1. sp1_human x egr1_human October 10, 2001 10:50 .. . . . . . 526 RGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCG 575 | | | .: : | :: | : : :. | |:| |||::|| | | 327 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQC..RICM…

Slide 1 © Wiley Publishing. 2007. All Rights Reserved. How Most People Use Bioinformatics Slide 2 Learning Objectives Get an overview of the most basic tools used in bioinformatics…

Slide 1 CSE 182: Biological Data Analysis Instructor: Vineet Bafna TA: Ryan Kelley www.cse.ucsd.edu/classes/fa05/cse182 Slide 2 Databases Biological databases are diverse…

Slide 1 Genomic Rearrangements CS 374 – Algorithms in Biology Fall 2006 Nandhini N S Slide 2 Motivation One of the keys to evolution. Detecting dynamics between members…

Slide 1 Previous Lecture: Sequence Alignment Concepts Slide 2 Introduction to Biostatistics and Bioinformatics Sequence Database Searching This Lecture Stuart M. Brown, Ph.D.…

Slide 1 © Wiley Publishing. 2007. All Rights Reserved. Searching Sequence Databases Slide 2 Learning Objectives Finding out why similarity searches are so important Understanding…

School B&I TCD Bioinformatics Database homology searching May 2010 Why search a Database To find homologous sequences to your unknown to determine function To find other…

School B&I TCD Bioinformatics Database homology searching May 2010 Why search a Database To find homologous sequences to your unknown to determine function To find other…

Database Searching with BLAST Previous Lecture: Sequence Alignment Concepts 1 Introduction to Biostatistics and Bioinformatics Sequence Database Searching This Lecture Stuart…

Bestfit Output sp1_human x egr1_human October 10, 2001 10:50 .. . . . . . 526 RGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCG 575 | | | .: : | :: | : : :. | |:| |||::||…