1. sp1_human x egr1_human October 10, 2001 10:50 .. . . . . . 526 RGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCG 575 | | | .: : | :: | : : :. | |:| |||::|| | | 327 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQC..RICM…

Slide 1Acc414 ATGGAGGCGGCTGCCATGGCCGTA---ACCGCAGCCACGGGGGCCTTGGCGCCCGTGCTA 57 Acc420 ATGGAGGCGGCTGCCATGGCCGTA---ACCGCAGCCACGGGGGCCTTGGCGCCCGTGCTA 57 Acc761 ATGGAGGCGGCTGCCATGGCCGTA---ACCGCAGCCACGGGGGCCTTGGCGCCCGTGCTA…

Slide 1Norovirus Testing: What Happens at The Lab Dr. Amy Woron [email protected] 615-262-6462 Molecular Biologist TN Dept. of Health Laboratory Services Slide 2 Norovirus…

Slide 1The rest of bioinformatics Prof. William Stafford Noble Department of Genome Sciences Department of Computer Science and Engineering University of Washington [email protected]…

Slide 11st Lecture Modern Methods in Drug Discovery WS10/11 1 Modern Methods in Drug Discovery Aims of this course: comprehensive knowledge about all processes in the drug…

Slide 1Molecular Replacement in CCP4 Martyn Winn CCP4 group, Daresbury Laboratory Slide 2 Data analysis before MR Matthews coefficient Number copies in a.s.u. Native Patterson…

Slide 11st Lecture Modern Methods in Drug Discovery WS08/09 1 Modern Methods in Drug Discovery Aims of this course: comprehensive knowledge about all processes in the drug…

Slide 1A Practical Introduction to Hidden Markov Models for Bioinformaticians Thomas R. Ioerger Department of Computer Science Texas A&M University Slide 2 HMM’s -…

Slide 1mandatory to put some order in such a vast wealth of structural knowledge 1 4. Nucleic acids and proteins in one and more dimensions - second part Slide 2 Taxonomy…

1.Alignment-based methods Needed if we have an unknown DNA or protein sequence. Purpose: To find sequences/regions ofsignificantsimilarity in a sequence repository or database.…