YOU ARE DOWNLOADING DOCUMENT

Please tick the box to continue:

Transcript
Page 1: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

Ecological speciation of a hybrid sunflower, Helianthus

anomalus

Yuval Sapir, Loren H. Rieseberg

Dept. of Biology, Indiana University,Bloomington, IN 47405, USA

Page 2: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

Pre-/post-zygotic isolating barriers - reduce gene-flow.

Niche shift promotes genomic differentiation (selection).

Selection against unfit hybrid progeny (reinforcement).

Ecological speciation

= Speciation facilitated by divergent

selection in contrasting environments

Page 3: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

Hybridization:

•Increases genetic variation and creates new combinations

•Complementary gene action

•Simultaneous change at multiple traits/genes

Role of hybridization in ecological speciation

If hybrid colonize different ecological habitat

Habitat-specific ecological selection promote hybrid speciation

Page 4: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.
Page 5: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

Helianthus annuus Helianthus petiolaris

Helianthus anomalus

Page 6: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

Distribution of hybrids & parental spp in the US

Page 7: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

Methods

• 96 individuals from each parental species (3 populations each)• 192 individuals from 4 populations of Helianthus anomalus• DNA extraction• Microsatellites markers from EST library• Preliminary survey 49 loci amplified in all 3 spp were chosen

Page 8: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

Indices for detecting selection footprint

)2(

)1(lnln

popVAR

popVARRV

1)2(1

1

1)1(1

1

lnln 2

2

popH

popHRH

Schlötterer C., 2002. Genetics 160:753-763

Schlötterer C. & Dieringer, D., 2005. in: Nurminsky D. (ed) Selective Sweep. Landes Bioscience, Georgetown, TX, pp 55-64

Genetic diversity -

Genetic variance -

H =gene diversity = expected heterozigosity

Page 9: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

Reduction in genetic variance or genetic diversity

Selective sweeps = hitch-hiking effect

Footprint of selection

Example from: Harr et al., 2002. PNAS 99(20):12949-12954

non-significant effect(95% interval)

significant reduction(P<0.05)

Page 10: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

Locus lnRV ano/ann lnRV ano/pet lnRH ano/ann lnRH ano/pet lnRV ano/PSP lnRH ano/PSP

279 0.370063306 -0.582473871 0.616871722 -0.665118053 -0.33558 -0.19432

283 -3.959820226 -4.342449119 -4.624676908 -3.384418966 -4.17432 -4.28447

285 -0.201700483 -0.460701278 -0.091107944 -0.496282049 -0.39421 -0.59403

289 -1.082327545 -0.901026376 -2.392140467 -1.874146478 -0.99647 -2.4265

313 -0.353491339 -0.668690377 -0.972340453 0.7922876 -0.54449 -0.52819

317 -2.211069594 -2.213149476 -2.25805302 -1.799079708 -2.23718 -2.28374

321 0.515002212 -0.750125252 0.531176522 -0.613313962 -0.35225 -0.257

323 -0.177087018 -1.402019453 -0.09917793 -2.04257327 -0.96884 -1.07669

324 -1.291081689 -1.169741318 0.347214221 1.100793562 -1.23441 0.69088

356 -3.090069816 -1.568625393 -0.403263699 -0.26715323 -2.60808 -0.35278

382 -1.645997933 -2.138230301 -2.485190161 -2.715321614 -2.22197 -3.21965

424 -5.841082394 -5.752628469 -2.316011577 -2.533400084 -5.79674 -2.47042

426 0.904128942 -0.149556001 -0.012490882 -3.561364411 -0.00308 -2.17582

429 -1.34775602 -1.832156726 -0.34592679 -0.578370591 -1.67122 -1.30204

439 -2.727556354 -1.004600964 -2.025595886 -0.483410193 -2.43943 -2.01536

440 -2.231910445 -1.733416744 -2.377568129 -1.082526042 -2.04003 -2.43532

441 -3.265653326 -1.101263355 -0.78466602 -0.430370161 -2.77961 -0.73815

446 -4.885154939 -3.293560928 -3.331557892 -1.181931246 -4.50563 -2.58138

451 -0.526901367 0.102891354 -2.537209852 -3.050925384 -0.28008 -2.8457

459 -2.445276465 0.399010384 -1.660772719 -2.119456688 -1.8683 -2.22423

466 -2.798428392 -1.332973231 -1.574383794 -1.253664018 -2.58618 -2.26334

520 0.0122101 -0.188976128 -0.464936489 -0.034136815 -1.04396 -1.40242

536 -1.261861746 -2.066244116 0.264362191 -1.999019143 -1.83283 -1.33293

538 1.798784834 2.398645674 1.162760445 0.24347485 1.80622 -0.26914

540 -0.199616395 0.827318193 -0.369147716 -0.379104687 0.14808 -0.49121

541 -2.682534099 -3.098202516 -3.027836248 -4.274103908 -3.14006 -4.0106

595 0.471601821 0.688469857 -0.013263357 -1.595789278 0.51352 -1.96624

612 -0.276136693 -0.738612043 -0.795295327 -1.657499122 -0.87573 -1.82525

615 0.521900569 -0.177102153 -0.084882787 -0.328026906 0.08111 -0.51209

621 -0.864374377 -1.374634628 -0.075610784 -0.509381005 -1.17825 -0.52207

668 -0.780715628 -0.614952751 -2.997374904 -3.079441486 -0.85056 -3.44805

677 -1.238041458 -2.516353793 -0.736806034 -1.425133687 -2.06577 -1.11932

692 -1.911487283 -2.447325171 0.507665556 -0.618505211 -2.40762 -0.7656

701 -1.774588809 -2.347849394 -3.494156724 -2.209051038 -2.11067 -3.57664

715 -7.573484869 -8.495438799 -8.964794845 -9.52644981 -8.10658 -9.5255

716 -3.413981133 -4.219405945 0.013514175 -2.148381915 -3.90258 -0.8879

732 -3.215636315 -3.136654452 -0.94256986 -2.155353082 -3.18543 -1.86963

739 -2.584307071 -3.971471926 -1.53976839 -2.409974258 -3.44103 -1.9973

765 -3.233822114 -4.160246433 -2.845909362 -3.91960935 -3.74782 -3.54954

772 -2.721618745 -3.083268656 -0.951886552 -0.836050438 -2.88519 -0.97619

813 -4.27710209 -4.380146113 -1.560635087 -2.885146452 -4.31745 -2.13002

815 -1.692166716 -3.025941688 -1.302680114 -1.867084736 -2.46333 -1.67498

834 -3.129918282 -3.570995678 -2.080027201 -2.374887972 -3.33086 -2.24646

848 -0.515982271 -1.095057596 -1.230462474 -1.209710918 -0.80583 -1.35894

854 -1.087410062 -1.642350663 -5.896708133 -5.846963648 -1.35952 -6.24423

953 -5.105017897 -5.42942434 -7.086745021 -6.520438521 -5.24619 -7.04584

985 -2.970893202 -2.552517359 -0.878278244 0.625854692 -2.81222 -0.37285989 -1.833147039 -1.466087702 -1.218420058 0.544332327 -1.69181 -0.60376998 -6.05431568 -5.728273309 -2.656400129 -0.281287565 -5.96192 -1.92316

lnRVlnRHano/ann2218ano/pet2220ano/PSP2623

PSP = pooled data from Parental Species; ano = H. anomalus ; ann = H. annuus ; pet = H. petiolaris

12 loci showed significant effect in both allele variance and genetic diversity

Results

Page 11: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

lnRV and lnRH distributionslnRV=difference in allele variance; lnRH=difference in gene diversity

Page 12: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

lnRV and lnRH distributionslnRV=difference in allele variance; lnRH=difference in gene diversity

r=0.561-10

-8

-6

-4

-2

0

2

-10 -8 -6 -4 -2 0 2

lnRV

lnR

H

Page 13: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

Reduced gene diversity and shared alleles

a

jaia ffps ,, ,min

-10

-8

-6

-4

-2

0

2

0 0.2 0.4 0.6 0.8 1

Proportion of shared alleles

lnR

H

Page 14: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

Gene function – locus HT424 as an example

lnRH = -2.47; 4 alleles in H. anomalus; 10 in parentsProportion of shared alleles: 0.85

Sequence:AACTTATACAATGTAGAGATATGGTTGTTCCAAAGAAGATTCAACGTAGTAATCCTTATGAAGAGCGTGTTCCTGTCGGATTGGCTATTGTTGCAGCAGTCATAGTTCGGTTACAGCTTGCAAATACTGCTGCTGGTGGAATTGAAACACATGTTGGTGGTTCTATGTTAGTTGATGTGGTTAACAGCTCGTGGCTGCAAGTTATTCTAGCCGGTGTTACTTGGTATCTCATTGGTCTGGCTGCGGTTGAGATTATAGCAGTCCTTCGAATAAAATCGAACGATATTGAAGAATGAATAAAATAGTATATATATACAGGTATGTAGTATGTATAGGTTAAGCTGTTATAGGAATCATATATTCATTATTATATACACTCTCGAAAGAAAGCTCAGTCAAGCGTATGTTCATTACCCCAAAAAAAATCTTTAAAGTCGGAACACAAAAAATGTCGGGGGAAAAAAAA

Putative translation:LIQCRDMVVPKKIQRSNPYEERVPVGLAIVAAVIVRLQLANTAAGGIETHVGGSMLVDVVNSSWLQVILAGVTWYLIGLAAVEIIAVLRIKSNDIEE*

BLAST results:DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana]

• Interact with heat-shock proteins• Can function as chaperones on their own• Role in targeting and folding of polypeptides• Regulation of gravitropism

Page 15: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

Summary and conclusion:

• Twelve of 49 loci exhibited significant reduction in variation compared to both parental species.

• The proportion of shared alleles is correlated with reduced variation.

• Genes exhibit footprint of selection may contribute to drought tolerance, heat tolerance, or deepening the root.

• Selection on ecologically important genes allowed H. anomalus to colonize desert sand dunes.

Page 16: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

Future directions

• Finer-scale hitch-hiking mapping to determine size of genomic regions affected by selective sweep

• Sequence analyses to confirm history of selection

• Functional analyses (correlations with QTLs, gene expression studies, transformations)

Page 17: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

University of GeorgiaBeau BrouilletteLisa Donovan

ThanksRieseberg lab, IUAmanda PostoBriana Gross Nolan KaneRebecca RandelYoko KakugawaZhao Lai

$upported by:

BARD-Vaadia post-doctoral fellowship

University of Veterinary Medicine, ViennaChristian SchlöttererDaniel Dieringer

Page 18: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.
Page 19: Ecological speciation of a hybrid sunflower, Helianthus anomalus Yuval Sapir, Loren H. Rieseberg Dept. of Biology, Indiana University, Bloomington, IN.

a a

b

0

0.1

0.2

0.3

0.4

0.5

0.6

Hano-Hann Hano-Hpet Hann-Hpet

Pro

porti

on o

f sha

red

alle

les

Kruskal-Wallis Test: 22=45.95; P<0.001; Paired tests - Wilcoxon Sign Ranked

a

jaia ffps ,, ,min

Proportion of shared alleles with parental species


Related Documents