Renault Clio Owners Manual 2001

WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page CVlCLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03-page1WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page CV2CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03-page2RENAULT recommendsWWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page 0.02CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03-page40.02BriefoverviewTyrepressures ......................................................................................................... 0.04Adjustingtheseatsanddrivingposition.............................................. 1.10 1.12Childrestraints .......................................................................................... 1.22 1.26Warninglights............................................................................................ 1.30 1.45Hornandheadlampflash......................................................................... 1.46 1.50De-icing/Demisting ................................................................................................. 1.52Runningin,driving................................................................................... 2.02 2.10Heating/Airconditioning.......................................................................... 3.04 3.09Openingthebonnet ............................................................................................... 4.02Levels(engineoil,windscreenwasher,etc.) ......................................... 4.03 4.10Emergencysparewheel ............................................................................ 5.02 5.05Practical advice (changing the bulbs, fuses, repairs, troubleshooting) .. 5.02 5.33WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page 0.03CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03-page50.03C O N T E N T SSections1234567Gettingtoknowyourcar .....................................................................Driving ...............................................................................................................Yourcomfort .................................................................................................Maintenance ..................................................................................................Practicaladvice ...........................................................................................Technicalspecifications ........................................................................Alphabeticalindex ....................................................................................WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page 0.04CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03-page60.04TYREPRESSURESWHENCOLD(in bar)Versions 1.2 1.2 16V 1.4 1.4 16V 1.5 dCiType(see vehicle identification plate)LB0F LB11 LB0BLB03 - LB17LB0P - LB2ALB13 - LB2BLB07Normal use Front 1.9 1.9 2.2 2.3 2.2 Rear 1.8 1.8 2.2 2.0 2.0Full load (1) Front 2.0 2.0 2.3 2.4 2.3 Rear 2.0 1.9 2.3 2.1 2.1Spare wheel 2.0 2.0 2.3 2.4 2.3Size of wheel rims 5.5 J 14 5.5 J 145 B 135.5 B 135.5 J 14 5.5 J 14Tyre sizes 175/65R14 175/65R14155/80R13175/70R13175/65R14175/65 R14WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page 0.05CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03-page70.05Tyre pressures when cold(in bar) (continued)Tyre safety and use of chainsRefer to the information on tyres in section 5 for advice on tyre maintenance and, depending on the version, the use ofchains.(1) Special note concerning vehicles used at full load (maximum permissible all-up weight) and towing a trailerUnderthesecircumstances, themaximumspeedmust berestrictedto60mph(100km/h) andthetyrepressureincreased by 0.2 bar.Refer to the Weights paragraph in section 6 for more details.WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page 0.06CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03-page80.06WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.0lCLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03-page91.01Section1:GettingtoknowyourcarKeys......................................................................................................................................................... 1.02 - 1.03Doors ..................................................................................................................................................... 1.04 1.06Engine immobiliser system.............................................................................................................................. 1.07Head restraint - Seats .......................................................................................................................... 1.08 1.10Seat belts/Methods of restraint in addition to the front seat belts ................................................. 1.11 1.21Child safety ........................................................................................................................................... 1.22 1.26Clock.................................................................................................................................................................. 1.27Rear view mirrors .................................................................................................................................. 1.28 - 1.29Driving position..................................................................................................................................... 1.30 - 1.31Instruments........................................................................................................................................... 1.32 1.45Lighting and external signals ................................................................................................................ 1.46 - 1.47Headlight beam adjustment .................................................................................................................. 1.48 - 1.49Horn and headlamp flash................................................................................................................................ 1.50Windscreen wipers ........................................................................................................................................... 1.51De-icing/Demisting ........................................................................................................................................... 1.52Fuel tank (filling with fuel) .................................................................................................................. 1.53 - 1.54WWW.MANUALS.WS WWW.MANUALS.WS 213NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.02CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 101.02KEYS/RADIOFREQUENCYREMOTECONTROL1 Coded key for ignition switch,doors and fuel filler cap.Never leave your carwith the ignition on andcontainingachildorananimal as the child couldstart the engine or operateelectrical equipment, forexampleelectricwindows, andcould trap part of its body (neck,arm, hand...). Risk of seriousinjury.2 Plipremotecontroldoorlockingunit, ignitionkey, keyfor doorsand fuel filler cap.The plip remote control unit 2 isused to lock and unlock the doors.It is suppliedwithpower byabatterywhichmust bereplacedwhen the battery warning light 3nolonger lightsup(refer tothefollowing paragraph).Remote control operatingrange"This varies according to theenvironment: therefore take carewhenhandlingtheremotecontrolthatyoudonotinadvertentlylockor unlock the doors.Locking/unlocking the doorsPress the remote control forapproximately one second to lock orunlock the doors. (Indicator light 3will light up.)- The hazardwarning lights flashtwice toindicate that the doorshave been locked.Note: Depending on the vehicle, ifeither a door or tailgate is open ornot properlyclosedor if a rearinterior light remains in thecontinuous lighting position(see information on interiorlightsinsection3), the hazardwarning lights will not flash.- The hazardwarning lights flashonce to indicate that the doorshave been unlocked.WWW.MANUALS.WS WWW.MANUALS.WS 12NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.03CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 111.03KEYS/RADIOFREQUENCYREMOTECONTROL(battery)Note: On certain cars, if a door is notopened within approximately30 seconds of the doors beingunlocked using the remote control,the doors will lock againautomatically.InterferenceInterferencemaybecausedtotheoperationoftheremotecontrolbyfactors in the immediate vicinity(external installations or the use ofequipment operating onthe samefrequency as the remote control).If aplipremotecontrol hasbeenlost orif youneedanotherset ofkeys or a plip remote control unit,contact your Renault Dealer as onlyhe can help. If a remote control unit isreplaced, it will benecessarytotake the car to your Renault dealeras the car and the unit are neededtogether for initialisation. It is not possible to use more thantworemotecontrolunitsforonecar. Make sure the batteries are alwaysingoodcondition; theyhave aservice life of approximately twoyears.Replacing the batterySlide the cover on the remotecontrol 1.The batteries can be obtainedfrom your Renault Dealer. Thesebatteries shouldlast about twoyears.Adelayof1secondisrequiredbetweenlockingandunlockingactions.Replacethebattery2asshownonthe cover.Note: It is advisable not to touch theelectroniccircuit inthekeycoverwhen replacing the battery.WWW.MANUALS.WS WWW.MANUALS.WS 12354NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.04CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 121.04OPENINGTHEDOORSOpening the doors from theoutsideFront: Use the key to unlock one ofthefront doorlocks2. Placeyourhand behind the handle 1 and pullit towards you.Rear: Depending on the version,openingthedriver door opensallfour doors, if not reach inside, raisethedoorlock/unlockbutton3andoperate the door handle.Openingthedoorsfrominsidethe carMove handle 4.Childproof locksThese make it impossible for therear doors tobeopenedfromtheinside. Movelever5oneachdoorand check from the inside that bothdoors are securely locked.WWW.MANUALS.WS WWW.MANUALS.WS 12NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.05CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 131.05LOCKINGTHEDOORSManual lockingFront: From outside the car, use thekey, whichwill lockall fourdays(depending on the version), or frominside, push down the doorlock/unlock button 1.Rear: Pressdownknob1ineachdoor.Electric central lockingThis enables the four doorsand the luggage compartmentto be locked or unlockedsimultaneously.Presstheredspot onswitch2tolock the doors.Thefront doormechanismcannotbe locked if the door is open.If youdecidetokeepthedoors locked when you aredriving, remember that itmaybe more difficult forthose assisting you to gain access toyourcarintheeventofanemergency.WWW.MANUALS.WS WWW.MANUALS.WS 1NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.06CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 141.06AUTOMATICDOORLOCKINGWHENDRIVINGFirst decidewhetheryouwishtoactivate this function.To activate itWith the ignition on, press thecentral door locking button 1 on thelocking side (padlock side) for about5 seconds, until you hear the beep.To deactivate itWith the ignition on, press thecentral door locking button 1 on theunlocking side (opposite thepadlock) for approx. 5 seconds,until you hear the beep.If you decide to keep thedoors lockedwhenyouare driving, rememberthat it may be moredifficult forthoseassistingyouto gain access to your car in theevent of an emergency.Operating principleWhen the car moves off, the systemautomatically locks the doors assoon as a speed of 4 mph (6 km/h) isattained. The indicator light onbutton 1 will illuminate.The door is unlocked- by opening a front door.Note: If areardoorisopened, itwill automatically be locked againwhenthecarreachesaspeedofapprox. 4 mph (6 km/h).- by pressing the door unlockingbutton 1.Operating faultsIf younote a fault (noautomaticlocking, indicator lightincorporatedinthebutton1doesnotilluminatewhenthedoorsarelocked...), first checkthat that allthe doors are properly closed. Iftheyareproperlyclosedcorrectly,consult your Renault Dealer.Also make sure that locking has notbeen inadvertently deactivated. Ifthis is the case, switch the ignitionoff and on again and reactivate it asdescribed above.WWW.MANUALS.WS WWW.MANUALS.WS 12NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.07CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 151.07ENGINEIMMOBILISEROperating principleThe car is automatically protecteda fewseconds after the key isremoved from the ignition.Whentheignitionisswitchedon,indicator light 1illuminates for afew seconds and then goes out.The car has recognised the code andthe engine can be started.If the car does not recognise theignitionkeycode,indicatorlight1will flash continuously and theengine will not start.This prevents the car being drivenby anyone not in possession of thecar's coded ignition key. Light indicatingthat theengineimmobiliser is operational.When the ignition is switched on,indicator light 1 comes on forapproximately three seconds andthen goes out. You can then startthe engine. Car protection indicator lightAfewsecondsaftertheignitionhasbeenswitchedoff, indicatorlight 1 will flash continuously.The car will not be protected untilthe key is removed from theignition. System malfunction warninglightIf warning light 1 continues toflash or remains illuminatedcontinuously after the ignition isswitched on, it indicates that thesystem is not operating correctly.If warninglight 2flashes whenthe car is being driven and isdecelerating or at idling speed, itindicates that thesystemis notoperating correctly.Use the second key (supplied withthe car). If you do not have access tothis, it is essential to call a RenaultDealerbecauseonlydealersintheRenault network are qualified torepair the engine immobiliser.Anyunauthorisedworkcarried out on the engineimmobiliser (computers,wiring, etc.) could bedangerous. It must be carried outby trained Renault networkpersonnel.WWW.MANUALS.WS WWW.MANUALS.WS ABNU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.08CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 161.08FRONTHEADRESTRAINT To adjust the height:Simply slide it up. To remove the head restraint:Press the tabs A and B of the headrestraint guides. To replace the head restraint:Insert therods intothesleeves,with the notches to the front, andlower the headrestraint to thedesired height.The head restraint isimportant for safety. Ensurethat it is in place and in thecorrect position. Thedistance between your head and thehead restraint should be as small aspossible. The top of your headshould be in line with the top of thehead restraint.WWW.MANUALS.WS WWW.MANUALS.WS BA ABNU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.09CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 17q1.09REARHEADRESTRAINTTo adjust the heightSimply slide it up.To removePress the tabs A and Bof the headrestraint guides.To refit the head restraintInsert the rods into the sleeves, withthe notches to the front, and lowerthe head restraint to the desiredheight.Adjustment of the rear centrehead restraint To adjust the height:Simply slide it up. To remove the head restraint:Press the tabs A and B of the headrestraint guides. To replace the head restraint:Insert therods intothesleeves,with the notches to the front, andlower the headrestraint to thedesired height.Storage positionWhen completely lowered, thehead restraint is in the storageposition: it must not be used when apassenger is sitting in the rear centreseat.The head restraint isimportant for safety.Ensure that it is in placeand in the correctposition. Thedistancebetweenyour head and the head restraintshouldbeassmall aspossible.Thetop of your head shouldbeinlinewiththetopoftheheadrestraint.WWW.MANUALS.WS WWW.MANUALS.WS 321NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.l0CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 181.10FRONTSEATSTo move forwards or backwardsLift lever 2 to unlock the seat.Release the lever inthe requiredposition and ensure the seat islocked in place.To raise or lower the driver's seatMove lever 1.To tilt the seatbackTurn the wheel 3 and tilt theseatback to the desired position.For safety reasons, onlyadjust theseats whenthecar is stationary.WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.llCLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 191.11SEATBELTSAlways wear your seat belt whentravelling in your car. You must alsocomply with the local legislation inthe particular country you are in.Before driving off:- First ensure that your drivingposition is correct.- Then adjust your seat belt toprovide maximum protection.Adjusting your driving positionSit with your back firmly againstthe seatback.This is essential to ensure thatyourlumbarvertebraeareinthecorrect position.Adjust thedistancebetweentheseat and the pedals.Your seat should be as far back aspossiblewhilestill allowingyoutodepresstheclutchpedalfully.Theseatbackshouldbeadjustedso that your arms are slightly bentwhen you hold the steering wheel.Adjustthepositionofyourheadrestraint.For maximumsafety your headshouldbeascloseaspossibletothe head restraint.Adjust the height of the seat.This adjustment allows you toselect the seat position whichoffers you the best possible vision.Adjust the position of the steeringwheel.It is advisable not to tilt theseatback too far back toensure correct operation ofthe seat belts.Make sure the seatback iscorrectly locked in position.You are advised not to putanything on the floor in thedriver's footwell under heavybraking asit couldslide underthe pedals and prevent their safeoperation.Incorrectly adjusted seatbelts may cause injuries inthe event of an accident.Even pregnant womenshould wear a seat belt. In this case,ensure that the lap belt is notexerting too much pressure on theabdomen.WWW.MANUALS.WS WWW.MANUALS.WS 6453123NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.l2CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 20q1.12SEATBELTS(continued)Adjusting the seat beltsSit with your back firmly against theseatback.Theshoulderstrap1shouldbeasclose to the base of the neck aspossible but not on it.The lap strap 2 should be heldfirmlyoverthethighsandagainstthe pelvis.The belt should be worn so that it isas close to the body as possible, i.e.avoid wearing heavy clothing,having bulky objects under the beltsor reclining the seatbackexcessively, etc.Adjusting the front seat beltshoulder strap heightPress button 6 to select the positionyou require so that the shoulderstrap 1 is worn as described above.Make sure that the belt is locked inpositioncorrectlyonceithasbeenadjusted.To fastenUnwind the belt slowly andsmoothlyandensurethebuckle4locks into the housing 3 (check it islocked by pulling on the buckle 4).If the belt jams, allow it to run backbefore attempting to unwind itagain.If your belt becomes completelyjammed:- Pull the belt slowly but firmly sothat just over an inch (3 cm)unwinds.- Then allowthe belt to rewindautomatically.- Unwind it again.- If the problempersists, consultyour Renault Dealer.UnlockingPress button 3 on catch 5. The beltwill rewind itself.Guide the buckle to help theoperation.WWW.MANUALS.WS WWW.MANUALS.WS 1NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.l3CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 21q1.13METHODSOFRESTRAINTINADDITIONTOTHEFRONTSEATBELTSThese are:OSeat belt pretensioners.OForce limiter.OAir bags for driver and frontpassenger.Thesesystemsareprovidedtoactindependently or together when thecar is subjected to a frontal impact.There are three possibilities,depending on the force of theimpact:- protection is provided by the beltonly;- the pretensioner is triggered torectifybelt positionandtakeupplay in the belt;- if the air bag and force limiter aretriggered, they provide additionalprotection in the event of the mostsevere impact.OSide air bags are provided toactivateintheeventofasevereside impact.Front seat belt pretensionersThis systemis only operationalwhen the ignition is switched on.If the car is subject to a severefrontal impact, piston 1immediatelyretracts the seat beltbuckle pulling the seat belt tightagainst the body and therebyimproving its efficiency. Have the entire restraintsystemcheckedfollowingan accident. No work whatsoever may beperformed on the pretensionersystem (computer, wiring, etc.). OnlyqualifiedRenaultNetworkpersonnel may work on thepretensioner systemto preventincorrect triggering of the systemwhich may cause injury. Theelectrictriggersystemmayonly be tested by a speciallytrainedtechnicianusingspecialequipment. When scrapping your car,contact yourRenault Dealerfordisposal of the gas generator.WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.l4CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 221.14METHODSOFRESTRAINTINADDITIONTOTHEFRONTSEATBELTS(continued)Force limiterAbove a certain severity of impact,this mechanism is used to limit theforce of the belt against the body sothat it is at an acceptable level.Warningconcerningtheservice life of the airbagsThepyrotechnicsystemsinairbags andpretensioners have alimited service life. Thesesystemsmust bereplacedeachtime they are activated but at thelatest after they have been inservicefor10years. Thisworkmust always be undertaken by aRenault Dealer.Theseat belt pretensionersandthe air bag operate together. Ifone of the systems has passed thedate when it is due for renewal, itwill alter the overall safetyprotection provided.Air bags for the driverand front passengerThese may be provided for thedriver and the front passenger.Thepresenceof thisequipment isindicated by the words Air bag onthe steering wheel and thedashboard,andalabelonthebaseof the windscreenor onthe sunvisor.WWW.MANUALS.WS WWW.MANUALS.WS 1NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.l5CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 23q1.15METHODSOFRESTRAINTINADDITIONTOTHEFRONTSEATBELTS(continued)Air bags for the driverand front passenger(continued)Each air bag system consists of:- An air bag and gas generator fittedin the steering wheel for the driverand in the dashboard for the frontpassenger.- A computer for both systems,which includes the impactdetector and a monitor controllingthe electrical trigger system for thegas generator.- Asinglewarninglight 1ontheinstrument panel.OperationThe system is only operationalwhentheignitionis switchedon(ignition key in position M:Ignition on).If a severe frontal impact occurs, theair bag(s) inflate(s) in approximately30 milliseconds, cushioning theimpactofthedriver'sheadagainstthe steering wheel and the frontpassenger's head against thedashboard. The air bag then deflatesimmediately so that the passengersare not impeded in any way as theyget out of the car.The air bag system uses theprinciples of pyrotechnics. Thisexplains why, when the air baginflates, it will generate heat,produce smoke (this does not meanthat afire is about tostart) andmake a noise upon detonation. In asituation where an air bag isrequired, it must inflateimmediately andthis may causesomeminor,superficialgrazingtothe skin.FaultsWarninglight1illuminatesontheinstrument panel when the ignitionis turned on and then goes out aftera few seconds.If it doesnot illuminatewhentheignition is turned on or if it flashes,there is a fault in the system.Consult your Renault Dealer as soonas possible. Your protection will bereduced until this problem isrectified.WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.l6CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 241.16METHODSOFRESTRAINTINADDITIONTOTHEFRONTSEATBELTS(continued)All the warnings below are given so that, if the air bag is activated, it is not obstructed in any way and also to prevent therisk of serious injuries caused by items which may be dislodged when the air bag inflates.The air bag is designed to complement the action of the seat belt. Both the air bags and seat belts are integralparts of the same protection system. It is therefore essential that the seat belt is worn at all times. If seat belts arenot worn, the occupants are exposed to the risk of serious injury in the event of an accident. The risk of minorsuperficial injuries occurring when the air bag is deployed may also increase, although such minor injuries arealways possible with air bags.The air bag does not offer protection against light or moderate frontal impacts, side or rear impacts or if the car turnsover.Air bags for driver and passenger Noworkormodificationwhatsoevermaybeperformedonanypartofthedriverandpassengerairbagsystem(computer, wiring, etc.) except by qualified Renault network personnel. To ensure that the system is in good working order and to avoid incorrect triggering of the system which may causeinjury, only qualified Renault Network personnel may work on the air bag system. As a safety precaution, have the air bag system checked if your car has been involved in an accident, is stolen orbroken into. When selling or lending the car, inform the user of these points and hand over this handbook with the car. When scrapping your car, contact your Renault Dealer for disposal of the gas generator(s).WWW.MANUALS.WS WWW.MANUALS.WS 1NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.l7CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 25q1.17METHODSOFRESTRAINTINADDITIONTOTHEFRONTSEATBELTS(continued)All the warnings below are given sothat, if the air bag is activated, it isnot obstructed in any way and alsoto prevent the risk of seriousinjuries caused by items which maybe dislodged when the air baginflates.Warnings concerning the drivers air bag Do not modify either the steering wheel or the steering wheel boss. Do not cover the steering wheel boss. Do not affix any objects (badge, logo, clock, telephone bracket, etc.) to thesteering wheel boss. Thesteeringwheel must not beremoved(except byqualifiedRenaultnetwork personnel). Do not sit too close to the steering wheel. If you sit with your arms slightlybent (see Adjusting your driving position in section 1), it will ensure thatthere is sufficient space for the air bag to inflate properly and to be fullyeffective.Warnings concerning the passenger air bag: location 1 Do not attach or glue any objects (pins, logo, clock, telephone mounting,etc.) to the dashboard in the proximity of the air bag housing. Do not place anything between the dashboard and the passenger (animal,umbrella, walking stick, parcels, etc.). The passenger must not put his or her feet on the dashboard or seat as thereis a risk that serious injuries may be sustained. As a general rule, keep allparts of the body (knees, hands, head, etc.) well away from the dashboard.IT IS FORBIDDEN TO FIT A REAR-FACING CHILD SEATON THE PASSENGER SEAT WHEN THE CARIS FITTED WITH A PASSENGER AIR BAG.WWW.MANUALS.WS WWW.MANUALS.WS 1 1NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.l8CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 261.18METHODSOFRESTRAINTINADDITIONTOTHEFRONTSEATBELTS(continued)Side air bagsThis air bag maybe fittedtothefront seatsandisactivatedat thesides of the seats (door side) toprotect the occupants in the event ofa severe side impact.The markings 1 on the windscreenwill remind you of the presence ofthis equipment.Thissystemwill onlyoperateif asevere side impact occurs.Warnings concerning theside air bag Fittingseatcovers: seatsequipped with an air bagrequire special coversspecifically designed for yourcar. Consult your Renault Dealerto find out if these covers may bepurchasedfromRenaultoutlets.The use of any covers other thanthose designed for your car (andincluding those designed foranother car) may affect theoperationof theseair bagsandreduce your protection. Do not place any accessories,objects or even animals betweenthe seat back and the door. Thismay prevent the air bag fromoperating correctly or causeinjury if the air bag is deployed. No work or modificationwhatsoever may be performed onthe seat except by qualifiedRenault network personnel.WWW.MANUALS.WS WWW.MANUALS.WS 1243342NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.l9CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 271.19REARSEATBELTSRear side seat belts 1The belts are locked, unlocked andadjustedinthe same way as thefront belts.Manually adjusted lap beltThebeltsarelockedandunlockedinthesamewayastheinertia-reeltype belts.Adjusting the lap belt To tighten, pull on the free end 3of the belt. To slacken the belt, tilt adjustingbuckle 4 upwards and pull on lapstrap 2 whilst pressing the buckle.Make sure that the rear seatis locked in positionproperly so that the seat beltswill operate efficiently.Refer to the information on the rearseat in section 3.WWW.MANUALS.WS WWW.MANUALS.WS 15243NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.20CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 28q1.20REARSEATBELTS(continued)Rear centre beltUnwind the belt slowly fromposition 1.Fastentheblackbuckle2intotheblack housing 3.Fasten the last sliding buckle 4 intothe red housing 5.Special point concerning cars witha split rear seatIf you have to fold down the part ofthe rear seat behind the frontleft-hand seat:- raisetheseatcushionagainstthefront seat;- inserttheblackbuckle2intotheblack housing 3;- lower the seatback (after removingthe head restraint).Then fasten the last sliding buckle 4into the red housing 5.WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.2lCLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 29q1.21SEATBELTSThe following information applies to both the car's front and rear seat belts. Nomodificationmaybemadetothecomponent partsoftherestraintsystem(beltsandseatsandtheirmountings) fitted originally.Consult your Renault Dealer for special applications (e.g. fitting child seats). Do not use any devices which give any play in the belts (clothes pegs, clips, for example). Never wear the shoulder strap under your arm or behind your back. Never use the same belt for more than one person and never hold a baby or child on your knees with your seat beltaround them. The belt should never be twisted. The seat belts must be replaced following a serious accident. Likewise, have your seat belts replaced as soon as theyshow any signs of wear. Take care that the seat belts are correctly positioned so that they can be used properly when refitting the rear benchseat. If necessary, re-adjust the position and tension of the belt.WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.22CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 301.22CHILDSAFETYIn all countries there are regulationsgoverning the use of restraintsystems for children and babies.In Europe, children under 12 yearsof age or a height of less than1.50 m(1)(approx. 5 ft) must travelin an approved seat that is suitablefor the height andweight of thechild.The driver is responsible forensuring that this equipment isused correctly.Remember that a collision at30 mph (50 km/h) is the same asfalling from a height of 10metres. Expressed in other terms,transporting a childwithout arestraint is the equivalent ofallowing him or her to play on athird-floor balconywhichdoesnot have any railings.(1) Always comply with the laws of thecountry in which you are travelling.They may be different to theguidelines in this handbook.Under no circumstancesshould babies or children beallowedtotravel sittingonthe knees of anotherpassenger in the car.If a head-on collision occurs at 30mph (50 km/h), the resultingmomentum of a child weighing 30kg (66 lbs) will be the same as thatof a one tonne projectile: you willfind it impossible to hold the child,even if you yourself are wearing abelt.Itisparticularlydangeroustoputthe belt round your child when heor she is sitting on your knee.Never usethebelt for morethanone person at the same time.Child restraints for which approvalwas obtained after January 1992offeramuchhigherlevelofsafetythan those approved before thatdate.Itisthereforeadvisabletoselectachildrestraint that complies withEuropean regulation ECE 44.Restraints that comply with thislegislation must be marked with anorange label bearing the letter Efollowed by a number (whichstandsfor thecountrywhereit istype approved) and the year inwhich the type approval wasgranted.The standard classifies childrestraints in five categories:Category 0: from 0 to 10 kg (0 to 22 lbs)Category 0+: from0 to 13 kg (0 to 28 lbs)Category 1: from9 to 18 kg (20 to 40 lbs)Category2: from15to25kg (33to55lbs)Category3: from22to36kg (48to80lbs)WWW.MANUALS.WS WWW.MANUALS.WS 1 2NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.23CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 311.23CHILDSAFETY(continued)The right choiceThesafetyofyourchildrenisalsoyour responsibility.Toensurethat your childhasthemaximumpossibleprotection, werecommend that you use seatsobtained from a Renault Dealer.Restraint systems for all thecategories are available. Thesesystems have been developedin consultation with themanufacturers and have been testedin Renault vehicles.Consult your Renault Dealer andask him to help you install it.Category 0 and 0+A child's neck is very susceptible toinjury up to the age of two. There is arisk that a child in a front-facingseat will sustain neck injuries in theevent of afrontal collision. Renaulttherefore recommends a rear-facingseatgivingall-roundprotectionandfitted with a safety harness (figure 1).Category 1Between the ages of 2 and 4, achild's pelvis is not fully developed.Restraints using the car'sthree-point belts arenot adequateand there is a risk that the child willsustainabdominal injuries intheevent of a frontal collision. Itis therefore advisable to userear-facingseats(figure1), bucket-typeseats(figure2) or seatswithharnesses.Toavoidanyrisktoyour safety, werecommendthat youuseRENAULT approved accessories because they are suitable for yourcar and are the only accessories for which RENAULT will provide awarranty.WWW.MANUALS.WS WWW.MANUALS.WS 3 4NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.24CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 32q1.24CHILDSAFETY(continued)Category 2 (15 to 25 kg)(33 to 55 lbs)Thetypeofrestraintmostsuitablefor the pelvis of a child agedbetween 4 and 7 is one that can becombinedwitha three-point seatbelt. This is a booster seat (figure 3)withbeltguidestoensurethatthebelt will be worn flat over the thighsof the child.A booster seat with a height-adjustable seatback and a belt guideare recommended as this will allowthebelttobewornasclosetothebase of the neck as possible but notonit. Abucket-typeseat(figure4)must be used for cars where the rearcentre seat is equipped with atwo-point belt.Category 3For children aged over seven, abooster seat with belt guides isrecommended to ensure that thecar's three-point seat belt will beworn flat over the child's thighs.A booster seat with aheight-adjustable seatback and abelt guide are recommended as thiswill allowthebelt tobewornasclose to the base of the neck aspossible but not on it.If a booster seat without a seatbackis used(figure 4), the car's headrestraint must be adjusted to suit thechild's stature; the upper edge of theheadrestraintmustbeatthesameheight as the top of the child's headand should never be lower than thelevel of the child's eyes.WWW.MANUALS.WS WWW.MANUALS.WS 5 6 7NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.25CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 331.25CHILDSAFETY(continued)DANGERIt is forbidden to install a rear-facing baby/child seat on the frontpassenger seat if the car is equipped with a passenger air bag. Thechild may suffer very serious injuries if the air bag inflates.You are reminded about these instructions by label 5 (on the dashboard),label6(onthefrontpassengerwindow)andlabel7(onthesunvisor).WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.26CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 341.26CHILDSAFETY(continued)CHILD SAFETY No modifications may be made to the originally fitted parts of the restraint system (belts and seats and theirmountings). Follow carefully the fitting instructions provided by the manufacturer of the restraint system. Always avoid dressing the child in bulky garments and do not place any objects between the child and the restraintsystem. The seat belt in the car must be taut so that the child's seat is held in position securely. Check the tension regularly. Never pass the belt under the arm or behind the back. The harness or belt should be taut and fitted to suit the child's stature. Never allow your child to stand up or kneel on the seats while the car is moving. Check that the child is in the correct position for the entire journey, particularly when he or she is asleep. Use the seat belts to hold the seat in position, even if it is not occupied. Otherwise, if an accident were to occur, it maybecome dislodged and pose a risk to other car occupants. Have the seat belts and restraint systems in use at the time of a serious accident checked. Never leave a child unsupervised in a car, even if he/she is in a restraint device. Activate the rear door locks (if your car is equipped with these). Make sure the child does not get out of the car at the side where there is traffic. Set your children a good example - always wear your seat belt.WWW.MANUALS.WS WWW.MANUALS.WS 143265NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.27CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 351.27CLOCKSetting the clockWiththeignitionon, deselect theradio function.Pressbutton2(DSP)andbutton4(SEL) simultaneously until you heara beep. You can then set the time.To skipthroughthe hours, pressbutton 1 (forward arrow).Toskip through theminutes, pressbutton 3 (back arrow).Setting the clockWith the ignition on, select display6 showing total mileage and clock.Therearetwomethodsforsettingthe time:- one long press on button 5 allowsyoutoscroll throughthe hoursand minutes quickly;- short presses onbutton5allowyou to set the time minute byminute.If the electrical supply is cut(battery disconnected, feed wirebroken, etc.), theclockwillnotdisplay the correct time.The clock must be reset.For your safety, we recommendthat you do not carry outcorrections while driving.WWW.MANUALS.WS WWW.MANUALS.WS 11B A2CDENU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.28CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 361.28REARVIEWMIRRORSExternal rear view mirrors withmanual adjustmentMove lever 1 to adjust the mirror.For safetyreasons, onlyadjust the mirror whenthe car is stationary.The driver's side externalrear view mirror may havetwo clearly differentiatedzones.ZoneBis what cannormallybeseeninaconventional rear viewmirror. For your safety, zone Aincreasestheareayoucanseeatthe rear and to the side of your car.TheobjectsinzoneAlookmuchfurther away than they really are.Electrically operated externalrear view mirrorsWith the ignition on, turn knob 2:- PositionCtoadjusttheleft-handrear view mirror- Position E to adjust the right-handrear view mirrorD is the central neutral position.WWW.MANUALS.WS WWW.MANUALS.WS 21NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.29CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 37q1.29REAR-VIEWMIRRORS/STEERINGWHEELInterior rear-view mirrorThis is adjustable. Lower the smalllever 1 located behind the rear-viewmirror when driving at night toavoid being dazzled by theheadlights of the car behind.For safetyreasons, onlymake these adjustmentswhen the car isstationary.Adjusting the steering wheelOn certain cars, the position of thesteering wheel is adjustable.Raise lever 2 and place the steeringwheel in the desired position; lowerthe lever to lock the steering wheel.WWW.MANUALS.WS WWW.MANUALS.WS 1 2 3 4 5 6 7 8 9 10 11 1229 28 27 26 25 24 15 14 1321 20 19 18 17 162322NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.30CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 381.30DRIVERSLAYOUT,LEFT-HANDDRIVEWWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.3lCLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03-page391.31DRIVERSLAYOUT,LEFT-HANDDRIVE(continued)The presence of the equipment described below depends on the car version, equipment option and country.1 Demister outlet for left-handside window2 Left-hand side vent3 Stalk for: Direction indicators External lighting Front fog lights Rear fog lights Horn4 Control instruments5 Driver's air bag location6 Radio remote control7 Windscreen wiper/washerstalk8 Centre air vents9 Stowage compartment10 Passenger air bag location11 Right-hand side vent12 Demister outlet for right-handside vent13 Stowage compartment14 Positionfor radioor blankingcover15 Air conditioning controls16 Electric door locking switch17 Passenger window riser control18 Hazard warning lights switch19 Handbrake20 Ashtray21 Gear lever22 Driver's side electric windowcontrol23 Cigarette lighter24 Ignition switch25 Steering wheel height adjuster26 Stowage27 Controls for: Electric headlight beamadjustment Heated rear screen Electric rear view mirror28 Bonnet release29 Fuse boxWWW.MANUALS.WS WWW.MANUALS.WS 1 2 3 4 5 6NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.32CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 40q1.32INSTRUMENTPANELIf these warning lights light up, you must stop as soonas traffic conditions allow.+WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.33CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 411.33INSTRUMENTPANEL(continued)Thepresenceandoperationof thewarningandindicatorlightsdescribedbelowdependonthecar'sequipment and the country.1 Fuel gauge2 Low fuel level warninglightIt goes out as soonasthe engine is running.If it illuminates or remainsilluminated, fill up with fuel assoon as possible.Not usedRear screendemistingindicator lightFront fog lightindicator lightRear fog lightindicator lightAir bag warning lightThis illuminates whenthe ignition is switchedon and goes out after a fewseconds.Ifitdoesnotilluminatewhenthe ignition is turned on or if itflashes, thereisafault inthesystem. Consult your RenaultDealer as soon as possible.Headlight main beamindicator lightHeadlight dipped beamindicator light3 Indicator light forleft-hand directionindicators4 Speedometer(kmormilesperhour)5 Indicator light forright-hand directionindicators6 Coolant temperaturewarning lightIf it illuminates whenyou are driving, stop and let theengine idle for a minute or two.Thetemperatureshoulddrop.If it doesnot, stoptheengineand check the coolant level(having let the engine cooldown). Call for the assistance ofa Renault Dealer if necessary.Engine immobilisersystem indicator lightThis light has severalfunctions. Refer to theinformation on the engineimmobiliser in section 1.Not usedWWW.MANUALS.WS WWW.MANUALS.WS 6 77aNU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.34CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 421.34INSTRUMENTPANEL(continued)If these warning lights light up, you must stop as soonas traffic conditions allow.+WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.35CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 431.35INSTRUMENTPANEL(continued)Thepresenceandoperationof thewarningandindicatorlightsdescribedbelowdependonthecar'sequipment and the country.6 Not usedPreheating warninglight (on diesel version)and electronic incidentwarning light (on petroland diesel versions). Preheating warning light (ondiesel version)Whentheignitionkeyisinposition M, this light shouldlight up; it indicates that theheater plugs are switched on.It goes out after preheating issufficient and the engine canbe started. Electronicincident warninglight (on petrol and dieselversions).If thislight comesonwhenyouaredriving, it indicatesan electrical or electronicincident. Consult yourRenault Dealer as soon aspossible.Not usedAnti-lock brakingwarning lightThis light comes onwhentheignitionisswitchedon and goes out after 3 seconds.If it lights upwhenyouaredriving, it indicatesafault inthe anti-lock braking system.Braking will then occurnormally but without theanti-lock system.Consult your Renault Dealer assoon as possible.Handbrake on andbrake circuit faultwarning lightThis lights up when thehandbrake is applied and thengoes out again. If it lights up atthe same time as the STOPwarninglight,itindicatesthatthefluidlevelinthecircuitislow; it may be dangerous tocontinuedriving. Call for theassistance of a Renault Dealer.7 Coolant temperature indicatorIn normal use, the needleshould be below zone 7a.Under severe conditions theneedle may enter this area. Thisis not serious unless warninglight comes on.WWW.MANUALS.WS WWW.MANUALS.WS 11 10 9 8NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.36CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 44q1.36INSTRUMENTPANEL(continued)If these warning lights light up, you must stop as soonas traffic conditions allow.+WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.37CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 451.37INSTRUMENTPANEL(continued)Thepresenceandoperationof thewarningandindicatorlightsdescribedbelowdependonthecar'sequipment and the country.8 Oil pressure warninglightIt goes out as soonasthe engine is running; if itcomes on when you aredriving, stopimmediatelyandswitch off the ignition andcheckthe oil level. If this isnormal, call fortheassistanceof a Renault Dealer.Exhaust gas monitoringwarning lightFor vehicles equippedwith this option, the lightcomesonwhentheignitionisswitched on and goes outwithin 3 seconds. If it lights upcontinuously,consult yourRenault Dealeras soon as possible. If it flashes, reduce theenginespeeduntil thelightstops flashing.ConsultyourRenaultDealeras soon as possible.Refer to the information onanti-pollution, fuel economyand driving in section 2.9 Multifunction keyResetting the trip mileagePress the button.Resetting the clockRefer to the information on theclock in section 1.Select display of normalmileometer or trip meter.10 Total mileage, trip mileage andclockCanbereadapproximately30seconds afterswitching ontheignition.11 Not usedBattery charge warninglightIt shouldgoout whenthe engine starts. If it lights upwhile you are driving, itindicates that the circuit isovercharging or discharged.Stop and have the circuitchecked.WWW.MANUALS.WS WWW.MANUALS.WS 2 3 4 516NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.38CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 461.38INSTRUMENTPANELThepresenceandoperationof thewarningandindicatorlightsdescribedbelowdependonthecar'sequipment and the country.If these lights light up, you must stop as soonas traffic conditions allow.WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.39CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 471.39INSTRUMENTPANEL(continued)Thepresenceandoperationof thewarningandindicatorlightsdescribedbelowdependonthecar'sequipment and the country.1 Not usedNot usedAir bag warning lightThis illuminates whenthe ignition is switchedon and goes out after a fewseconds.Ifitdoesnotilluminatewhenthe ignition is turned on or if itflashes, thereisafault inthesystem. Consult your RenaultDealer as soon as possible.Rear fog light indicatorlightFront fog light indicatorlight1 Rear screendemistingindicator light2 Rev counter (scale 100)Upto3000rpm(or2500rpmon diesel versions), enginespeed not to be exceeded in theintermediate gears foreconomical driving3 Fuel level gauge4 Coolant temperature indicatorIn normal use, the needleshould be below zone 4a.Under severe conditions theneedle may enter this area. Thisis not serious unless warninglight illuminates.5 Speedometer.6 Not usedNot usedHeadlight main beamindicator lightHeadlight dipped beamindicator lightWindscreen demistingindicator lightWWW.MANUALS.WS WWW.MANUALS.WS 9 8 7NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.40CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 481.40INSTRUMENTPANELThepresenceandoperationof thewarningandindicatorlightsdescribedbelowdependonthecar'sequipment and the country.If these lights light up, you must stop as soonas traffic conditions allow.WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.4lCLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 491.41INSTRUMENTPANEL(continued)Thepresenceandoperationof thewarningandindicatorlightsdescribedbelowdependonthecar'sequipment and the country.7 Multifunction display Oil level display functionThecar must beparkedonlevelgroundandtheengineshouldhave beenswitchedoff for some time beforehandto obtainanaccurate levelreading.When ignition has beenswitched on forapproximately 30 seconds:- if thelevel is correct, thedisplay will show oil OKTo ascertain the level moreaccurately, press the tripmileometer reset button.Thesquaresinthedisplayindicate the level. Thenumber of squaresdisplayed reduces as the oillevel drops and they arereplaced by a dash.- if the level is at itsminimum, thewordOKwill not appear on thedisplay, the dashes and thewordoil will flashandthe SERV indicator lightwill illuminate.It is vital to top up with oilas soon as possible. Totalmileagerecorder, tripmileage and clockCan be read approximately30 seconds after switching onthe ignition.8 Multifunction key Display selectionPress briefly to move fromthetotal mileagetothetripmileage and vice versa. Trip mileage zeroing buttonPressthebuttonandholditdownwhenthetripmileageis displayed.9 STOP warning lightIt goes out as soonasthe engine starts.This lights up together withone of the warning lights:9 Engine immobilisersystem warning lightThis light performsseveral functions. Refertotheinformation on the engineimmobiliser in section 1.SERVICE warning lightThis comes on whenthe ignition is switchedon and goes out after 3 seconds.If it lights upwhile youaredriving, it indicates arecommendation that you visita Renault Dealer inthe nearfuture: if it flashes it isindicating that there is water inthe diesel.It lights up together with one ofthe warning lights:Turning left directionindicator lightWWW.MANUALS.WS WWW.MANUALS.WS 9NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.42CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 501.42INSTRUMENTPANELThepresenceandoperationof thewarningandindicatorlightsdescribedbelowdependonthecar'sequipment and the country.If these lights light up, you must stop as soonas traffic conditions allow.WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.43CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 511.43INSTRUMENTPANEL(continued)Thepresenceandoperationof thewarningandindicatorlightsdescribedbelowdependonthecar'sequipment and the country.9 Low fuel level warninglightIt goes out as soonas the engine starts.If it lights upor remains lit,fill up with fuel as soon aspossible.Turning right directionindicator lightOil pressure warninglightIt should go out assoonastheenginestarts; if itlights up when you are driving,stop at once, switch off theignition and check the oil level.If this is normal, call for theassistance of a Renault Dealer.Preheating warninglight (on diesel version)and electronic incidentwarning light (on petroland diesel versions). Preheating warning light (ondiesel version)Whentheignitionkeyisinposition M, this light shouldlight up; it indicates that theheater plugs are switched on.It goes out after preheating issufficient and the engine canbe started. Electronicincident warninglight (on petrol and dieselversions).If thislight comesonwhenyouaredriving, it indicatesan electrical or electronicincident. Consult yourRenault Dealer as soon aspossible.Coolant temperaturewarning lightIt goes out as soonastheenginestarts.Ifitlightsup while you are driving, stopand let the engine idle fora minute or two. Thetemperatureshoulddrop. If itdoesnot, stoptheengineandcheckthecoolant level (oncetheenginehascooleddown).Call for the assistance of aRenault Dealer if necessary.Battery charge warninglightIt should go out as soonas the engine starts.If it lights upwhenyouaredriving, it indicates that thecircuit is overcharging ordischarged.Stopandhavethecircuit checked.WWW.MANUALS.WS WWW.MANUALS.WS 11 10 9NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.44CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 521.44INSTRUMENTPANELThepresenceandoperationof thewarningandindicatorlightsdescribedbelowdependonthecar'sequipment and the country.If these warning lights illuminate, you must stop as soonas traffic conditions allow.WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.45CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 53q1.45INSTRUMENTPANEL(continued)Thepresenceandoperationof thewarningandindicatorlightsdescribedbelowdependonthecar'sequipment and the country.9 Not usedHandbrake on andbrake circuit incidentwarning light.Ifitlightsupwhenthebrakesare applied, it indicates that thefluid level in the circuit is low.It may be dangerous tocontinuedriving. Call for theassistance of a Renault Dealer.10 Toxic fume monitoringwarning lightFor vehicles equippedwith this option, the lightcomesonwhentheignitionisswitched on and goes outwithin 3 seconds. If it lightsupcontinuously,consult yourRenault Dealeras soon as possible. If it flashes, reduce theenginespeeduntil thelightstops flashing.ConsultyourRenaultDealeras soon as possible.Refer to the information onanti-pollution, fuel economyand driving in section 2.11 Anti-lock brakingwarning lightThis light comes onwhentheignitionisswitchedon and goes out after 3 seconds.If it lights upwhenyouaredriving, it indicatesafault inthe anti-lock braking system.Braking will then occurnormally, without the anti-locksystem.Consult your Renault Dealer assoon as possible.WWW.MANUALS.WS WWW.MANUALS.WS 112NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.46CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 541.46EXTERNALLIGHTINGANDSIGNALSSide lightsTurntheendofthestalk1until the symbol is opposite themark 2.Dipped beam headlightsTurntheendofthestalk1until the symbol is opposite themark 2.A light illuminates on theinstrument panel.Before setting out to drive atnight: checkthat the electricalequipmentisingoodconditionandadjust theheadlight beams(if your car is not carrying itsnormal load).Main beam headlightsWithstalk1inthedippedbeam position, pull the stalktowards you.An indicator light on the instrumentpanel lights up when the main beamheadlights are on.Toreturntothedippedheadlightposition, pull the stalk towards youagain.Switching off the lightsTurn the end of stalk 1 backto its original position.Lights on warning buzzerA warning buzzer will sound whenthe driver's door is opened and thelights havebeenleft switchedonafter the ignition has been switchedoff (to prevent battery discharge).WWW.MANUALS.WS WWW.MANUALS.WS 33 4NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.47CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 55q1.47EXTERNALLIGHTINGANDSIGNALS(continued)Front fog lightsTurn the central ring ofstalk 4 until the symbol appearsopposite mark 3.Operation of the fog lights dependson the external lighting selected,and an indicator light is illuminatedon the instrument panel.Rear fog lightsTurn the central ring ofstalk 4 until the symbol appearsopposite mark 3.Operation of the fog lights dependson the external lighting selected,and an indicator light is illuminatedon the instrument panel.Do not forget to switch off the rearfog light when it is no longer neededto avoid inconveniencing other roadusers.When the external car lights areextinguished, therear foglight isextinguished or the equipmentreturns to the front fog lightsposition (if these are fitted).WWW.MANUALS.WS WWW.MANUALS.WS ANU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l3Page l.48CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 561.48ELECTRICALADJUSTMENTOFTHEHEADLIGHTSButtonAallowstheheight of thebeamstobeadjustedaccordingtothe load.Turn button A downwards to lowerthe headlight beam and upwards toraise it.Versions with single lenses Adjustment positions of button APosition 0: basic setting, luggagecompartment empty and driver onlyor driver + one front passenger.Position2: car with5persons onboard, luggage compartment empty.Position3: car with5persons onboard, luggage compartment full.Positions 1, 4: intermediate positions.WWW.MANUALS.WS WWW.MANUALS.WS ANU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l4Page l.49CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 571.49ELECTRICALADJUSTMENTOFTHEHEADLIGHTSButtonAallowstheheight of thebeamstobeadjustedaccordingtothe load.Turn button A downwards to lowerthe headlight beam and upwards toraise it.Versions with double lenses Adjustment positions of button APosition 0 or 1: basic setting, luggagecompartment empty with driveralone or with a front passenger.Position 2 or 3: car with 5 persons onboard, luggage compartment empty.Position4: car with5persons onboard, luggage compartment loaded.WWW.MANUALS.WS WWW.MANUALS.WS 1210NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l4Page l.50CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 58q1.50HORNANDHAZARDLIGHTSHornPress the end of the stalk 1.Headlight flasherToflashtheheadlights,evenifthesidelights are not on, pull the stalk 1towards you.Hazard warning lightsPress switch 2.This switch illuminates all fourdirection indicators simultaneously.Itisonlytobeusedtowarnotherroad users that you are: obligedtostopinanunusualorpossibly unauthorised location experiencing unusual or difficultdriving or traffic conditions.Direction indicatorsMove the stalk 1 in the plane of thesteeringwheel inthedirectioninwhichyouare going to turnthesteering wheel.In motorway driving, steeringwheel movements are normallyinsufficient to automatically returnthe stalk to the 0 position. There isanintermediatepositioninwhichyoushouldkeepthestalkduringthe steering wheel movement.Whenyoureleasethethestalk, itautomatically returns to position 0.WWW.MANUALS.WS WWW.MANUALS.WS 1ABCD1NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l4Page l.5lCLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 591.51WINDSCREENWIPER/WASHERWindscreen wiperWiththeignitionon,move stalk1inthe plane of thesteering wheel: A Off BIntermittent wipeThe wipers will pause forseveral seconds betweensweeps. CContinuous slow wipe D Continous fast wipeWindscreenwasherWith the ignition switched on, pullthe stalk 1 towards you.In frosty weather, make sure that thewiper bladesarenot stuckbyice(risk of motor overheating).Keep an eye on the condition of theblades. Change the wiper blades assoonastheybecomelessefficient(approximately once a year).If you switch off the ignition beforeswitching off the windscreen wiper(position A) the blades will stop at arandomposition on the windscreen.WWW.MANUALS.WS WWW.MANUALS.WS 12NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l4Page l.52CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 601.52DE-ICING/DEMISTINGHeated rear screenWith the engine running,press button 1. (indicator lightilluminates on the instrumentpanel.)This function demists the rearscreenandthe electric rear viewmirrors (if these are fitted to the car).Thedemist functionisstoppedintwo ways:- automatically after 15 minutes'operation.- by pressing key 1 again. (Theindicator light goes out.)Demisting the windscreenMove control 2: set it toposition:For greater efficiency, close thedashboard air vents.All the air is directed to thewindscreen and front side windowdemisting vents.WWW.MANUALS.WS WWW.MANUALS.WS 1NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l4Page l.53CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 611.53FUELTANKUseful capacity of fuel tank:Approx. 50 litres (11 gallons).Acapholder1isprovidedonthefuelfillerflapforusewhenfillingthe tank.This is of a special type. Ifyou have to replace it, makesurethenewcapisofthesame type. Consult yourRenault Dealer.Never handle the cap near a sourceof heat or a flame.Fuel gradePetrol versionUsefuelwhichcorrespondstotheappropriate octane rating as definedby the particular standards in forcein each country.See Engine Specifications.Diesel versionUse diesel engine fuel (DERV) only.Whenyouarefillingthefueltank,make sure that no water can get inaccidentally. If this happens, theSERV warning light on theinstrument panel will flash, andyou should consult your RenaultDealerimmediately. Thefuelfillercapandneckmust be cleananddust-free. Thediesel fuel must behigh quality.WWW.MANUALS.WS WWW.MANUALS.WS NU665~3_Clio_fra_Gl.qxdl3/08/0ll4:l4Page l.54CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T1.WIN 12/9/2001 11:03- page 621.54FUELTANK(continued)Filling with fuelPetrol versionOnly use unleaded petrol.Using leaded petrol will damage theanti-pollution system and may leadto a loss of warranty.To ensure the fuel tank is not filledwithleadedpetrol, the fuel tankfiller neck contains a restrictorfitted with a valve which onlyallows the nozzle for unleadedpetrol to be used (at the pump).- Insert the nozzle as far as it will goso as to open the valve.- Keepthenozzleinthispositionthroughout the entire fillingoperation.Filling with fuel(continued)Petrol and diesel versionsNo more than two filling operationsmay be made after the fuel feed hasswitchedoff automaticallyfor thefirst time because there must besufficientspaceinthefueltanktoallow for expansion.It is strictly forbidden towork onor modify thefuel supply system(computers, wiring, fuelcircuit, injector, protectivecovers...) in view of the possiblerisk to safety (except forqualified personnel from theRenault network).Persistent smell of fuelYour car has a pressurised fuelsupply system. If a there is apersistent smell of fuel: stopthecarif trafficconditionsallow and switch off the ignition; switch on the hazard warninglights, ask all passengers to leavethe car and keep them away fromtraffic; donot investigateor restart theengine before the car has beenchecked by qualified Renaultnetwork personnel.WWW.MANUALS.WS WWW.MANUALS.WS NU645~3_665~3_fra_G2.qxdl0.08.200ll6.30Page 2.0lCLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T2.WIN 6/9/2001 20:47-page12.01Section2:Driving(Adviceonuserelatingtofueleconomyandtheenvironment)Running in / Ignition switch........................................................................................................................... 2.02Starting the engine / Stopping the engine ..................................................................................................... 2.03Special features of petrol versions.................................................................................................................. 2.04Special features of diesel versions.................................................................................................................. 2.05Advice on anti-pollution and how to economise on fuel................................................................ 2.06 2.08Environment...................................................................................................................................................... 2.09Power steering................................................................................................................................................... 2.10Handbrake - Gear lever .................................................................................................................................... 2.10Anti-lock braking system (ABS) ...................................................................................................................... 2.11WWW.MANUALS.WS WWW.MANUALS.WS NU645~3_665~3_fra_G2.qxdl0.08.200ll6.30Page 2.02CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T2.WIN 6/9/2001 20:47-page22.02RUNNINGIN IGNITIONSWITCHPetrol versionFor the first 625 miles (1000 km) donot exceed 70 mph (130 km/h)in the highest gear or 3000 to3500 rpm.Onceyouhavecovered625miles(1000km) youmayuse your carnormally. However, itisonlyafter1500 miles (3000 km) have beencoveredthat youmay reasonablyexpect full performance.Serviceintervals: refertothecar'sservicing booklet.Diesel versionForthefirst 900miles(1500km),do not exceed 2500 rpm. Oncompletion of this mileage youmaydrivefaster, however, thecarwillonlyprovidetopperformanceafter approximately 4000 miles(6000 km).During the running inperiod, donot accelerate hard while the engineis still cold and do not let theengine overrev.Service intervals: Refer to yourServicing booklet for details ofsubsequent service intervals.PositionSt:Stoppedandsteeringlock appliedTo lock: remove the key and turn thesteering wheel slightly until thesteering lock engages with a click).To unlock: turn the key and thesteering wheel slightly.Position A: AccessoriesTheignitionis switchedoff. Anyaccessories (radio, etc.) willcontinue to operate.Position M: Ignition onIgnition is on.You are ready to start.Position D: StartIf the engine fails to start at the firstattempt, the key must be turnedback before the starter can beactivatedagain. Releasethekeyassoon as the engine starts.WWW.MANUALS.WS WWW.MANUALS.WS NU645~3_665~3_fra_G2.qxdl0.08.200ll6.30Page 2.03CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T2.WIN 6/9/2001 20:47-page32.03STARTING/STOPPINGTHEENGINEStarting the engineSpecial feature on vehiclesequipped with an engineimmobiliser systemIn very cold conditions(temperatures below 20C): switchontheignitionforseveralsecondsbefore attempting to start the engineto make it easier to start the engine.Make sure the engine immobiliser isnot activated. (See section 1 on theengine immobiliser.)OPetrol injectionEngine hot or cold- Turn the key to the Startposition without depressingthe accelerator.- Releasethekeyassoonastheengine starts.ODiesel injectionCold or warm engineTurn the ignition key to theignition on position, M, and holdthis position until the preheatingwarning light goes out.Turn the key to the starterposition, D, without depressingthe accelerator.Releasethekeyas soonas theengine starts.Hot engineTurn the ignition key directly to theStart position. In the event that theengine does not start at the firstattempt, repeat the operation usingpreheating.Let the engine run in neutralwithout overrevving for severalseconds.Stopping the engineWith the engine idling, turn the keyback to the stop position.Never leave the vehicle unattended with the key in the ignition if there is a child (or animal) in the vehicle.Withthekeyintheignitionheorshecouldstarttheengineoroperateelectricalequipmentsuchastheelectric windows and there is a risk that the child may be injured (by trapping his or her neck, arm, hand, etc.).Risk of serious injury.Never switch off the ignition before the vehicle has stopped completely. Once the vehicle has stopped, the powersteering, brake servo and the passive safety devices such as air bags and pretensioners will no longer operate.When the key has been removed, the steering will lock.WWW.MANUALS.WS WWW.MANUALS.WS NU645~3_665~3_fra_G2.qxdl0.08.200ll6.30Page 2.04CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T2.WIN 6/9/2001 20:47-page42.04SPECIALFEATURESOFPETROLVERSIONSThe following operating conditions: drivingforalongtimewiththelow fuel level warning lightilluminated using leaded petrol using lubrication additives or fuelnot approved by RenaultOr operating incidents such as: faulty ignition, running out offuelorsparkplugdisconnected,causing engine misfiring andjerking when driving loss of powermay cause the catalytic converter tooverheat and thus reduce itsefficiencyor evendestroyit andcause thermal damage to the car.If you note any of the aboveincidents, have the necessaryrepairs carried out as soon aspossible by your Renault Dealer.These faults may be avoided bytaking your car regularly to yourRenault Dealer at the intervalsspecified in your Servicing booklet.Starting problemsTo avoid damaging the catalyticconverter, do not keep trying tostart the engine (using the starter, orby pushing or towing the car)without having identified andcorrected the starting fault.If the fault cannot be identified, donot persist in attempting to start theengine and call a Renault Dealer.Do not park the car or runtheengine in locations wherecombustible substances ormaterials suchas grass orleaves could come into contact witha hot exhaust system.WWW.MANUALS.WS WWW.MANUALS.WS NU645~3_665~3_fra_G2.qxdl0.08.200ll6.30Page 2.05CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T2.WIN 6/9/2001 20:47-page52.05SPECIALFEATURESOFDIESELVERSIONSDiesel engine speedDiesel engines are fitted withinjection equipment incorporating amechanical governor whichprevents overrevving of the engineirrespective of the gear in use.Lack of fuelIf thefuel tankhasbeendraineddry, you may start the enginenormally after refilling the fuel tankprovided that the battery is wellcharged.However, if after a few seconds andseveralattemptstheengine fails tostart, contact a Renault Dealer.Precautions to be taken inwinterTo avoid any problems in icyweather: Ensure that battery is always fullycharged. Always keep the fuel tankrelatively full to avoid watervapour condensing in it andaccumulating at the bottom of thetank.Vehicles equippedwithdieselfuel heaterThis equipment enables diesel fuelto be used without an additivedownto18Cor,ifthevehicleisused regularly for short journeys(cold engine), down to 5C.WWW.MANUALS.WS WWW.MANUALS.WS NU645~3_665~3_fra_G2.qxdl0.08.200ll6.30Page 2.06CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T2.WIN 6/9/2001 20:47-page62.06ADVICEONANTI-POLLUTION,FUELECONOMY,DRIVINGRENAULTisactivelyparticipatingin the reduction of pollutantexhaust gas emissions and in savingenergy.By virtue of its design, moderatefuel consumption and initialsettings, yourRenault conformstocurrent anti-pollution standards.Technical design, however, cannotachieveall. Thefuel consumptionof your car and the level of pollutantexhaust gas emissions are verymuch within your control. Makesure that your car is maintainedcorrectly, use it carefully and watchyour driving style.MaintenanceIt is important to remember thatfailure to respect anti-pollutionstandards could lead to legal actionagainstthecarowner. Inaddition,the replacement of parts of theengine, fuel supply system andexhaust byparts other thanthoseoriginally recommended by themanufacturer could alter your car insuch a way that it no longercomplies with anti-pollutionstandards.Have your car checked and adjustedby your Renault Dealer inaccordance with the instructions inthe cars servicing booklet.Your Renault Dealer has all theequipment necessaryfor ensuringthat your car is maintainedtoitsoriginal standard.Always remember that the emissionof pollutant fumes is directly linkedto fuel consumption.Engine adjustments Ignition: this does not requireadjustment. Spark plugs: the specifications ofthe Renault TechnicalDepartment must be strictlyobserved in order to achieveoptimum conditions of use,performance and output.If the spark plugs have to bechanged, use the make, type andgap specified for your car'sengine. Consult your RenaultDealer for this information. Idling speed: this does not requireadjustment. Air and fuel filters: a cloggedfilter element reduces output andshould be changed. Injection pump setting: the pumpmustbesettotherecommendedvalues.WWW.MANUALS.WS WWW.MANUALS.WS NU645~3_665~3_fra_G2.qxdl0.08.200ll6.30Page 2.07CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T2.WIN 6/9/2001 20:47-page72.07ADVICE ON ANTI-POLLUTION AND HOW TO ECONOMISE ON FUEL, DRIVING(continued)Driving Drivecarefullyfor thefirst fewmiles until the engine reaches itsnormal operating temperature,ratherthanletitwarmupwhilethe car is stationary. Speed is expensive. Sporty driving uses a lot of fuel:drive with a light right foot. Study the road ahead so that youare able to brake as little aspossible, itcanbesufficientjustto lift off the accelerator. Avoid fierce acceleration. Donotoverrevtheengineintheintermediate gears. Always usethe highest ratio possible withoutlabouring the engine. Donottrytomaintainthesamespeed up a hill; accelerate nomore than you would on the level.Keep your foot in the sameposition on the accelerator pedal. Double declutching andacceleratingbeforeswitchingoffare superfluous actions inmodern cars. Bad weather, flooded roadsDo not drive throughfloods if the depth ofwater is above the loweredge of the wheel rims.WWW.MANUALS.WS WWW.MANUALS.WS NU645~3_665~3_fra_G2.qxdl0.08.200ll6.30Page 2.08CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T2.WIN 6/9/2001 20:47-page82.08ADVICE ON ANTI-POLLUTION AND HOW TO ECONOMISE ON FUEL, DRIVING(continued)General hints Electricity is a fuel, so switch offall electrical equipment whichis notrequired.However, (with safety always inmind), keepyour lights onwhenvisibility is poor (see and be seen). Try to use the air vents. Driving withthe windows open will increase fuelconsumptionby4%whentravellingat a speed of 60 mph (100 km/h). Air conditioning increases fuelconsumption, especially in towndriving. Switch off the systemwhenit is not needed. Never fill the fuel tank right to thebrim as this is wasteful. Do not leave an empty roof rack inposition. Itisbettertofitatrailerforbulkyobjects. When towing a caravan, fit a winddeflector and adjust it carefully. Avoid using the car for door-to-doorcalls (short journeys with long waitsin between) because the engineneverreachesitsnormaloperatingtemperature. Trytogroupyour calls.Tyres Inadequatepressuresmayincreasefuel consumption. The use of non-recommended tyresmay also increase fuel consumption.WWW.MANUALS.WS WWW.MANUALS.WS NU645~3_665~3_fra_G2.qxdl0.08.200ll6.30Page 2.09CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T2.WIN 6/9/2001 20:47-page92.09ENVIRONMENTYour vehicle has been designedwith the aim of caring for theenvironment. The majority of versions areequipped with a depollutionsystem including a catalyticconverter, alambdasensor andan active carbon filter. (Theactive carbon filter preventsvapour from the petrol tank beingreleased into the open air.) Thesevehiclesrunonunleadedfuel only. 87%of your vehicleconsistsofparts that canbe recycledandalready contain recycledmaterials. 95% of the plastic components inyour vehiclearemarkedwithasymbol which allows theprincipal component material tobe identified. These markingsmeanthatpartsremovedcanbesorted more easily, thusoptimisingtherecyclingof eachof them.In addition, your car meetsthe requirements of Europeanlegislation relating to environmentalprotection.Make your contribution towardsprotection of the environment too!Whendisposingof parts replacedduring routine maintenance(battery, oil filter, air filter, etc.) andoil containers (whether empty orfull of used oil, etc.), do not includethem with household waste.Disposeofthemthroughspecialistorganisations. Inall cases, complywith local bye-laws.WWW.MANUALS.WS WWW.MANUALS.WS 21NU645~3_665~3_fra_G2.qxdl0.08.200ll6.30Page 2.l0CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T2.WIN 6/9/2001 20:47-page102.10GEARLEVER HANDBRAKE POWERSTEERINGTo select reverse gear(car stationary)Movethelevertoneutral,thenliftup ring 1 against the gear lever knobto enable selection of reverse gear.The reversing lights will light up assoon as reverse gear is selected(with the ignition on).To release:Pull the lever up slightly, pressbutton 2, then lower the lever to thefloor.The red warning light on theinstrument panel will light upifyou are driving with an incorrectlyreleased handbrake.To applyPull the lever up.The lever should travel about10 notches to hold the car. Your caris fitted with self-adjusting rearbrake shoes and the handbrakeshouldonlybeadjustedduringabrake overhaul.When the car isstationary, apply thehandbrake fully toensure that the carcannot move unintentionally.Make sure the handbrake isproperly released when the car isbeing driven, otherwiseoverheating may occur.Neverleavethesteeringwheel onfulllockwhenthecarisparkedifyou have power-assisted steeringfitted, as this may damage thepump.As a general rule, youshould not switch off theignition when in motion,and never on hills(power steering and brake servowill not function).WWW.MANUALS.WS WWW.MANUALS.WS NU645~3_665~3_fra_G2.qxdl0.08.200ll6.30Page 2.llCLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T2.WIN 6/9/2001 20:47-page112.11ANTI-LOCKBRAKINGSYSTEM(ABS)(depending on version or option)When braking sharply, the two mainaims are to reduce the stoppingdistance and to keep your car undercontrol. However, depending on thenature of the ground, weatherconditions and your reactions, thereis a danger that the wheels may lockand directional control may be lost.The anti-lock braking system (ABS)has beendesignedtocombat thisdanger.Thebrakecontrolsystempreventsthe wheels from locking, even if thebrakes are applied too sharply, andallows the car to be steered and thusits direction to be controlled. Underthese circumstances it is quitepossibleforthedrivertosteerthecar round an obstacle whilst brakingat the same time. Also, this systemallows you to optimise stoppingdistances, especially whenroadholding becomes difficult (wetor slippery roads, variable roadsurfaces).Although this system allows you tooptimise stopping distances, theABSsystemdoesnotallowyoutoincrease car performance, whichisphysically linked to the localconditions of tyre/ground adhesion.Therulesof gooddrivingpracticemust alwaysbeobserved(suchasdrivingatasafedistancefromthevehicleinfront). Thefactthatthecars safety has been enhancedshouldnot encourageyoutotakerisks.Whenever the system is in use, youwill feel a varying degree of pulsingthrough the brake pedal. Thesetangible signs will warn you that theadhesion between the tyres and thegroundhas reachedits limit andthat youmust adapt your drivingstyle to suit the road conditions.FaultsTwo possible situations may occur:1 - The warning light islit on the instrument panel.Braking is still available, butwithout the ABS system. Consult aRenault Dealer as soon as possible.2 - Warning lights andare lit on the instrument panel.This indicates that boththe brakingsystemandtheABSsystemarefaulty. Your car brakes maystillpartially operate. However, it isdangerous to brake suddenly andyou must therefore stop as soon astraffic conditions allow. Contactyour Renault Dealer as a matter orurgency.The braking control provided by the anti-lock braking system is independent of the effort applied to the brake pedal.In an emergency, apply strong and continuous pressure to the brake pedal - there is no need to pump it repeatedly.WWW.MANUALS.WS WWW.MANUALS.WS NU645~3_665~3_fra_G2.qxdl0.08.200ll6.30Page 2.l2CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T2.WIN 6/9/2001 20:47-page122.12WWW.MANUALS.WS WWW.MANUALS.WS NU645~3_665~3_fra_G3.qxdl0.08.200ll6.29Page 3.0lCLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T3.WIN 17/8/2001 11:48-page13.01Section3:YourcomfortAir vents................................................................................................................................................. 3.02 - 3.03Heating - Ventilation - Air conditioning............................................................................................ 3.04 3.09Interior lighting................................................................................................................................................. 3.10Electric windows .............................................................................................................................................. 3.11Sun visor ........................................................................................................................................................... 3.12Glove box - Storage compartments ...................................................................................................... 3.13 - 3.14Ashtrays - cigarette lighters ............................................................................................................................. 3.15Rear bench seat (operation) ............................................................................................................................. 3.16Luggage compartment ...................................................................................................................................... 3.17Transporting items in the luggage compartment ........................................................................................... 3.18WWW.MANUALS.WS WWW.MANUALS.WS 1 2 3 4 5 6 78 8NU645~3_665~3_fra_G3.qxdl0.08.200ll6.29Page 3.02CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T3.WIN 17/8/2001 11:48-page2q3.02AIRVENTS(air outlets)1 - Left-hand front window demister2 - Left-hand air vent3 - Windscreen demisting vents4 - Centre air vents5 - Heating/ventilation control unit6 - Right-hand side air vent7 - Right-hand front windowdemister8 - Footwell heater outlets for frontand rear passengersWWW.MANUALS.WS WWW.MANUALS.WS 1 23 34NU645~3_665~3_fra_G3.qxdl0.08.200ll6.29Page 3.03CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T3.WIN 17/8/2001 11:48-page33.03AIRVENTS(continued)Side air ventsAir flowMovetumblewheel 2(beyondthepoint where resistance is felt).: maximum flow: closedDirectionRight/left: Move tab 1.Up/down: Guide the air vent up ordown.Centre air ventsAir flowMovetumblewheel 4(beyondthepoint where resistance is felt).: maximum flow: closedDirectionRight/left: Move tabs 3.Up/down: Guide the air vent up ordown.WWW.MANUALS.WS WWW.MANUALS.WS A B CNU645~3_665~3_fra_G3.qxdl0.08.200ll6.29Page 3.04CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T3.WIN 17/8/2001 11:48-page43.04HEATING-VENTILATIONControlsA Air temperature adjustment.BDistribution of air.CAir flow regulation.Adjusting the air temperatureTurn button A.Turning the knob to the rightincreases the temperature.Distribution of air in thepassenger compartmentMove control B. PositionAll theair flowisdirectedtothedashboard vents. PositionThe air flow is distributed betweenthe dashboard vents and thefootwells.WWW.MANUALS.WS WWW.MANUALS.WS A B CNU645~3_665~3_fra_G3.qxdl0.08.200ll6.29Page 3.05CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T3.WIN 17/8/2001 11:48-page53.05HEATING-VENTILATION(continued) PositionThe air flow is distributed betweenthe dashboard vents and thefootwells.Close the dashboard vents to directall the air to the footwells. PositionThe air flow is distributed betweenall the air vents, the front sidewindowdemisting air vents, thewindscreen demisting vents and thefootwells. PositionClose the dashboard vents for moreeffective demisting.All the air is directed to thewindscreen and front side windowdemisting vents.For maximumefficiency, set controlC to 4.Adjustingtheamountofair supplied to thepassenger compartment Normal use (ventilation)Move control C from 0 to 4.Passengercompartmentventilationis by blown air. The blowerdetermines how much air enters butcar speed has some effect on this.WWW.MANUALS.WS WWW.MANUALS.WS A C BDENU645~3_665~3_fra_G3.qxdl0.08.200ll6.29Page 3.06CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T3.WIN 17/8/2001 11:48-page63.06HEATING-VENTILATION-AIRCONDITIONINGControlsA Air temperature adjustment.BDistribution of air.CAir flow regulation.D Using the air conditioning.EAir conditioning indicator light.Adjusting the air temperatureMove control A.To the right: maximumpossibletemperatureTo the left: minimum possibletemperatureDistribution of air in thepassenger compartmentMove control B. PositionAll theair flowisdirectedtothedashboard vents. PositionThe air flow is distributed betweenthe dashboard vents and thefootwells.WWW.MANUALS.WS WWW.MANUALS.WS A C BDENU645~3_665~3_fra_G3.qxdl0.08.200ll6.29Page 3.07CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T3.WIN 17/8/2001 11:48-page73.07HEATING-VENTILATION-AIRCONDITIONING(continued) PositionThe air flow is distributed betweenthe dashboard vents and thefootwells.Close the dashboard vents to directall the air to the footwells. PositionThe air flow is distributed betweenall the air vents, the front sidewindowdemisting air vents, thewindscreen demisting vents and thefootwells. PositionClose the dashboard vents for moreeffective demisting.All the air is directed to thewindscreen and front side windowdemisting vents.For maximumefficiency, set controlC to 4.Adjustingtheamountofair blown into thepassenger compartmentVentilationMove control C from 0 to 4.Passengercompartmentventilationis by blown air. The blowerdetermines how much air enters butcar speed has some effect on this.The further the control is moved tothe left, the greater the amount of airsupplied.Ifyouwanttofullyclosetheinletandstopthe ventilationunit, setcontrol C to 0.WWW.MANUALS.WS WWW.MANUALS.WS A C BDENU645~3_665~3_fra_G3.qxdl0.08.200ll6.29Page 3.08CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T3.WIN 17/8/2001 11:48-page83.08HEATING-VENTILATION-AIRCONDITIONING(continued)Temporary isolation of thepassenger compartmentNormaloperationoftheheatingandventilationsystemisobtainedusingexternal air.Recirculation of air allows the externalatmosphere to be isolated (driving inpolluted areas).Tochange toisolationmode, presscontrol D to start the air conditioningand move control C from 0 to 4.Airrecirculationallowsthedesiredcomfort level to be achieved asquickly as possible.This starts or stops air recirculation. Inthis positionthe air is takenfrominside the passenger compartment andis recirculated without admittingexternal air.Prolongeduse of isolationmode causemay mist the windows slightly orcause odours due to the air not beingrenewed.It isadvisablethereforetoreturntonormal operation (external air) byadjustingcontrol Cwhenyouhavepassed through the polluted area.When the air conditioningsystem is operating, allwindows must be closed formaximum efficiency.If there is an operating fault, consultyour Renault Dealer.Do not open the refrigeration circuit:this may cause injury to the eyes orskin.WWW.MANUALS.WS WWW.MANUALS.WS A C BDENU645~3_665~3_fra_G3.qxdl0.08.200ll6.29Page 3.09CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T3.WIN 17/8/2001 11:48-page93.09HEATING-VENTILATION-AIRCONDITIONING(continued)Air conditioning controlsControl Doperates orstopsthe air conditioning system.The system cannot be switched onif control C is set to 0.Use the air conditioning systemoccasionallyinwintertokeepthesystem in good working order.Do not worry about any waterwhich may appear from underneaththe car as this results fromcondensation.Using the air conditioning system: lowers the internal passengercompartment temperature,especiallyinhot weather, whendriving in traffic or when the carhas been parked in the sun; reduces thehumidityof theairblown inside the passengercompartment (prevents misting).Fuel consumptionincreaseswhenthe air conditioning system is beingused. (Switchitoffwhenitisnotrequired.)Note: theair conditioningmaybeused in all conditions but does notoperate when the externaltemperature is low. Button D not activated (indicatorlight E not illuminated)The air conditioning is notoperating.Heating and ventilation aretherefore identical to that of a carwithout air conditioning. Button D activated (indicatorlight E illuminated)The air conditioning is activated.WWW.MANUALS.WS WWW.MANUALS.WS 1ANU645~3_665~3_fra_G3.qxdl0.08.200ll6.29Page 3.l0CLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T3.WIN 17/8/2001 11:48- page 103.10INTERIORLIGHTSInterior light AWhen switch 1 is pressed:- continuous lighting is obtained,- or temporary lighting is obtained,by opening one of the front doors,or by opening any door,depending on the car version. Thelight only goes out when the doorconcerned is correctly closed.Automatic operation of theinterior lights (for certain cars) if thedoorsareunlockedusingthe plip remote control, theinterior lightingisswitchedonfor approximately 15 seconds. if the doors are locked using theplipremotecontrol,theinteriorlighting is immediately switchedoff. if a door is open (or not properlyclosed),thelightingisswitchedon for a period of approximately15 minutes. ifallthedoorsareclosedwhentheignitionisswitchedon, thelighting is gradually switchedoff.WWW.MANUALS.WS WWW.MANUALS.WS 123NU645~3_665~3_fra_G3.qxdl0.08.200ll6.29Page 3.llCLIOnu665-3C:\Documentum\Checkout\nu665-3_eng_T3.WIN 17/8/2001 11:48- page 11q3.11ELECTRICWINDOWSFront driver's side electricwindowWith the ignition on, press switch 1to open the window or raiseswitch 1 to close it.Front passenger's side electricwindowWith the ignition on, press switch 2to open the window or raiseswitch 2 to close it.Child safetyIf there is a child (oranimal) in the car, neverleave it unattended withthe key in the ignition.Withthekeyintheignitionitwould be possible to operate theelectricwindowsandthereisarisk that the child may beseriously injured (by trapping itsneck, arm, hand, etc.).Manual window controlsOperate handle 3.WWW.MANUALS