APPLICATIONS OF PCR IN MYCOLOGY Applications of PCR in Mycology Edited by P.D. Bridge CABI BIOSCIENCE UK Centre, Egham, UK D.K. Arora Centre for Advanced Study in Botany,…

Slide 1Web 2.0: the Impact of Bottom- Up Research Innovation Eric T. Meyer and Lucy Power Oxford Internet Institute Oxford e-Social Science Project Slide 2 Technology in…

1. 1DIRECTED EVOLUTION BY in vitroRECOMBINATIONINTRODUCTION:Two distinct ways to engineer proteins have appeared during the last few decades. Theseinclude a rational protein…

Slide 1 SEQUENCING-related topics 1. chain-termination sequencing 2. the polymerase chain reaction (PCR) 3. cycle sequencing 4. large scale sequencing stefanie.hartmann @…

Slide 1 Thermus AQuaticus DNA polymerase SEQUENCE: MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPED FPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPG…

Slide 1 7 and 9 February, 2005 Chapter 8 Recombinant DNA and Genetic Engineering Genetic manipulation Slide 2 Overview Recombinant DNA technology exploits features of genes,…

Slide 1 Polymerase Chain Reaction: Diagnostic Application Roche By Salwa Hassan Teama Slide 2 Polymerase Chain Reaction: Diagnostic Application By Salwa Hassan Teama M.D.…

Polymerase Chain Reaction PCR PCR PCR allows for amplification of a small piece of DNA. Some applications of PCR are in: forensics (paternity testing, crimes) identification…

Polymerase Chain Reaction 1998 PCR Evolution The future is amplifying! 1985 First publication of PCR by Cetus Corporation in Science (R. Saiki, S. Scharf, F. Faloona, K.…

CELL CELL Building blocks of life Chemical system able to maintain its structure and reproduce Cells  tissues  organs Organism PROKARYOTES Primitive organisms Rigid…