Top Banner

of 16

August9 2013.pdf

Apr 02, 2018

Download

Documents

dholyk2012
Welcome message from author
This document is posted to help you gain knowledge. Please leave a comment to let me know what you think about it! Share it to your friends and learn new things together.
Transcript
  • 7/27/2019 August9 2013.pdf

    1/16

    Vol. 131 No. 22 Friday, August 9, 2013

    www.minnedosatribune.com

    90 cents + tax

    We acknowledge the

    financial support of the

    Government of Canada

    through the

    Canada Periodical Fund

    of the Department of

    Canadian Heritage.

    and hangin on!

    Rockin out

    Photo by Jennier Paige

    Photo by Darryl Holyk

    Teory of a Deadman headlined year ten of Rockin the Fields of Minnedosa.Pictured is lead singer, yler Connolly.

    By DARRYL HOLYK

    he Heartland Rodeoreturned to Minnedo-sa this August long week-end attracting competitorsand spectators rom near

    and ar.Overall, things went

    well, said Minnedosa Ro-

    deo President, Greg Woy-chyshyn. Te stands were

    ull and there were no realinjuries to speak o so thatsalways good.

    Te one area that did

    experience some strugglesthis year, was the quantityo ood available onsite or

    competitors and specta-tors. With the canteen inthe display building not

    open, the lone ood vendor

    did its best to try to keep up

    the demands o the hungrycrowd. T e rodeo com-mittee has already started

    talking about options ornext year so that this issuedoes not arise again.

    We hope to havesome new exciting ood

    vendors or next year to

    make sure we are wellstocked throughout the

    weekend, said Greg.T e three-day rodeo

    weekend kicked of Sat-urday morning with a

    Manitoba Barrel RacingAssociation 3D barrel rac-ing event. Later that ater-

    noon, the ags o rodeowere carried into the mainarena by riders on horse-

    back to open day one o

    the Heartland Rodeo. Te

    national anthem was sungby six-year-old Echo Des-

    jardins. Tis young cowgirl

    also competed later in theshow in the Pee Wee BarrelRacing event.

    Following the CowboyPrayer, hard hitting ro-deo action kicked of with

    hometown cowboy, BenMarcino being the rst to

    compete in the barebackevent. Other events in-cluded Saddle Bronc, ieDown Roping, Goat ying,

    eam Roping, BreakawayRoping, Barrel Racing,Steer Wrestling, Steer Rid-

    ing and Bull Riding.

    Continuedon Page 9

    Evan Billings takes a sideways fallfrom a bull named Red Skin.

    By JENNIFER PAIGE

    Every year during the August long weekend excite-ment and energy ll the streets o Minnedosa. Tispast weekend people came rom ar and wide to enjoy a

    weekend ull o great music, good riends, and take in ev-

    erything Minnedosa has to ofer.en years ago, Rockin the Fields was thought to

    be a goner with only good memories o past estivals to

    hold onto. But now, ten years later, a dedicated team oorganizers and loyal volunteers have lled the hills oMinnedosa with rock music once again.

    Celebrating their 10th year o non-pro t co-oper-ative, Rockin the Fields 2013 saw a non-stop line up obands that d rew a wide range o attendees. Tis years an

    avourites included Trooper, Te Trews, Starship featur-ingMickey Tomas, Monster Truck and estival headliner,

    Teory of a Deadman .

    Over the past several years, Rockin the Fields hasevolved, growing every year, including this year whichsaw attendance grow to just over 2,000 visits per day,

    compared to 2004 when daily attendance was only 400.Organizers boast that the estival went as smooth as

    ever with no arrests or charges during the three-day mu-

    sic est. Te rst aid trailer was also uneventul only see-ing minor scrapes and the odd person who drank beyondtheir limit.

    Continued on Page 8

  • 7/27/2019 August9 2013.pdf

    2/16

    2 Te Minnedosa ribuneFriday, August 9, 2013

    $XJXVW+DLUFXW6SHFLDO

    :LWK$QLWDLadies Cuts $20.00Mens Cuts $15.00

    All Hair Products 25%OFF!!!

    Check out our Enjoy Being Active Clothing line!

    204-867-253325 Main Street S.

    Find us on Facebook

    7KH0LQQHGRVD1XUVHV

    ZRXOGOLNHWRWKDQNDOOWKDWVXSSRUWHG

    RXU6SDJKHWWL6XSSHU

    EXUVDU\IXQGUDLVHU

    2XUHQWHUWDLQHUV

    =DFN.RVFLHOQ\

    (PPD-HDQ.RVFLHOQ\

    .DWLH:R\FK\VK\Q

    6WHYLH2Q\VKNR

    $QGDQH[WUDVSHFLDOWKDQNVWR+HDWKHU%UD]HDX

    IRUYROXQWHHULQJKHUVXSHUEFDWHULQJVHUYLFHV

    :LWKRXW\RXDOOWKLVHYHQWZRXOGQRWEHSRVVLEOH

    7KDQNV$JDLQ[

    FREE ESTIMATES!Roofng, Sot, Fascia, Eavestrough

    [email protected]

    SATISFACTION GUARANTEED!!!

    By JENNIFER PAIGE

    With an extensive listo volunteer ac-tivities, committee boardmemberships and presi-dential positions, localresident, Robert Grahamhas been honoured with anational award or his lie-time o civic-minded con-tributions.

    Te Diamond JubileeAward was created in hon-our o the 60th anniversa-ry o Her Majesty QueenElizabeth II and to pay

    respects to her six decadeso service. Recipients othe award had to be nomi-nated by ellow commu-nity members to Memberso Parliament o the Legis-lative Assembly. Since thebeginning o 2012, 60,000deserving Canadians havebeen recognized or theiroutstanding achieve-ments that have positivelyimpacted our country,their province or theircommunity.

    Bob was a good ftor the award and it is easyto see that he deservesit when you take a lookat his volunteer history,says Brock Alexander, whopenned one o the threenomination letters sent toparliament members. woother letters were writtenby Dave McDonald andBrian Bruce.

    We sent in threenomination letters ex-plaining all o the timeBob spends in town, vol-unteering and being an

    active, involved commu-nity member , says Mc-Donald. Tis is a very

    well deserved award. Bobis always there to help,

    just like with Rockin theFields, he has donated alot o time there and doesevery year. Whatever or

    whenever you need help,he is there to help out.

    Graham has lived inthe southwest corner oMinnedosa or 28 years.I have always been in-

    volved in the communitybecause I love this town.It is a great place to liveand raise kids. When youspend some time volun-teering you get to knowpeople, learn about team-

    work and get to know thecommunity you l ive in.

    Graham has been avolunteer in town or aslong as he has been a resi-dent, a staple at Rockinthe Fields since its con-ception, president o theLittle River Game and Fish

    Associatio n or 14 years,

    previously a town councilmember, as well as partic-ipating in numerous com-mittees, and undraisingboards.

    I like to see things

    getting accomplished.One o my avourite proj-ects I have worked on

    would probably have tobe the back nine at thegol course. I spent count-less numbers o hours anddays out there, says Gra-ham.Graham was present-

    ed with the Diamond Ju-bilee Award on July 11th ata ceremony during the lo-cal mens gol night. I was

    very overwhelmed whenI ound out I was nomi-nated and when I was

    presented with the medal;there are lots o deserv-ing people that do a lot othings or this town andto be recognized means alot.

    Graham honoured for Dedication to Community

    Bob GrahamsCommunity Involvement:

    Curling Club - previously a member and servedas president or two years. Golf Club - previously served as grounds chairor two years. Currently a member and served as

    president or two years. Presently on the executivecommittee as a senior representative and assists

    with several projects at the course. Little River Game and Fish Association- hasserved as president or 14 years. own of Minnedosa - during his our year termas councillor, Bob served our years as chairman othe economic development board. Rockin the Fields - volunteered every yearsince Classic Rock began in 1996. Little Saskatchewan River Conservation Dis-trict - currently serves as board member and hasheld the position or six years. Te Minnedosa Regional Events Centre -served or the past our years on the undraisingcommittee. Rotary Club - member or the past our years. Masonic Lodge - previous member. Hockey League - coached or two years.

    Photo by Jennier Paige

    Bob Graham was recently presented a Diamond

    Jubilee Medal in recognition of his many years

    of volunteering in the community.

    SUBMITTED

    his past weekend, theMinnedosa Maver-icks represented the Santa

    Clara Baseball League atthe Senior AA Finals in Ha-miota.

    Game #1 Baldur (3)Minnedosa (1). Mitch Hut-

    ton had 1 hit and scored 1run.Game #7 Minnedosa

    (8) Springf eld (2). Win-ning Pitcher Nick Krutke-

    wich. John Lawrence had 3hits, 2 RBIs, Scored 1. Zac

    Yandeau had 2 hits, 1 RBI,Scored twiceGame #11 Minnedo-

    sa (7) Hartney (1). WinningPitcher John Hutton. An-drew Richards had 3 Hits,Scored once. Zac Yandeauhad 2 Hits, Scored twice.

    Game #14 - Hamiota(4) Minnedosa (3). JohnHutton went 2 or 3. Zac

    Yandeau doubled andscored once.

    In the f nal game,Brandon deeated Hamio-

    ta 8-3.

    Senior AA provincial

    baseball results

    Ifyourlabelreads

    13 /08 /31Itstimetorenew!

    Call 867-3816

  • 7/27/2019 August9 2013.pdf

    3/16

    3Te Minnedosa ribune Friday, August 9, 2013

    /8&.

  • 7/27/2019 August9 2013.pdf

    4/16

    4 Te Minnedosa ribuneFriday, August 9, 2013

    Darryl A. Holyk - Publisher & Editor- [email protected]

    Letterstothe

    Editor

    The Minnedosa Tribune Ltd.Box 930 Minnedosa, MB R0J 1E0

    Published Friday o each week rom the premises oTe Minnedosa ribune Ltd. 14 - 3rd Ave. S.W.

    Minnedosa, MB. R0J 1E0Member o Manitoba Community Newspapers Association

    and Newspapers CanadaAudited twice a year by Canadian Media Circulation Audit

    TRUSTED CONNECTED TARGETED

    Phone: (204) 867-3816Fax: (204) 867-5171Cell: (204) 867 - 7000

    Te Minnedosa ribune is independently owned and is theoldest weekly newspaper in the Canadian West and haspublished continuously rom the same premises sinceMarch o 1883. We acknowledge the fnancial support o theGovernment o Canada through the Canada Periodical Fund

    (CPF) or our publishing activities.

    E-Mail Addresses:

    General: [email protected]/printing: [email protected]

    Classifeds: [email protected]

    www.minnedosatribune.com

    T e Minnedosa ribune Ltd. does notguarantee the publication o all submitted articles andphotographs. Tese submissions, are at the discretion o thepublisher and will appear as space permits. Te Minnedosaribune reserves the right to edit any submission as deemednecessary by the publisher.

    We are not responsible or ax transmissions or emailsubmissions that are not received. o guarantee that suchsubmissions have been received please confrm with a phonecall or in person.

    All contents copyright 2013

    Sometime in the late

    evening hours o

    August 9th or

    the early morning

    hours o Tuesday,

    August 10th, 1993

    vandals wreaked

    havoc anddestruction at

    Minnedosa Cemetery.

    65 memorials were

    damaged, broken

    or smashed.

    Minnedosa Crime

    Stoppers and

    Town Council

    immediately ofered

    a $1,000 reward to

    solve this crime.

    Dear Editor,

    Canada has weatheredthe storm of the glob-al recession well, but as a

    trading nation in the global

    economy we are not im-mune to the problems that

    countries around the globe

    are facing today.

    With its focus on job

    creation, economic growth,

    and long-term prosperity,

    Economic Action Plan 2013

    is good news for Dauphin-

    Swan River-Marquette, and

    all of Manitoba. The plan

    continues to keep Canada on

    track to return to balanced

    budgets in 2015-16, and will

    keep federal taxes at their

    lowest level in 50 years.

    Thefi

    rst phase of Eco-nomic Action Plan 2013

    calls for increased skills and

    training support with the in-

    troduction of the Canada Job

    Grant. This grant will pro-

    vide $5,000 when matched

    by an employer to help

    Manitobans gain access to

    training at institutions, such

    as community colleges and

    trade schools, that will lead

    to high-quality, well-paying

    jobs.

    Manitoba small busi-

    nesses will benefit from

    Economic Action Plan 2013

    with the extension and ex-pansion of the hiring credit

    for small businesses. The

    hiring credit will save small

    businesses across Canada

    $225 million in 2013. An

    additional $20 million will

    be invested to help small

    businesses access research

    and business development

    services at universities andcolleges.

    For generations, our

    famers have fed Canada and

    the world, while providing

    jobs and career opportuni-

    ties to Canadians. Eco-

    nomic Action Plan 2013 will

    benefit part-time farmers by

    doubling the current deduc-

    tion limit under the restricted

    farm loss income tax rules

    from $8,750 to $17,500.

    Further our Government

    has increased and indexed

    the Lifetime Capital Gains

    Exemption from $750,000

    to $800,000. Not only will

    this ease the burden of plan-

    ning for retirement, but it

    will make it easier to trans-

    fer a family farm, to the next

    generation of entrepreneurs.

    Further, all farmers and the

    agriculture industry will

    benefi t from the increase to

    spending on competitive-

    ness, trade development,

    food safety, and environ-

    mental programming under

    Growing Forward II.

    Economic Action

    Plan 2013 strengthens our

    Government`s commitmentto the improvement of Man-

    itobas communities. The

    Community Improvement

    Fund will provide $32.2

    billion, over the next ten

    years, to help municipalities

    receive stable and predict-

    able funding in support of

    local infrastructure projects.

    The Building Canada Fund

    will provide $1.25 billion,

    over the next five years, to

    support economic infra-

    structure projects across

    Canada that have a national

    and regional significance.

    Our Government under-

    stands that investments in

    Canada`s public infrastruc-

    ture are crucial for job cre-

    ation, economic growth, and

    a higher standard of living

    for Manitoba`s families. Al-

    together the Conservative

    Federal Government has

    committed to $70 billion in

    stable infrastructure funding

    over the next ten years.

    In budget 2013 we

    have also recognized the

    importance of recreationalfi sheries in Canada and the

    contribution it makes to the

    economy. Our plan invests

    $10 million to work with

    local conservation and rec-

    reational fi shing groups to

    enhance and conserve fish

    habitat. A further $4 million

    will be invested towards

    marine conservation, and an

    additional $4 million will beprovided to protect our wa-

    ters from invasive species.

    Economic Action Plan

    2013 also confirms our

    Government`s support for

    hospitals, schools, and other

    important health and social

    services in rural Manitoba.

    In total, Manitoba will re-

    ceive $3.4 billion under Eco-

    nomic Action Plan 2013 in

    federal transfers. This will

    include $1.1 billion through

    the Canada Health Trans-

    fer, $443 million through

    the Canada Social Transfer,

    $1.8 billion through Equal-

    ization, and almost $7 mil-

    lion in total transfer protec-

    tion. Overall, the Plan willinclude $643 million more

    in federal transfer support

    to Manitoba than under the

    previous Liberal govern-ment.

    Economic Action Plan

    2013 will ensure the contin-

    ued prosperity of the Cana-

    dian economy. We are in-

    vesting in doctors, workers,

    small businesses and farms,

    and in rural communities

    like those in Dauphin-Swan

    River-Marquette.

    Sincerely,

    Robert Sopuck, MP

    Dauphin-Swan River-Mar-quette

    Economic Action Plan 2013 brings good news for riding

    20 years ago...

    SUBMIED

    wo more Holes-in-One were recently achieved atMinnedosa Gol and Country Club. On July 31st, NickButler shot one on hole $8 rom 191 yards using an 18 de-gree hybrid. Ten, on August 2nd, Karl Loewen shot oneon hole #12 rom 163 yards using a fve iron.

    More Holes-in-One

  • 7/27/2019 August9 2013.pdf

    5/16

    5Te Minnedosa ribune Friday, August 9, 2013

    TOP RATE1 year

    1.75%**Rates subject to changeCertain conditions may apply3 year

    2.10%*5 year

    2.40%*

    Dave McDonaldBruce McNabbwww.ricefnancial.com

    Call For More Terms & Rates 867-3946

    Te Minnedosa ribune welcomes Letters to theEditor. All letters must include the writers ull name,address, and telephone number. Only the writers

    name will be published; address and phone numberare required or confrmation. Anonymous letters willnot be published. Letters that are deemed libelous,in bad taste, or describe an incident involving otherpeople, will not be published. Te Minnedosa ribune reserves the right toedit letters based on taste, legality, clarity, andlength. Letters to the Editor can be submitted inperson, sent by mail to Box 930, Minnedosa, MBR0J 1E0, by ax (204) 867-5171, or by email [email protected]

    Letters to the Editor

    The Minnedosa

    & District

    Foundation

    Congratulations to Hayley Surovy,

    2013s recipient of the Verna Averill

    Memorial Scholarship. Thisscholarship is awarded to an M.C.I

    Grade XII graduate who plans on

    becoming a teacher. Hayley is

    enrolled at B.U. for the fall and

    upon graduating plans to teach

    middle years.

    By JENNIFER PAIGE

    his past Sunday inBowmanville, ON,Minnedosas country duo,Sister Reign took to thestage. Heidi Kornik andJodi McNabb, along with

    the Sister Reign band mem-bers, were selected as oneo eight top fnalists or theBoots and Hearts Music

    Festivals Emerging Artist

    Showcase.Boots and Hearts Music

    Festivalis the largest Cana-

    dian country music estivaland boast perormanceso more than 30 bandsincluding a mix o super-stars, such as Jason Alden,Miranda Lambert, DierksBently as well as a numbero emerging artists.

    Sister Reign was se-lected out o 200 appli-cants to perorm at theestival and participateor the chance to win theemerging artist showcase.Te other seven fnalistsin the running were Jor-dan Mcintosh, Rebekah

    Stevens, Abby Stewart,

    Te Hollowbodies, Jessica

    Mitchell, Te Reklaws, andWes Mack.

    Te Reklaws, romCambridge, ON endedup winning the showcase

    and were awarded withthe opportunity to openon the main stage in ronto 30,000 in attendanceor Dierks Bently, a mu-sic video agreement withCM, collaboration with asongwriter, studio time inNashville, as well as pro-duction and distributiono a single by a major re-cord company.

    Local Country Duo takes part in

    Star-studded Music Festival

    By JENNIFER PAIGE

    Have you recently hadsomeone knockingon your door trying to sell

    you something? Te meth-od o the door-to-doorsales is not as popular as itused to be, but i you do re-ceive a door-to-door sales-person in your home, it isimportant to be inormed.

    Minnedosa RCMPhas recently received nu-

    merous complaints aboutdoor-to-door salespeoplein the area. Local RCMPhave investigated the com-pany and report that theyare a legitimate company

    with a license rom thecity.

    Te common com-plaint reported to RCMPis repeated visits to unin-terested parties as well asconvincing residents whodo not need the productinto purchasing. However,according to the RCMP thecompany is not doing any-thing illegal.

    I your home is ap-proached by a door-to-door salesperson, be sureto ask to see the company

    issued identifcation andsellers license or registra-tion. All legitimate door-to-door salespersons arerequired to carry properidentifcation.

    Do not be pressuredinto buying anything. I

    you are interested in theproduct, ask or sales orproduct inormation andplan to call and order or

    visit local stores that sellsimilar products. Alwaysbe sure to compare pric-es as some door-to-doorproducts may be over-priced.

    In Manitoba, consum-ers are protected by theConsumer Protection O-fce, which hears, mediates

    and investigates consum-er-related complaints orconcerns.

    Every province andterritory in Canada alsohas a cooling o period,a specifc number o daysduring which you may

    cancel a contract you havemade with a door-to-doorsalesperson or any rea-son. According to the Con-sumer Protection O ceo Manitoba, anyone whopurchases something roma licensed door-to-doorsalesperson has a 10-dayright to cancel.

    For more inorma-tion on consumer rights orconsumers rights to can-cel, contact the Consumer

    Protection O ce o Mani-toba: Contact: 204-945-3800, oll-ree: 1-800-782-0067, email: [email protected] website: www.gov.mb.ca/cca/cpo/index.html

    Be an informed consumer

    Photo submitted

    Minnedosas Sister Reign poses for a photo at theBoots and Hearts Festival in Ontario.

    By JENNIFER PAIGE

    My frst week athe ribuneduring August long

    weekend has been ullo excitement, amaz-ing volunteer enthu-siasm, town spirit andsome people that sureknow how to rock inthe mud!

    As or a little bit

    about mysel, I wasborn and raised inBrandon, MB. Liv-ing close to Minnedosa growing up, I spent quite abit o my summer time here. Ater graduating highschool I spent some time travelling beore moving toLethbridge, AB. I attended Lethbridge College andgraduated rom the Communication Arts program

    with honours. Ate r graduation I settled in Winnipeg,and began working or a publishing company in thedowntown centre which publishes a number o agri-culture related magazines.

    Ater spending some time in the city, I deter-mined that big city lie was not or me. And alas, Iound Te ribune. I am excited to take on this newposition and as I become a regular by-line, please bepatient as I learn names, aces and the ins and outs othe town.

    Working in the feld o journalism is a privilegethat provides me with the opportunity to listen, askquestions and tell peoples stories. Tank-you all orthe warm welcome I have received, I look orwardlearning your stories and immersing mysel in thispaper.

    Meet our new

    reporter, Jennifer

  • 7/27/2019 August9 2013.pdf

    6/16

    6 Te Minnedosa ribuneFriday, August 9, 2013

    7KH0LQQHGRVD5RWDU\&OXEZRXOGOLNHWRWKDQNDOOWKRVHZKRSXUFKDVHGWLFNHWV0D[0F1DEEDQG

    WKRVHZKRDWWHQGHGWKH$QQXDO&OXE'UDZ

    RQ-XO\

    &RQJUDWXODWLRQVWRWKHIROORZLQJZLQQHUV

    'DYH%DLOH\

    0DF0DUJ'DYLGVRQ

    5LFN7D\ORU

    0DXULFH.LQJGRQ

    )D\H/DUU\&LEXOD

    .DWKHULQH0LNH.LQJGRQ

    *UHJ&UDVDQWL

    'HDQ:DUHKDP

    5RE6PLWK

    7HUHVD%ULDQ.LOLZQLN

    2OLYH7HPSOHWRQ'RULV0F1DEE

    'HE3ULWFKDUG

    $UQROG.LQJGRQ

    'HQQLV0F1DEE

    5RVV%XUQVLGH

    5D\&KHU\O2UU/LFHQVH5)

    Minnedosa Golf ClubMinnedosa Golf ClubExpansion Committee

    Cash Calendar Draw Winners

    for the Month of July 2013

    Lottery License #MGCC3945RF

    Eleanor & Dave Marnock $250

    Stan Rainkie $50

    Jen McDonald $30Martin Woronchuk $30Kevin Hill $30Wayne Cowan $30

    $20 Winners^D

    dDDEZ^^:d

  • 7/27/2019 August9 2013.pdf

    7/16

    7Te Minnedosa ribune Friday, August 9, 2013

    13082gg05

    By RAVENS GLEN WI

    Congratulations andbest wishes to Peterand Karen Dymtriw who

    will celebrate their 25thwedding anniversary onAugust 10th, we all wishyou many more.

    Don and Wendy Fer-guson o Edmonton calledin to visit Ralph and ShirleyPedersen on July 28th.

    Gordon and Enid Clark

    spent several days at Mani-tou Beach Resort and Spaenjoying the mineral wa-ters there. Tis lake is along narrow basin thatallows water to enter butthere is no drain out, andthe eastern access road hashad to be built up by sev-eral eet.

    Friends and neigh-bours gathered last Fridayevening to help Ralph andShirley Pedersen celebratetheir 50th wedding an-niversary with cake, icecream and visiting. On

    Saturday, August 3rd, theiractual anniversary date,the amily took them onthe Martese boat cruise atClear Lake and then outor an Anniversary dinner.Congratulations rom all

    your riends.Shirley Pederson spentthe long weekend in Bran-don with her sister Bernice

    Atkinson and helped hercelebrate her birthday.

    Dennis Pedersen isnow an of cial masterangler when he caught a

    trophy catsh recently. IanLamb was shing with himand also caught a largecat sh, which they boththen released ater the pic-ture taking! Dennis andBarb Pedersen have had

    a young black bear around

    their yard easting on theirsaskatoon bushes.Happy birthday wish-

    es are sent out to Ida Brad-ley, Peter Weetman and LilFarrend who celebratedbirthdays this past week.Heres wishing you manymore! Lils daughter Lou-ise o Calgary is here visit-ing her mother, and sisterHolly and Albert Shurvelland amily.

    Several riends andrelatives attended the babyshower held in Sandy Lakeor the new daughter o

    Melissa and Chad Davies.She is another great-nieceor Hilda Davies.

    Shannon and CindyDalke, Melanie and ylerspent a week holidaying atGrand Beach in July.Bob and Willine Younghad their amily here tocelebrate Willines specialbirthday at the Royal OakInn. Tey brought theirgrandchildren, Bobby andBrooke home to spendseveral days with them.Rob Young was here on the

    long weekend to pick upthe children to take home.Roger, Nancy and amily

    were all here or the longweekend to visit, alongwith Robin and StaceyBradley.

    NEWDALE NEWS

    SUBMITTED

    Midwest won thisyears provincialbantam AAA baseballchampionship on Sunday,

    August 4th in Morden, MB.Morgan Geekie

    pitched a complete gameve-hitter, striking out ninebatters, helping Midwestdeeat host South Central

    3-1 in the championshipnal.

    o advance to thechampionship game, Mid-

    west wound up deeat-ing North Winnipeg 9-4in a semi nal on Sundaymorning. Adam Robidouxhit a three-run home runor Midwest en route to the

    victory.Midwest went unde-

    eated in the tournament,winning all our o theirround robin games. Teteam now moves on to the

    Baseball Canada BantamChampionship, slated totake place August 22nd-26th in Vaughan, ON.

    T e squad includesDayton Heino andRyan McLenehan romMinnedosa. MorganGeekie and Blake Mervyn(Strathclair), Riley Sham-ray (Oak River), BrodySmith (Hamiota), DarcyBuhler (Macgregor), ChadKilimnik (Russell), AdamRobidoux (Binscarth),Noah Lemoine (St. Lazare),

    Keenan Lewis (Miniota),Nick Kuharski (Neepawa),and Joben Smith (Foxwar-ren).

    1993 - Tanks to a do-nation o $2,500 rom theDepartment o NaturalResources, the MinnedosaFish Enhancement Com-mittee is ormed. A localCrime Stoppers Board isalso ormed.

    1973 - A spokespersonor Sedco Drilling Co. o

    Calgary, AB said his com-pany will be drilling orgas and oil west o SandyLake.

    1963 - Rolling RiverSchool Division will paythe Village o Erickson$14,000 or the installa-tion o water and sewerservices to the projectedhigh schools propertyline. T is payment willcover all taxes or 20 years,however, RRSD will haveto pay the usual water

    rates.

    1943 - Seven cases omeasles are reported inthe Crocus District.

    1933 - Ater raids havebeen conducted or ten

    years, a still is nally dis-covered in the Bethanyarea. A ne o $200 ischarged to its operator.

    1913 - Schools are set tore-open on August 18th.

    1903 - Letters patentare issued incorporatingP.J. McDermott, H. Mut-ton, J.W. Tompson, H.F.Maulsen and R.. Sander-son as Minnedosa MillingCompany with a capital o$25,000.

    )256$/(%

  • 7/27/2019 August9 2013.pdf

    8/16

    8 Te Minnedosa ribuneFriday, August 9, 2013

    RockinallweekendRockin the Fields photos by Jennifer Paige

    Sundays rain turned roads to a muddy mess.

    Continued from Page 1

    Some heavy rain and cool evening temperatures didnot stop the crowds or campers. Te rain was a bit o a

    bummer, but it is expected. Unavorable weather isnt go-ing to stop these people, says Gail McGillvery, a Winni-peg resident, attending her third Rockin the Fields.Tis

    estival and the people that attend have the best energy.It is my avourite summer event. Tere is nothing betterthan spending a weekend outdoors, with great music and

    great people.

    Other perormances throughout the weekend in-cluded FilthyLucre, Te Headpins, Until Red, One Bad

    Son, Nuthin But rouble, Te Dust Rhinos as well as nu-merous emerging bands. Attendees also had the oppor-

    tunity to participate in a scavenger hunt, a exas holdemtournament, a volleyball tournament, a rock trivia con-test, and many attendees avourite estival extrathebest campsite competition.

    As Rockin the Fields continues to grow in atten-dance every year, organizers say they hope to reach 7000-8000 attendees a day, in the uture. Rockin the Fields

    2014 presale prices are in efect until August 31st. Duringthe pre-sale, you may also purchase your current or un-occupied campsite, however ater the pre-sale campsites

    cannot be held.

    Monster ruck plays the main stage.

    Monter rucks Jeremy Widerman.David Berenner of T eory of a Deadman.

  • 7/27/2019 August9 2013.pdf

    9/16

    9Te Minnedosa ribune Friday, August 9, 2013

    Continuedrom Page 1

    Future rodeo com-petitors had a chance to

    try their hand at the alwaysentertaining Muttin Bus-tin event during the main

    rodeo intermission. Whilethere were some cashprizes or the top riders,

    all young muttin busterswalked away with a bag ochips and drink. We may

    see some o these young

    cowboys and cowgirlscompeting in Heartland

    Rodeo events in the uture.Rodeo is a real am-

    ily sport, mentioned an-

    nouncer Ivan Ahntholz.Tese olks dont compete

    against one another; theyonly compete against theirown last ride or last run.

    Following Saturdaysrodeo perormance, thedisplay building came

    alive with music and com-radery as the annual ro-deo social gave competi-

    tors and spectators alike achance to kick back, relax,enjoy a ew cold ones or

    kick up their heels on the

    dance f oor to the purecountry sounds oBrothersof the Road. During the so-cial, auctioneer erry Woy-chyshyn Sr. auctioned o

    a number o abulous do-nated prizes during a live

    undraising auction. Teauction brought in over$1,400 or the local rodeo

    committee.Despite the rain, Sun-

    days rodeo perormance

    went ahead giving com-petitors the added chal-lenge o a mucky rodeo

    arena to compete in.T e 2012 edition o

    the Minnedosa Rodeo was

    named Heartland Rodeo

    Associations Rodeo othe Year. Minnedosa also

    earned this welldeservedtitle back in 2009.

    Logan Bridgeman o Rivers was one o 16High School Tie Down Ropers.

    Aaron Lee and Erin Cathcart show of their Team Roping abilities.

    Mike Denbow earned a 18.03 inTie Down Roping.

    Long Weekend Rodeo Action

    Saskatchewans Mason Helmeczi ridesbareback in Mondays High School Rodeo.

    Sean Tesarski takesa wild ride on

    Payday the bull.

    Robyn Denbow races around a barrel Saturday night.

    Rodeo photos

    by Darryl Holyk

  • 7/27/2019 August9 2013.pdf

    10/16

    10 Te Minnedosa ribuneFriday, August 9, 2013

    By LISA BILCOWSKI

    With the Library Sum-mer Reading pro-gram in ull swing, our

    weeks have been busy withyoung people spendingtime reading and have un

    at the library. Tere havebeen numerous activitydays, a movie day, as well

    as a visit rom MagicianRyan Price. Te kids werequite entertained by tricks

    that included a visit romSimon the Rabbit and Alexthe Parakeet!

    A heads-up to all oureBook readers, eLibrarieshas made some big chang-

    es as o August 1st. Tereare some great new up-grades to help make your

    loaning experience easierand more convenient. I

    you continue to have some

    troubles, please give us a

    call or drop by and we willdo our best to help you out.

    NEW TITLES

    Easy Reads

    Te French Fry King by Roge

    Mr. Kings Tingsby Genevieve Cote

    Night Sky Wheel Rideby Sheree Fitch

    Juvenile Fiction

    Into the Woodsby J. orres

    Te Reluctant Journalof Henry K. Larsenby Susin Nielsen

    Spirit Wolfby Kathryn Lasky

    Young Adult Fiction

    40 Tings I Wantto ell You

    by Alice KuipersAwaken

    by Meg Cabot

    My Book Of Life By Angeliby Marine Leavitt

    Fiction Novels

    Te Accidental Husband by Jane Green

    Big Girl Panties

    by Stephanie EvanovichDeath Angel

    by Linda FairsteinTe Dinner

    by Herman Koch

    First Sightby Danielle Steel

    Te Girl in the Wallby Alison Preston

    Revenge Wears Pradaby Lauren Weisberger

    Non-Fiction Reading

    Bathroom IdeasYou Can Use

    by Chris PetersonTe Boys in the Boat

    by Daniel James Brown

    Pilgrims Wildernessby om Kizzia

    Run, Brother, Run

    by David BergTe Jugglers Childrenby Carolyn Abraham

    Keep on top o whatsgoing on at the library so

    you dont miss out on uncontests, activities andprograms of ered in the

    community. Visit us at 451st Ave S.E. or www.discoverminnedosa.com. You

    can also check us out on

    Facebook by searching orMinnedosa Regional Li-

    brary. Find book recom-mendations, see what oth-ers are currently reading

    and view photos o whatshappening at the Library.

    MAIL THIS FORM WITH PAYMENT TO BOX 930,

    MINNEDOSA, MB R0J 1E0 PHONE 204-867-3816

    NAME:

    ADDRESS:

    TOWN:

    PROVINCE:

    POSTAL CODE:Online subscriptions at

    www.minnedosatribune.com

    Within Manitoba:

    $37.29 tax included

    Other Canadian locations:

    $34.65tax included

    New Subscription

    Renewal

    Subscribe to The Minnedosa Tribune

    Library Corner

    By DIANE BACHEWICH

    Editors note: We apol-ogize or the ollowingerrors rom last weeks re-port.

    Bev Marchischuk hadher nephew Dennis andEva Wahoski o Salmon

    Arm, BC visiting with her.During Heritage Days,

    the rope making demon-

    stration was done by An-thony Kowalchuk, ErnieBachewich and Dave Rys-

    tephanuk.Shelly, Carlin and Vic-

    toria Bedrey o Vanscoy, SK

    visited with Diane Bache-

    wich and also attended theSichewski-Stasiuk amily

    reunion.Under the congratula-

    tions to Pam Spitula andGraham Fediuk on their

    recent marriage it shouldhave stated that Pam is thedaughter or Dennis andDebbie Spitula.T is weeks report:

    Robert and Liz Mandzukhad Lizs brother, Harold

    Culp o Orangeville, ONholidaying with them. Teyalso had their daughter

    Risa and granddaughterKaiya Adams o St. Cath-erines, ON spending some

    time here beore joiningher husband Andres inNelson, BC. Risa has a doc-

    tor position at the medical

    clinic in Nelson and theywill be making their home

    there.Happy birthday to

    Nestor Drul who cel-ebrated his 84th birthday

    with cofee and cake at theDrop-in Centre.Word has been re-

    ceived o the passing o

    Dennis Bain, age 65, inFernie, BC. Dennis is theson o the late Mike and

    Rosie Bain.Gloria Campbell madea quick trip to Calgary tak-

    ing her grandchildrenback. T ey spent sometime with their grandma

    Glo.Summer visitors with

    Liz and Lorrie Antonation

    were Calvin and ammy

    Antonation and amily oPincher Creek, AB; Brenda

    King, Chris Antonation,Fred Wurmuth o Bran-don, MB; Erin Zurbyk rom

    Winnipeg, MB; Matt Kingrom Rivers, MB; Cindyand Joe Zurbyk, Les and

    Faye Antonation o Elphin-stone, MB; Michael andLena Shewchuk o Win-

    nipeg; Vicky Kiryluik oDauphin, MB; Robert and

    Wendy Nykolaishen o Vic-

    toria, BC also visited withall other amilies. Tis is a

    yearly get-together and itdidnt even rain this year.

    Sympathy to the am-ily o Sadley Mushie whopassed away in Brandon.Sadley was born and raised

    here in Sandy Lake.Ida Andreychuk has

    returned home ater visit-

    ing with daughter Glendaand Darrell o SherwoodPark, AB and with son

    Mark and amily in Nelson,BC and with her sister-in-laws Mary and Doreen and

    amily in Kelowna, BC.Gary and Doreen

    Derhak o Calgary, AB are

    holidaying or a couple o

    weeks with mom, Helen

    Derhak and the rest othe amilies. Gary just got

    back rom a salmon sh-ing trip to Nootka SoundWilderness Lodge, west oCampbell River on the Pa-

    cic Ocean. A good catcho salmon was caught andthis time, the big ones nev-

    er got away!John Domaschuk re-

    turned home rom an en-

    joyable western holidayto Lacombe, AB where hespend some time with son

    Blair and amily. He thentravelled to Calgary to seeson Lindsay and while

    there visited with Sam

    and Donna Backlin and

    daughters. From there,Lindsay accompanied his

    dad to Kelowna, BC wherethey spent some time withJohns sister Mary andamily and brother Leon-

    ard. While there, they cel-ebrated Leonards 80thbirthday. Daughter Holly

    and amily o Victoria, BCjoined her ather or a visitalso.

    Sympathy is extendedto the amily o the lateJohn Lenkewich, who

    passed away at the age o90 years on July 11th at theCharles Wood Personal

    Care Home.

    SANDY LAKE NEWS

    6321625

    &223

    Shotgun Start: 6:00 p.m.Stableford Scoring

    22-3

  • 7/27/2019 August9 2013.pdf

    11/16

    TO PLACE AN AD

    BY PHONE C 867-3816Hours to place, correct or cancel ads:Monday - Friday 9 a.m. - 4 p.m.

    BY MAIL CLASSIFIED ADVERISINGT M bu, P.O. Bx 930,

    M, Mtb R0J 1E0

    BY FAX 204-8675171

    BY E-MAIL [email protected]

    Te Minnedosa ribune Ltd. reserves the right todelete any words or phrases deemed by Te Minnedosaribune Ltd. to be objectionable, or to reuse to publish anyadvertisement. Te Minnedosa ribune Ltd. shall not beresponsible or any loss or damage to any advertiser or thirdparty resulting rom the ailure o an advertisement to appearin Te Minnedosa ribune Ltd. or rom any error or omission

    in any advertisement which is published.

    RATES

    $9.00 or frst 40 words, additional words .10 each.

    Repeat ads - Hal Price.

    Classifed Display - $9.00/col. inch each insert.

    (Incl. logo, box & bolding, and centering).

    Happy Snaps: (Birthday, Engagement, Wedding, Birth, &Graduation)- $16.00 or the frst 20 words and the picture.

    Obituaries: $6.50 per col. inch.

    Reach the entire province (50 weekly newspapers) $189.00Westman and Eastman: $119.00

    All Ads plus 5% G.S..

    DeadlinesClassifed advertisements must be submitted no laterthan noon uesday or insertion in the ollowing Fridaysedition. ALL CLASSIFIED ADVERISEMENS MUS BE

    PREPAID BEFORE INSERION.

    Te Minnedosa ribune is not responsible ortypographical errors published AFER the frst insertion, nordoes it assume responsibility or errors published as a result oan advertisement placed, changed, or cancelled, by telephone.o ensure your advertisement appears correctly please submit it

    in person, by ax, mail, or email.

    WANTED

    11Friday, August 9, 2013The Minnedosa Tribune

    TO PLACE AN AD

    BY PHONE C 867-3816

    Hours to place, correct or cancel ads:Monday - Friday 9 a.m. - 4 p.m.

    Y MAIL CLASSIFIED ADVERISING

    T M bu, P.O. Bx 930,

    M, Mtb R0J 1E0

    Y A 2 4- 1 1

    BY E-MAIL [email protected]

    Te Minnedosa ribune Ltd. reserves the right todelete any words or phrases deemed by Te Minnedosaribune Ltd. to be objectionable, or to reuse to publish anyadvertisement. Te Minnedosa ribune Ltd. shall not beresponsible or any loss or damage to any advertiser or thirdparty resulting rom the ailure o an advertisement to appearin Te Minnedosa ribune Ltd. or rom any error or omission

    in any advertisement which is published.

    RATES

    $9.00 or frst 40 wor s, a itiona wor s .10 eac .

    Repeat ads - Hal Price.

    Classifed Display - $9.00/col. inch each insert.

    (Incl. logo, box & bolding, and centering).

    Happy Snaps: (Birthday, Engagement, Wedding, Birth, &Graduation)- $16.00 or the frst 20 words and the picture.

    O ituaries: $6.50 per co . inc .

    Reach the entire province (50 weekly newspapers) $189.00Westman and Eastman: $119.00

    A A s p us 5% G.S..

    DeadlinesClassifed advertisements must be submitted no laterthan noon uesday or insertion in the ollowing Friday sedition. ALL CLASSIFIED ADVERISEMENS MUS BE

    PREPAID BEFORE INSERION.

    Te Minnedosa ribune is not responsible ortypograp ica errors pu is e AFER t e frst insertion, nor

    oes it assume responsi i ity or errors pu is e as a resu t oan a vertisement p ace , c ange , or cance e , y teep one.o ensure your advertisement appears correctly please submit it

    in person, y ax, mai , or emai .

    FOR SALE

    GARAGE SALES

    COMING EVENTS

    REAL ESTATE HAPPY BIRTHDAY

    REAL ESTATE

    CAMPER

    FOR SALE

    Selling something? Let

    our readers know! Place an adin Te ribuneClassifeds start-ing at $9.00 plus tax. (tn).

    Watkins. Call Elaine at204-761-2938 (evenings).

    1997 electric Yamahagol cart with charger, canopy,

    windshield, club hood andcanvas storage cover; excellentcondition. $3,500. Phone 204-848-7603. (x)

    Princess antique bed, 72long, 36 wide, rod iron brass,great condition, $140.00 obo;Sanyo ECR 305 cash registerrom Winnipeg Cash Register

    Company, $75.00; York weightset, 230 olding bench, spacesaver, 8-2 1/2 lb weights, 4-5lb

    weights, 6-10lb weights, $50.00; ton metal truck tool box 21

    wide x 31 high x 5t length,$150.00; wooden shop table on

    wheels, 65 length, 24 wide, 3t tall, $50.00; Hammond organ$25.00; wooden o ce desk,5t length, 22 wide x 31 tall,$30.00; o ce desk 4 t length x30 wide x 31 tall, $30.00; 2 endtables and 1 coee table, metal

    with assorted clay stone on top,$75.00. For ino call 204-867-2553. (22-3x)

    2005 Ameri-Camp Sum-mit Ridge 30 oot long, bump-er hitch-Queen bed(separateroom)- Quad bunks (separateroom)-Sleeps 8- Large Fridge-expandable kitchen table-Pullout soa bed- Large awning-

    Sewer, water, propane andcable hookups. Delivery Avail-able. $13,499 OBO 204-573-1412 or 204-761-7803. (21-3)

    Looking or something?Our readers may have it! Placean ad in Te ribuneClassifedsstarting at $9.00 plus tax. (tn)

    Garage sale undraiseror Robyn Dragans 11 monthmission trip. I you have anyitems to donate, please dropo at 215 2nd St. N.W. or call204-867-0468 or 204-867-1978. Garage sale will take

    place at the Minnedosa Cal-vary Church, 52 2nd Ave S.W.on August 17th at 9:00 a.m.(21-2x)

    Multiamily yard sale:toys, household items, chil-drens books, petite size cloth-ing on Saturday, August 10th,10:00 a.m. 2:00 p.m., 7-4th

    Ave. NE. Cancelled i raining.(x)

    NEW HOME FOR SALE

    Beautiul, open-concept 1308sq. t. bungalow fnished

    top-to-bottom built in 2010.Home eatures walk-out

    basement, 3 + 2 bedroomsand 3 bathrooms located in anewly developed residentialarea o Minnedosa. Nicely

    landscaped back yardoverlooks the own rom thedeck or rom the brick patioarea below. In-oor heated

    double attached garage.Includes main oor laundry

    pair as well as stainlesssteel kitchen appliances.oo many extras to list.

    $338,000.00Call or text 204 867-7405 or

    204 867-7154(18-2x)

    1RZ%XLOGLQJ6FHQLF5LGJH(VWDWHV

    &RQGRV

    8QLWV$YDLODEOH)RUGHWDLOVFDOO

    3HWHU+DUULVRQRI6XWWRQ+DUULVRQ5HDOW\

    OPEN HOUSESaturday 2 - 3:00 p.m.

    Come and Go bridalshower in honour o Kristinaman, bride-elect o RyanHyrsak, to be held on Saturday,

    August 10th rom 2:00 4:00p.m. at the home o the groomsparents, Delmar and KarenHrysak, 165 3rd St. S.E. (21-2x)

    You are invited to a bridalshower on Sunday, August11th, 2013 in honour o ALwk, daughter o Lenand Pam, engaged to mCm, son o Stew and

    Kathy (o Forrest, MB) at theSandy Lake Community Hall at2:00 p.m. Everyone Welcome!(21-2x)

    Join us or a bridal show-er in honour o KKut, bride-to-be o Ryan Syn-chyshyn on Sunday August11th rom 2 4 p.m. at 3452nd St. S.E Minnedosa. Pleaseaccept this as your invita-tion. (21-2x)

    BRIDALSHOWERS

    Kaylan and Bryan Pinutao Minnedosa

    are excited to announce

    the arrival o their baby girlon

    May 26, 2013,Madelynn Rose Marie.

    Proud grandparents areMurray and Eileen rott

    o Minnedosa,David and Diane Pinuta

    o Winnipegand great grandma is

    Frances rotto Minnedosa.

    (x)

    BIRTHANNOUNCEMENT

    It took 50 years to

    look this good!From your riends at the

    Minnedosa Vet Clinic.

    Have an upcoming eventyoud like to let everyoneknow about? Get the wordout there with a ComingEvent listing in Te ribune.

    Ads starting at $9.00 plus tax.(tn)

    UC Bingo at UkrainianHall, uesday nights. Doorsopen at 6:00 p.m. Early bird at7:00 p.m. ollowed by regulargames. License #3359 B1 and3359 BO. (47-tn)

    Elphinstone Lions Club,8th annual yard sale. Satur-day, August 17th, 2013, 10:00a.m. 2:00 p.m. at the LionsPark. I bad weather in thehall. ables $10.00 each or3 or $25.00. o book a tablephone 204-625-2423. No out-side ood concessions. Lunch

    Available. (21-2x)

    Newdale Horticul-tural Society Flower Show.

    Wednesday, August 14th,2013. Doors open at 2:00 p.m.Roast Bee supper rom 5:00 7:00 p.m. Adults $10.00 Chil-dren (6-12yrs) $5.00 5 andunder FREE. Everyone Wel-

    come! (21-2x)

    Te Prayer group romMinnedosa Calvary Church

    would like to invite you toa ree BBQ on Wednesday,

    August 21st rom 11:30 a.m. 1:00 p.m. at the annersCrossing Park. (22-2)

  • 7/27/2019 August9 2013.pdf

    12/16

    12 Friday, August 9, 2013 The Minnedosa Tribune

    HELP WANTED

    NOTICE

    DAYCARE

    PAINTER

    COMING EVENTS

    Minnedosa Service toSeniors Congregate Meal

    Program serving suppermeals or seniors at theownview Manor 6th fooruesdays, Tursdays,Sundays starting at 5:00p.m. $8.00 dine in, $10.00delivered. Call 204-867-2198 ater 1:00 p.m. on dayo the meal or call 204-867-5190 or all other inquiries.Service to Seniors Menu:

    Ag 11h:

    Bee stew with biscuits,rolls, potatoes, vegetable,salad, pickles, dessert, tea

    or coeeAg 13h:

    Roast chicken with gravyand dressing, rolls, potatoes,

    vegetable, salad, pickles,dessert, tea or coee

    Ag15h:

    Grilled pork chops, rolls,potatoes, vegetables, salad,

    pickles, dessert, tea orcoee

    (12-tn)

    Save the Date Satur-day, September 28th Saluteto Broadway eaturing AaronHutton and Friends. icketsales at Co-op September13th, 14th and 20th. Watch ordetails. (x)

    Gold Rush Vacation

    Bible School is coming toMinnedosa Covenant Churchrom August 19th 23rd, 9a.m. noon. All children rompreschool (age 3+) to gradesix are welcome. Games, Bi-ble stories, crats, prizes andmore! Phone 204-867-2810or more inormation. (22-2)

    August 17th at Franklin Hallrom 2:00 4:00 p.m.

    60th wedding anniversary orRon and Beryl Parrott.

    (-x)

    Te MINNEDOSAHORTICULTURAL SOCI-

    ETYwants you to come andhelp us celebrate our 100THANNIVERSARY with birth-day cake at the MCCC dur-ing our annual fower show.uesday August 20th rom2:00 to 4:00 p.m. Entries willbe accepted rom 5:00 to9:00 p.m. on Monday August19th and rom 8:00 a.m. to9:00 a.m. on uesday mor-ning August 20th. Books andtags are available at the AgO ce and Flowers on Main.

    All exhibitors are very wel-come. Everyone is welcometo view the displays rom 2:00to 7:00 p.m. Te Junior Awardprogram is at 7:30 p.m. and

    sale o veggies and fowers at8:00pm. NO Admission - rain-bow auction on site. (22-2)

    Kingdon Electric is nowworking exclusively on theprojects o one general con-tractor and so will not be ac-cepting work rom any othercustomers. I apologize or anyinconvenience, and wouldlike to thank past customersor their support. (21-2x)

    Qualied Painter with25 years experience. All workguaranteed. Call Blaine at204-874-2399. (43-tn)

    Mcavishs Ice CreamParlour at Clear Lake requires

    ull-time or part-time help.For interview, phone 1-204-848-7366. (19-4x)

    Little Sprouts ChildcareHome is SAYING in Minne-dosa!!! I currently have oneInant/Preschool spot andthree School-Age spots avail-able starting ASAP. I am a li-censed ECE II, and providetons o outdoor play as wellas developmentally appropri-ate activities. I also providetwo snacks and a hot home

    cooked lunch daily. We goon eld trips within walkingdistance o my house, andoten spend all day exploringoutside! I am open 7:30 a.m.- 5:00 p.m., Monday-Friday.Please call Karen at (204)867-3626 or email shaash79@

    yahoo.ca, or more inorma-tion or to book a spot! ( 16-tn)

    Little Wonders CountryDaycare near Erickson has var-ious spots available or Augustand September. I also have oneull time inant/preschool spotavailable late August. I you

    would like more ino please callLynne at 204-636-2931 (21-5x)

    Instructor Clinical Nursing

    Half-Time Term (.5) from August 2013 up to June 2015School of Health Sciences & Community Services

    Neepawa Rural Bachelor of Nursing Site

    Red River College is a leader in applied learning and innovation. Our talented team of employees is passionate about education,innovation and student success. We offer competitive salaries, extensive benefits, and the opportunity for personal and professionalgrowth in a rewarding career. Together, we are going places.

    Duties: The primary responsibility of this position is to teach, mentor, supervise and evaluate nursing students in the clinicalpractice settings for the Red River College LPN to BN Neepawa rural location. Other responsibilities include maintaining clear andcurrent communication and consultation with the Neepawa site classroominstructor and the RRC main campus, the rural programcoordinator and the Clinical Course Leader.

    Qualification Requirements:Required:

    Baccalaureate Degree in Nursing. Applicants with a Diploma in Nursing and significant clinical expertise may beconsidered

    Registration or eligibility for registration with the College of Registered Nurses of Manitoba Experience and competence as a practitioner in the areas of medical, surgical and gerontological nursing Interpersonal communication competence and the ability to relate to a diverse nursing student population Computer skil ls Cultural sensitivity Commitment to lifelong learning

    Assets: Previous clinical teaching experience

    Conditions of Employment:x This position may be required to work evenings

    We seek diversity in our workplace. Aboriginal persons, women, visible minorities and individuals with disabilities areencouraged to apply.

    Competition Number: 2013-117

    Closing Date: August 23, 2013

    Salary Range: $28.19 to $41.88 per hour

    *The successful candidate with a Masters or PhD in a related field will receive anEducational Supplement of $2,725 or $5,450 per annum respectively pro-rated on anhourly basis.

    Apply to: Red River CollegeC410 - 2055 Notre Dame AvenueWinnipeg, MB R3H 0J9Fax: 204-694-0750e-mail: [email protected]

    We thank all applicants for their interest, but only those selected for an interview will be contacted.

    For more information and other employment opportunities, visit www.rrc.ca/employment, http://www.rrc.ca/hiringprocess ,www.rrc.ca/peopleplan & www.rrc.ca/about.

    *(1(5$/0$1$*(5675$7+&/$,5&223

    7KH&RRSHUDWLYH5HWDLOLQJ6\VWHP&56LVDXQLTXHPXOWLELOOLRQGROODURUJDQL]DWLRQEDVHGRQWKHIXQGDPHQWDOSULQFLSOHVRIFRRSHUDWLRQ,WLVFRPSULVHGRIDQHWZRUNRIDSSUR[LPDWHO\DXWRQRPRXVUHWDLOFRRSHUDWLYHVDFURVV:HVWHUQ&DQDGDDORQJZLWKWKHLUEUDQFKRSHUDWLRQVDQG)HGHUDWHG&RRSHUDWLYHV/LPLWHG)&/)&/LVWKHZKROHVDOLQJPDQXIDFWXULQJDUPRIWKH&56

    ZKLFKSURYLGHVWKHUHWDLOFRRSVZLWKDUDQJHRISURGXFWVDQGVHUYLFHV6WUDWKFODLU&RQVXPHUV&RRS/WGLQYLWHVDSSOLFDWLRQVIRUWKHSRVLWLRQRI*HQHUDO0DQDJHU5HSRUWLQJWRDQHOHFWHG%RDUGRI'LUHFWRUVWKH*HQHUDO0DQDJHULVUHVSRQVLEOHIRUDOODVSHFWVRIWKH&RRSVRSHUDWLRQLQFOXGLQJPDUNHWLQJPHUFKDQGLVLQJILQDQFLDOPDQDJHPHQWKXPDQUHVRXUFHVDQGPHPEHUDQGERDUGUHODWLRQV7KHRSHUDWLRQLQFOXGHV)RRG+RPH&HQWUH*HQHUDO0HUFKDQGLVH/LTXRU/RWWHU\$JUR3HWUROHXPDQG3XPSV7KHVXFFHVVIXOFDQGLGDWHVKRXOGKDYHSULRUUHWDLOPDQDJHPHQWH[SHULHQFHZKLFKLQFOXGHVRYHUVHHLQJDODUJHVWDIIFRPSOHPHQW7KHLQGLYLGXDOPXVWDOVRKDYHGHPRQVWUDWHGVWURQJOHDGHUVKLSH[FHSWLRQDOFRPPXQLFDWLRQDQGLQWHUSHUVRQDOVNLOOVDQGVWURQJSODQQLQJDQGRUJDQL]DWLRQDOVNLOOV6WUDWKFODLU&RQVXPHUV&RRSRIIHUVDFRPSHWLWLYHVDODU\DFRPSUHKHQVLYHEHQHILWVSDFNDJHKRXVLQJDQGH[FHOOHQWRSSRUWXQLWLHVIRUDGYDQFHPHQW7RDSSO\SOHDVHVHQGDFRYHUOHWWHUDQGUpVXPpWRWKHHPDLODGGUHVVEHORZRU

    6WUDWKFODLU&RQVXPHUV&RRSHUDWLYH/WG

    %R[6WUDWKFODLU0E5-&

    $WWQ'DUUHQ5R]GHEDHPDLOGBUR]GHED#KRWPDLOFRP

    :HWKDQNDOODSSOLFDQWVIRUWKHLULQWHUHVWEXWRQO\WKRVHFDQGLGDWHVFRQVLGHUHGIRUDQLQWHUYLHZZLOOEHFRQWDFWHG&ORVLQJ'DWHIRU$SSOLFDWLRQVLV0RQGD\$XJXVW

    WK

    /(602))$7,1&&ODVV'ULYHUZDQWHG+DXOLQJ

    *UDLQRIZRUNZLWKLQ

    0DQLWRED&RPSHWLWLYHZDJHV

    )D[UHVXPHWR

    RU3KRQH/HVDW

    7KH0RXQWDLQ*ULOO5HVWDXUDQWDWWKH(ONKRUQ5HVRUWLV

    QRZKLULQJIRU

    )$//:,17(56(59,1*326,7,216

    6WDII$FFRPPRGDWLRQVDUHDYDLODEOH

    3OHDVHVHQGUHVXPHWR6WHSKDQLH3LFDUG

    VWHSKDQLH#HONKRUQUHVRUWPEFD

    EQUAL TRANSPORTEdson, Alberta

    CLASS 1 DRIVERSNEEDED

    $35 PER HOUR(w/experience)

    H2S CERTIFIED,OFF ROAD

    EXPERIENCEREQUIRED,

    FLUIDS HAULINGEXPERIENCEPREFERRED

    COMPANY PAIDBENEFITS & BONUSES

    SEND RESUME &DRIVERS ABSTRACTIN CONFIDENCE TO:

    EMAIL: EDSON@

    EQUALTRANSPORT.CA

    FAX: (780) 728-0068

    (22-2)

    Town of Minnedosa

    The Town o Minnedosa is accepting tenders or:

    RFQ 2013-07 2nd St NW Water & Sewer

    General information

    The supply and installation o approx 84m o 150mm water line and

    150mm sewer line along 2nd St NW.

    To include:

    150mm C900 pipe

    150mm SDR35 sewer pipe

    One manhole structure

    One Mueller fre hydrant and associated par ts

    Supply o backfll material and removal o excess waste material

    Final landscaping, top soil and grass sowing

    Any required road repairs associated with the works.

    Any enquiry concerning the content o this Request or Quotation

    should be directed to Kevin Marcino at 204- 867-0037 or

    [email protected].

    Sealed Tenders marked 2nd St NW WATER & SEWER will be

    accepted at the Town o Minnedosas Civic Centre, 103 Main Street

    South, Box 426 Minnedosa, MB R0J 1E0 until 4:30 p.m. on Friday August

    23, 2013. Fax: (204) 867-2686 Email: [email protected]

    Any or all of the quotations may not be necessarily accepted.

    TENDER

    HELP WANTED

  • 7/27/2019 August9 2013.pdf

    13/16

    13Friday, August 9, 2013The Minnedosa Tribune

    IN MEMORIAM

    In loving memory oour dear niece and cousin,Jacqueline Kaye Lawson

    who passed away onA 12, 2009.

    Loving memories never die

    As years roll onand days pass by

    In our hearts yourmemory is kept

    Of one we lovedAnd will never forget.

    Kim, Brenda, Jennier,Natasha and Eric Moran

    (x)

    J 16, 1985

    A 12, 2009

    In Memory oour daughter and a sister,

    Jacqueline Lawsonwho will never be orgotten.

    As time goes on,We try to take your memory

    with us in everything we do.No one knows our heartache,

    Only those who havelost can tell

    Of the grief we bear in silenceFor the one we loved so well.

    You are someone specialWho we love and

    miss beyond words.

    Lovingly,Dad, Mom and Jef Lawson.

    (x)

    In loving memory oJacqueline Kaye Lawson.

    Four years have gone by butmemories never die.

    Your smile, your enthusiasm,your willing ways.

    Tese memories will never beforgotten,

    You will be in our heartsforever.

    Missing you alwaysGramma Johnson

    (x)

    PastershankJanuary , - Tuesday,

    July th, It is with great sadness thatour amily announce thepassing o eenie Pastershankon uesday, July 9th, 2013 atthe Sandy Lake Personal CareHome at the age o 98.

    eenie was born in theHarrison area on January 26,

    1915. She attended schooling atthe Martin Dale School. eenie

    married Frank Pastershank inOlha, MB on June 14, 1932.

    Tey armed at Wisla , Manitoba until1937, then moved to Elphinstone. Frank and eenie moved toMinnedosa in 1971 when they retired rom arming.

    eenie was devoted to her husband, amily and riends. Shepicked many pails o wild ruit or her amily over the years.

    Also was a very avid gardener and provided many jars o ruit,vegetables and pickles.

    For many years she enjoyed playing Bingo and cards withamily and riends.

    eenie was predeceased by her late husband Frank o 58 years;inant son Larry; her parents Joseph and Mary Kristalovich, as

    well as her nine siblings, three sister-in-laws and three brother-in-laws.

    eenie is survived by her son, Edward (Sylvia) Pastershank;daughters, Helen (Ed) Antonsen, Mabel (Nick) Stebeleski; vegrandchildren; nine great grandchildren and our great-greatgrandchildren. She is also survived by sisters, Lavinia, Regina,and brothers, Nick, Joe and numerous nieces and nephews.

    Te uneral service was held Saturday, July 13, 2013 at theSandy Lake Holy Ghost Ukrainian Catholic Church with Fr.Emil Kardasinec o ciating. Interment ollowed at the CatholicCemetery. I riends so desire, donations may be made to theSandy Lake Personal Care Home tub und.

    Raes Funeral Service o Shoal Lake was in care o

    arrangements.Vichnaya Pomyat!

    Harold Ernest ProvenJanuary , - July ,

    Tere was peace in the Little Saskatchewan River Valley, as thesun rose July 16, 2013 when Harold Ernest Proven died. He wassurrounded by his amily, in the place he loved best!

    Harold was born January 15, 1926 in the FairmountDistrict. So began the lie o a man who touched thelives o so many people. He was the youngest o six childrenborn to Fred and Hazel Proven. Harold was only our monthsold when his ather died, leaving his mother, Hazel to raise Stan,Elmor, Helen, Margaret, Jim and Harold. Harold was the last o his

    generation.Harold is survived by his loving wie o 65 years, Isabella; ve sons,

    Garry (Debra), David, Randall, Richard (Amy) and Douglas (Cindy);ten grandchildren, Kerry (im), Bronwyn, Danika, imothy, Gena,

    Evan, Ayma, Donald (Roselle), Michael and Jonathon; six greatgrandchildren, Ashley, Victoria, Kyla, Brooklyn, aner and Mason; and many nieces, nephews andcousins.

    He received his education at Basswood. Harold took his army basic training then returned toBasswood to begin work with a local carpenter, om Hymers. So began his love o woodworking. Hereceived his certicate in Cabinet Making at the Manitoba echnical Institute and then worked withMusselwhite Woodworking in Minnedosa.

    Harold was a nishing carpenter at Rivers Base or two years. In 1950 Harold and Isabella relocatedto Melita, where Harold established his own Cabinet Making Shop. In 1954 they moved to Calgary,

    where Harold obtained his Journeyman Carpenter certication.In 1960 Harold and Isabella moved their amily back to Basswood becoming the third generation

    o Provens on NE 3-16-19. Harold began arming and continued to build homes and do cabinetry.He was a trustee o the Basswood School Board and a Councillor with Harrison Municipality and

    Minnedosa Hospital Board or six years. He served on the Basswood United Church Board and wasvery involved in the Onanole Seniors Centre.

    Harold was a charter member o Local 516 o the National Farmers Union, serving as local Vice-President, District 6 Director and was elected to the National Board and National Executive asRegion Five Coordinator or our years.

    Harold was an activist, advocate or peace, social justice and human rights. Lielong involvementsincluded Project Ploughshares, Marquis Project, ools or Peace, Eco-justice and the Council oCanadians.

    His travels took him to China, Cuba and across Canada rom Ottawa to Vancouver Island.Harold was the recipient o several awards, which included the Global Citizenship Award and

    the National Farmers Union Grassroots Leadership Citation or loyal service to the arm union

    movement.Harold and Isabella retired to Onanole in 1990 to the home that Harold and his sons built. His

    double garage became his workshop. Tere he spent many happy hours making diamond willowcanes, stools, tables and numerous items rom a variety o wood in his shop. Clocks and picturerames were crated rom wood recycled rom the old barn at the arm. His generosity ound manyo these items given as gits with the signature H.E.P.

    A celebration o Harolds lie took place July 27, 2013 at the home o son, David.I desired, donations may be made in Harolds name to the Canadian Diabetes Association, 200-

    310 Broadway, Winnipeg, MB. R3C 0S6 or to a charity o your choice.Love Is Forever.

    OBITUARIES

    Bob Harrington

    A 2, 1994

    Sunshine fades andShadows fall

    But sweet remembranceOutlasts all

    Sadly missed by Diane, Jill,Karen and Family.

    Irene Marie DaggSeptember , - July ,

    With heavy hearts, the amily o Irene Marie Dagg announceher sudden passing July 24, 2013. Irene was born September26, 1929 at Mossbank Saskatchewan to Casper and MattieJohnson, and was the youngest o our children. Irene movedto Manitoba in 1945 to nish her education and attend normalschool. Upon completing normal school Irene had severalteaching positions.

    In 1951, while teaching at Crocus school Irene met DonaldDagg. Te two were married in Clanwilliam on July 17, 1954.

    Irene and Donald lived briey in Clanwilliam beore settlingon the Dagg amily arm south o town. March 28, 1958 Ireneand Don welcomed their rst child Murray, who was soonollowed by a daughter Janice on June 1, 1959. Irene loved the

    arm lie and enjoyed the years they spent there. In the early1990s Don and Irene moved back into Clanwilliam, this is

    where Irene spent the remainder o her years.Irene had many interests including baking, bird watching,

    doing crossword puzzles and gardening. She was active in theEmanuel Lutheran Church in Clanwilliam until its closing andollowing that continued to devote time daily to Bible study.

    Irene was predeceased by her sister Clara, Brother Oscar,brothers in law Bud and Gordon, and sister-in-law Evelyn. Letto mourn her is her husband o 59 years Donald, son Murrayand daughter Janice (Brian), grandchildren Brent (Candice),Christina (Cam), Jonathon (Destiny), Jefery (Joanne), Charles(Lyndie), great grandchildren Kira, Elizabeth, Emilie, Rhiannon,Elise, Stella, Kae-Lynn, and Evangeline, sister Myrtle, NephewEugene, and nieces Irene, Lynn, and Lois, as well as manyextended amily and riends.

    Funeral services were held July 27, 2013, with Elgin Hallo ciating. Interment ollowed at St. Johns Cemetery.

    Pallbearers were Brent Little, Cam Woodcock, Jon Dagg, JefDagg, Charlie Dagg and Andrew Richards. Minnedosa FuneralServices in care o arrangements.

    Memorial donations may be made to the Heart and StrokeFoundation.

    Charles IrvineSunday, July ,

    Charles Irvine o Brandon, beloved husband o the late Florence

    Irvine, and dear ather o Maxine Harvey and Blair Shaggy Irvine,

    passed away peaceully at his residence, Fairview Home, on

    Sunday, July 7, 2013 at the age o 93 years.

    Charlie attended remaine School. In 1941, he enlisted in the

    Royal Canadian Army Corps. Ater training at Red Deer, Alberta,he went overseas in March 1942. Charlie was sent to Sicily in July

    1943 and also saw service in Italy, Holland and Germany, returning

    home August 14, 1945. Charlie had many stories to tell during his

    time overseas or World War II. During this time, he also met all his

    Scottish relatives and spent quality time with all the aunties.He married Florence Jessie Chambers in Rapid City, MB on

    July 2, 1960 and lived in Rapid City on the arm until retiring intoMinnedosa. Charlie had ond memories growing up in the valley. He laughed

    at his stories o his childhood with his three sisters. One o the stories involved sledding down thebig hill behind the barn. He skated on and swam in the river nearby with the Christie and Andrewboys. Charlie enjoyed hunting with riends and brother-in-law, Bill Gibbons. He also enjoyedshing with riends and brother-in-law, Roy Attridge. Charlie was active in the Rapid City Legionand remaine Community Club. He attended many district card games and dances and Christmasconcerts. Charlie coached hockey with another Dad when Blair was playing hockey. Charlie armedor years, worked at International in Brandon and worked at Morris in Minnedosa. He relaxed by

    watching the birds, watching sports on television and reading the newspaper. Charlie loved peopleand visiting with everyone. He was well known or his jokes and teasing. Charlie was very ond o

    his grandchildren and spent many weekends at the Minnedosa beach watching them swim andplay. He became a great grandparent in 2009 and 2013.

    Charlie will live on in the hearts o son, Blair (Shaggy) and daughter, Maxine, grandchildrenChris, Becky, great grandchildren Mason and Charlee, sister Jessie Gibbons, cousins, nieces andnephews and riends. We are grateul or the happiness he brought to our lives. Predeceased byparents Charles and Isabella Irvine, wie Florence, sisters Isabella and Lily, son-in-law Gord.

    Te celebration o Charlies lie was held at Rapid City United Church, Rapid City, MB onTursday, July 11, 2013. Should riends so desire, donations are welcomed to Cancer Care ManitobaFoundation, 1160 675 McDermot Avenue, Winnipeg, MB R3E 0V9 or https://www.cancercaredn.mb.ca

    Charlie, you will be remembered.Messages o condolence may be placed atwww.brockiedonovan.com. Arrangements were in

    care o Brockie Donovan Funeral & Cremation Services, Brandon.

  • 7/27/2019 August9 2013.pdf

    14/16

    M & MAUTO BODY

    All Auto Body Repairs

    Ph: 867-20835 Main St.North

    Friday, August 9, 2013 The Minnedosa Tribune

    ACCOUNTING

    Income Tax Filing Farm and Business Accounting Payrolls Government form filing

    Phone 867-5550Fax 867-5808

    116 Main St. S.

    Minnedosa, MB R0J 1E0

    Tax Ser v i c e& A c co u n t i n g

    Parish BackhoeServices

    Septic Systems Weeping tiles

    Water Sysyems Basements

    All types of excavation

    Certifed in waste

    water management

    Call: Ian874-2134 or 867-0383

    BIRBIRCHCHCONSTRUCTION

    CommercialResidential

    GENERAL

    CONTRACTORS

    LTD.

    867-0400

    0r

    867-7506

    PRAIRIE CONCRETEMinnedosa - 867-3853

    Ready Mix ConcreteConcrete orms, Rebar, Wire Mesh,

    Weeping Tile, Concrete Sealer, Snap Ties

    All at Competitive

    prices

    Specializing in water & sewerinstallation & repair

    All types of excavation Basements, Demolition Snow removal Gravel, Topsoil Sales of septic tanks

    Tony 867-7582

    Kirk 867-0180

    Clint Moffat

    & Sons Ltd.OFFICE

    867-3356

    Sand & Gravel Products

    Excavating

    Water & Sewer

    Installations

    Site Preparation

    Landscaping

    Snow Removal

    ALLARD

    YAKUBCHAK

    WIRCHCERTIFIED GENERAL

    ACCOUNTANTS

    George Allard, C.G.A.*

    Gateway Street

    Onanole, Mb

    848-7413

    Howard Wirch, C.G.A*

    9-515 4th Ave

    Shoal Lake, MB

    759-2680

    Dauphin Office - 15 1st Ave S.W.

    Phone: 638-3005

    Fax: 638-5817*Denotes Professional Corporation

    CONSTRUCTION ELECTRICAL

    BURTON

    Enterprises Ltd.

    Air Conditioning,Heating & Electrical

    30 Years

    Ex perience!!

    Bus : 867-3950

    Fax:

    867-2340

    Refridgeration

    70 Main St, S.Minnedosa, MB.

    Personal Tax Returns

    Farm Returns

    Business Returns

    Cash Back

    Phone: 867-5124

    14

    EAVESTROUGH

    $1'FRQWLQXRXVSUHQLVKHGHDYHVWURXJK

    6LGLQJ5RRQJ6RIW)DVFLD&ORVHGFHOO

    3RO\XUHWKDQH6SUD\IRDP%ORZLQ$WWLF:DOO

    )LEUH,QVXODWLRQ)LUH5HWDUGHQW&RDWLQJ

    PFUHDO#OLYHFD

    AUTO CONSTRUCTION

    B

    BA SSWO OD

    A SS

    WOOD

    A

    A UTO

    UTO B

    BODY

    ODY

    A ND

    A ND G

    G LA SS

    LA SS

    WILD LIFE COLLISION EXPERTS

    WEST ST., BASSWOODPHONE: 874-2270

    E-GLASS REPLACEMENT

    & REPAIRS

    Catharine M Gijsbers.Certified General Accountant.Professional Corporation - 213 2NDStreet NEBox 385, Minnedosa MB R0J 1E0

    x Personal & Corporate Income Taxx Accounting and payroll servicesx AgExpert Analyst Certified Advisorx V.I.P. InstallerGroup trainerTel: 867-3884 Cell: 867-0190Email: [email protected]

    AC

    FINANCE

    Minnedosa

    Credit

    UnionMain line867-6350

    Joanne Clarke867-6364

    Susan Glasgow867-6353

    Alayna McTavish867-6354

    Debbie Strelczik867-6359

    Lori McNabb867-6360

    Harvey Wedgewood867-6363

    Carol Dalrymple867-6367

    Carol Taylor867-6368

    Kim Robinson867-6352

    Jeff Dusessoy

    867-6369Sylvia Firby867-6361

    Candice Brown867-6362Brad Ross867-6366

    Fax867-6391

    MCU MCU

    BookThisSpotforonly$13.74per

    week!

    Gwen UsickAlternate Broker

    Ph: 867-4657Fax: 867-2150

    [email protected]

    PRAIRIEMOUNTAINIndependently Owned

    and Operated

    6KRDO/DNH%GP%DWK

    EXQJDORZRQFRUQHUORW0RGHUQNLWFKHQQXPHURXVUHFHQW

    XSJUDGHVLQFOXGLQJLQVXODWLRQVLGLQJIDVLDVRIWHDYHVVKLQJOHV[GHFNPXFKPRUH0/6

    6WUDWKFODLU,PPDFXODWH%GP%DWKRSHQFRQFHSWPRELOHKRPHRQDODUJHORWRDNFDELQHWVFDWKHGUDOFHLOLQJ[GHFNVKHGJUHHQKRXVHHWF0/6

    0LQQHGRVD6WRQHKHULWDJHEGPEDWKKRPHIHDWXUHV

    RULJLQDOGHWDLOHGKDUGZRRGXQLTXH[WXUHVLQVXODWHGEDVHPHQWLVVROG

    ZLWKWRZQORWV7KHUHLVDVLQJOHJDUDJH

    GRXEOHLQVXODWHGJDUDJHZLWKLQRRUKHDWHLQIRUFHGFHLOLQJVKHGVFLUFXODU

    GULYHZD\0/6

    Take a tour on realtor.ca or our websitewww.remax-prairie mountain-npwa.mb.com

    (ULFNVRQ+REE\)DUPRQDFUHV

    UHFHQWO\UHQRVTIWVWRUH\FKDUDFWHU%GP

    %DWKKRPHUHSODFHVQXPHURXVRXWEXLOGLQJVD

    %GPJXHVWKRXVHYHJHWDEOHJDUGHQDQGPXFKPRUH0/6

    0LQQHGRVD4XDOLW\%GP%XQJDORZZLWK

    DWWDFKHG26VLQJOHFDUJDUDJH*'2RQDGHHSORWFORVHWRGRZQWRZQ0DLQEDWKODXQGU\+(JDVIXUQDFHFHQWUDODLUSDWLRYHJHWDEOHJDUGHQ$UHDOJHP0/6

    50RI2GDQDKVTIWKRPHZLWKPXQLFLSDOZDWHU

    EGPEDWKWULSOHFDUJDUDJHQHZHUZLQGRZV7KHUHDUHIHQFHGSDVWXUHV[VKHGEDUQVKD\ODQGJURRPHGZDONLQJSDWK

    YHJHWDEOHIUXLWJDUGHQVDOOORFDWHGRQ

    DFUHV0/6

    1(:

    /,67,1

    *

    Rick Taylor 867-7551

    [email protected]

    /RW0LQQHGRVD%HDFK&RWWDJHDW0LQQHGRVD/DNHZLWKQLFHYLHZV7KLVEHGURRPSLHFHEDWKFRPHVIXOO\IXUQLVKHGDWDQDIIRUGDEOHSULFH6FUHHQHGGHFNRYHUORRNVWKHYDOOH\DQGODNH&RWWDJHLVZLQWHUL]HG

    DQGKDV$&DQGFDEOH79

    WK6W1(8QLTXHEHGURRPEDWKIDPLO\KRPHLQGHVLUDEOHODNHDUHD*UHDWSDWLRDQGGHFNZLWKKRWWXERXWGRRUUHSODFHDQGEHDXWLIXO[LQJURXQGSRRO9HU\ZHOOPDLQWDLQHGKRPHVLWVRQORWDQGIHDWXUHVVN\OLWPDLQEDWKZLWKSRXUHGPDUEOHVXUURXQGDQGVRDNHUWXE)LQLVKHGEDVHPHQWKDVDIDPLO\URRP

    ODUJHEHGURRPSLHFHEDWKPHGLDURRPXWLOLW\VWRUDJHDQGIRRWFHLOLQJV

    VW6W1:

    ELOHYHOKRPHIHDWXUHVEHGURRPVIXOOEDWKVQLVKHGEDVHPHQWFHQWUDODLUDQGDLUH[FKDQJH+DUGZRRGWLOHQHZFDUSHWQHZGRRUVDQGGHFNZLWKJODVVUDLOLQJ'RXEOHGHWDFKHGJDUDJH

    ZLWKQHZVKLQJOHV

    QG6W1:

    7KLVVTXDUHIRRWEHGURRPKRPHLVYHU\WLG\DQGZHOO

    PDLQWDLQHG+RPHIHDWXUHVODUJHEHGURRPVPDLQRRUXWLOLW\URRPDQGFHQWUDODLUFRQGLWLRQLQJ1HZVKLQJOHVPRVWO\QHZHUZLQGRZV

    $SSOLDQFHVLQFOXGHG

    VW6W1(0LQQHGRVD7KLVVTIWEXQJDORZKRPHLVORFDWHGLQDJUHDWDUHDDQGIHDWXUHVDIDPLO\URRPRIIWKHNLWFKHQODUJH

    GLQLQJURRPDQGEDVHPHQWUHFURRP0DLQRRUEDWKZLWKMHWWHGWXEDQGSLHFHEDVHPHQWEDWK)RUFHGDLUJDVIXUQDFHFHQWUDODLUDQGZDWHUVRIWHQHU

    'RXEOHGHWDFKHGJDUDJH

    WK$YH6:9HU\VROLGVTIWEHGURRPEXQJDORZZLWKDIHQFHG\DUGDQG

    WRZQYLHZ8SGDWHGZLQGRZVVLGLQJLQVXODWLRQQHZVKLQJOHVIHQFHDQGQHZODPLQDWHRRULQJ/RFDWHGRQDTXLHWVWUHHWFORVHWRVFKRRODQGGRZQWRZQ

    /LYLQJLQ\RXU

    &RPPXQLW\

    VW$YH1:

    *UHDWVWDUWHUKRPHQHDUVFKRRO6KLQJOHVVLGLQJDQGDOOZLQGRZVXSGDWHGVLQFH0DLQRRU

    EHGURRPDQGEHGURRPVXSSHURRU/DUJHEULJKWNLWFKHQDQGODUJHOLYLQJ

    URRPZLWKKDUGZRRGRRU%LJIHQFHG\DUG

    1(:/,67,1*

    6WUDWKFODLU6SDFLRXVEHGURRPKRPHRQODUJHORWLQ6WUDWKFODLU/DUJHHQWUDQFHOHDGVWRWKH

    VSUDZOLQJHDWLQNLWFKHQZLWKDQDEXQGDQFHRIRDNFDELQHWV7KHGLQLQJURRPDQGVXQNHQOLYLQJURRPDUHYHU\

    QLFHZLWKORYHO\ZRRGZRUNDQGKDUGZRRGRRULQJ7KHQLVKHG

    EDVHPHQWKDVDVHFRQGNLWFKHQDQGFRXOGVHUYHDVDPRWKHULQODZVXLWH7KLVKRPHLVLQH[FHOOHQWFRQGLWLRQDQGKDVEHHQ

    QLFHO\XSGDWHGWKURXJKRXW

    '0LQQHGRVD%HDFK7KLVFR]\FRWWDJHDW0LQQHGRVD/DNHLVDUHDOFKDUPHU.LWFKHQVXQNHQOLYLQJ

    URRPEHGURRPVDQGDSLHFHEDWKURRPDOODGGWRWKHOLYHDELOLW\7KHGHFNRYHUORRNVDVPDOO\DUGZLWKDUHSLW6XPPHUVDWWKHODNHFDQEH

    DIIRUGDEOH

    1(:/,67,1*

    RECYCLING

    aluminum brass zinc steel

    e-waste lead

    catalytic converters stainless steel

    batteries copper

    www.urbanmine.ca

    204.774.0192

    72 Rothwell RoadWinnipeg, MB

    (1 block south of IKEA)

    The trusted name inmetal recycling

    We Do It All!Social Tickets, Raffle Tickets, Business

    Cards, Receipt Books, Flyers, Posters,

    Colour Copying

    867-3816

    Tribune Printing

  • 7/27/2019 August9 2013.pdf

    15/16

    RESTAURANT

    PRINTING

    More than just a

    Newspaper!

    We offer a full line of

    Custom Printing.

    Posters, Brochures, Invoices,

    Envelopes, Business Cards,

    Letterhead, Tickets, Invitations

    and MORE! We also provide

    Colour Photocopying, Photo

    Reproductions and Faxing.

    Visit us at:

    14 3rd Avenue S.W.

    Minnedosa, MB

    Monday - Friday

    9 a.m. to 12 noon &

    1 p.m. to 4 p.m.

    Phone 867-3816

    LEGAL

    Alexander

    Jackson

    Law Office

    B-116 Main St S

    Minnedosa, MB

    867-39

    81htt

    p

    :

    //

    www.

    aj

    a

    xl

    aw.c

    a

    SIMS & COMPANYLaw Ofce

    Norman H. Sims, Q.C.

    76 Main Street South

    MINNEDOSA t 867-2717

    HANDYMAN

    REAL ESTATE

    Burgess Law

    Office

    51 Main Street S

    Minnedosa

    867-2935

    [email protected]

    INSURANCE

    Drivers Licenses, AutopacGeneral Insurance

    Bruce McNabb & Dave McDonald

    867-3946

    MINNEDOSA

    INSURANCE SERVICES

    WAHOSKIMECHANICAL LTD.

    PLUMBING

    HEATING

    GAS FITTING

    AIR CONDITIONING

    204-867-3121or

    204-476-5185

    GORD KELLYPlumbing & Heating

    Gas Fitting

    ph: 867-2084

    cell: 867-0346

    SERVICES

    T A C

    Ventures Inc.

    WasteManagement &

    Contracting(204)476-0002

    Garbage RemovalBin Rentals

    Construction DemolitionRenovating

    Household clean upEstate clean ups

    The Minnedosa Tribune Friday, August 9, 2013 15

    PAINTING

    #6350/1"*/5*/(

    .YRNA$HARLES)OME$ELL

    ALCOHOLICSANONYMOUS

    If you like to drink and canThat's your business

    If you want to stop and can'tThat's our business.

    P.O. Box 36or 867-3966

    Alanon - 867-3308Alateen - 867-5121

    867-3401 MinnedosaMtg. Times: 8:00 pm Tuesdays

    MoodDisorders

    Associationof Manitoba

    Support GroupMeetings held at

    Minnedosa Hospital Boardroomevery 2nd Tuesday of the monthat 6:30 p.m. For more info call:

    Lora Hay 826-2773Connie Finlay 867-2556

    L

    L E

    EO

    O N

    N A

    A

    S

    SS

    S T

    T U

    U D

    D I

    I O

    O O

    O F

    F I

    I M

    M A

    A G

    G E

    E

    Family Hair Care

    Family Hair Care

    Wax

    ingWax

    ing Pedicures

    PedicuresManicures

    Manicures LCN Nails

    LCN Nails

    Pedique

    Pedique Tanning

    Tanning

    Massage

    Massage

    867-2287

    867-228767 Ma

    in St.67 Ma

    in St.

    St. Alphonsus

    Catholic Church142 4th St, NW.

    Minnedosa, MB 867-3831

    Mass Sunday 9:00 a.m.

    142 4th St, NW.

    Minnedosa, MB 8673831TRADING

    FRONTIERTRADING STORE867-5551

    Gently Used Furniture

    Clothing & Misc. Items

    Donations

    Estate Sales

    Pick-up & Deliveries

    SERVICES

    SELF-HELP

    Drug Problem?Narcotics

    Anonymous can help

    Meetings every

    Tuesday &

    Saturday at 7 p.m.at Calvary Temple,

    221 Hamilton Street,

    Neepawa, MB

    LakesideSeptic Service

    Potable waterdelivery.

    Book your portabletoilets.

    Small tool rentals.Bryon Gaiser

    867-2416Cell: 867-7558

    CALL ME... FOR ALL YOUR

    REAL ESTATE NEEDS

    www.suttonharrison.com

    PETER HARRISONPhone/Text 867-5444

    JOHNSTONYARD CARE SERVICES

    Lawn Mowing & Trimming

    Yard Clean Up Aerating & Power Raking

    Garden Tilling

    Eavestrough Cleaning

    Hedge Trimming

    Small Branch Trimming

    Window Washing

    Other Odd Jobs

    Cory Johnston Minnedosa

    (204) 476-4705

    www.johnstonyardcare.com

    RAINKE'SSewage Service

    JIM BEAUMONT476-2483

    Owner/OperatorCell: 476-6591

    Dennis: 476-2766

    23 Hour Service

    RANKIES

    People Helping People

    - Committed to Caring -

    Phone (204) 857-6100

    Fax (204) [email protected]

    www.centralplainscancercare.com

    SEPTIC

    PLUMBING

    MLA

    LEANNE ROWAT, M.L.A.

    Minnedosa

    114 Main St. S.

    Ofce Hours

    Constituency

    Ph: (204) 867-2297

    Fax: (204) 867-3641

    Winnipeg

    Ph: (204) 945-0258

    Fax: (204) 945-5921

    Mon. - Fri.9:00 - 5:00

    Riding Mountain Constituency

    Written Quotes InsuredPremium Finishes

    Book you winter jobs NOW!

    Working Area:From Brandon to Clear Lake

    Residential, Farm, Commercial Interior/ExteriorPowerWashing& Spray PaintingAvailable References Available

    Need it Painted?Call T.H.E.M.!

    Cell 204-868-8 088 Email: [email protected]

    Cell 204-868-8 088 Email: [email protected]

    !

    GRAINHAULING

    Ford FarmsCustom Grain Hauling

    Call Mark at

    204-867-0120

    Book this spot$5.52/week

    Call 204-867 3816

    BookThisSpotforonly$13.74per

    week!CREI

    GHTON

    S

    Handyman ServiceInterior/Exterior

    RenovationsCabinets, Countertops

    All FlooringDrywall and Taping

    Ceramic TileDecks, Fences, Garages

    and More!

    204-868-0382 BookThisSpotforonly$11.07per

    week!

    Essential ChoiceBody Balance

    Registered Massage Therapy

    Reiki Master/Teacher

    Indian Head Massage

    Pranic Healing & BodyTalk

    2048673983

    694 - 3 St. NE Minnedosa

    DarwinMatthewsTV ANDAPPLIANCESALESAND SERVICE

    Your Shaw Direct,LG, Samsung, Bell

    Danby DealerComputer Sales and Service

    Systems, Monitors &Accessories

    Minnedosa, MB

    Phone 867-3164

    E-mail: [email protected]

    Dari Isle

    204-867-3601

    Call for pick-upor dine in.

    HomemadeBurgers!

    Soft Ice Cream!

    SALES

    Fences, Decks,

    Shingles & More

    Pierre Sr. 2048680266

    FULLY INSURED

    SELF-HELP

    Brian HornerGrain & Fertilizer

    Hauling

    204-867-7182

    BookThisSpot

    foronly$13.74per

    week!

    Book this spot$5.52/week

    Call 204-867 3816

  • 7/27/2019 August9 2013.pdf

    16/16

    16 Te Minnedosa ribuneFriday, August 9, 2013

    2012 FORD F-150 XLT Super Cab 4x45.0L V8 Sweet!......$26,750

    2013 Ford Escape SE AWDLeather and NAV.......$29,950

    2012 Ford Taurus Limited AWDWOW! The Ultimate!....$27,995

    2012Chevrolet Malibu LTA Treat to Drive.......$18,750

    www.wilsonswheels.ca

    204-867-2699

    WK$YHQXH6:

    0LQQHGRVD

    &DOO3HWHU+DUULVRQ

    13082aa00

    Enrol today for full or part time in

    the day, evening or by distance.

    Classes begin September 2013

    Mature Student High School204.725.8735

    IS IT TIME TO

    ?

    AUCTIONS

    2 Day Estate Museum AuctionAug 17 & 18 Strathclair, MBHorse & Buggy Items, 7 Vin-tage Autos, Red Indian ins, 84

    Years o collecting www.mey-ersauctions.com 204-476-6262.

    AUTOMOTIVE

    Guaranteed approval driveaway today! We lend money toeveryone. Fast approvals, bestinterest rates. Over 500 vehiclessale priced or immediate de-livery OAC. 1-877-796-0514.

    www .y our app rov edo nl in e.com.

    FINANCIAL SERVICES

    MoneyProvider.com. $500Loan and +. No Credit Re-used. Fast, Easy, 100% Se-cure. 1-877-776-1660.

    FOR SALE

    A LAS! An iron flter thatworks. IronEater! Fully pat-ented Canada/U.S.A. Re-moves iron, hardness, smell,manganese. Since 1957. Visitour 29 innovative inventions:

    www .b ig ir on dr il li ng .c om .Phone 1-800-BIG-IRON.

    BAERIES FOR EVERY-

    HING Automotive, arm,construction, AV, marine,cycle, gol carts, solar. Phones,tools, radios, computers, etc.Reconditioned, obsolete, andhard-to-fnd batteries. SOLARpanels, inverters, and acces-sories. Te Battery Man Wpg.1-877-775-8271 www.battery-man.ca

    Restless Leg Syndrome & LegCramps? Fast Relie In OneHour. Sleep At Night. ProvenFor Over 32 Years. www.all-calm.com Mon-Fri 8-4 ES1-800-765-8660

    SAVE! NEW! WRAPPED! NewBed Line - Queen Pillow-op Bed Set $395! (King set

    $595.00) (6-piece BedroomSuite including Pillow-opBed set $900). 12 DrawerQueen Storage Bed $495! 5piece 42 round drop lea set$459. SOLID RUSIC OAK a-ble Set 60 to 96 (No Veneer)6-high back padded chairs$2,295 ($4,200 value)! Leather3-Piece Set! Soa, Love Seat &Chair. Sacrifce $1,495, Store

    Value $3,100. (Can Separate)Call: 204-571-1971. Brandon.

    MANUFACTURED HOMES

    HOMES, COAGES & More.RMI - Ready to Move in. Call

    1-888-733-1411; rtmihomes.com. Red ag Sale on now!

    MOBILE HOMES

    FAMILY WANED! New 2012SRI home 1672 sq.t. 3 bed-rooms, 2 baths, SS appliances& more. Can be re-located.$145,000. Glendale MobileHome Sales 204-724-7907

    New 2013 SRI mobile homemodels AVS-20631 and AV-667 are now onsite or view-ing. Custom order your newhome now or all delivery.Glendale Mobile Home Sales,Brandon 204-724-7907

    REAL ESTATE

    Real Estate: Shoal Lake, MB.Last our exclusive gol courselots with all services at the ap-proach. Easy access to lake.Priced to sell $30,000. Phone204-365-7161.

    STEEL BUILDINGS

    SEEL BUILDINGS/MEALBUILDINGS 60% OFF! 20x28,30x40, 40x62, 45x90, 50x120,60x150, 80x100 sell or bal-ance owed! Call 1-800-457-2206 www.crownsteelbuild-ings.ca

    Te amily o eenie Paster-shank would like to expressour heartelt gratitude to thepeople who provided supportat this di cult time. Your actso kindness through cards, owers, phone calls, gits oood are greatly appreciated.Special thanks to Fr. EmilKardasinec or his beauti-ul service, the pall bearers,cross bearer, Ernie Malchukand choir, alter server PeterMiko. Also thanks to RobertEwanyshyn or his violin soloo Amazing Grace during theinterment. Te church ladiesor preparing and serving thedelicious lunch. Te peoplethat took such good care oMom at the Sandy Lake Per-sonal Care Home. Specialthank you to the palliativecare ladies that stayed withmom when we couldnt bethere, you were all awesome.Tanks to Raes Funeral Ser-

    vice or their kind and caringproessional services. Yourkindness will not be orgot-ten. ~ Edward, Sylvia, Helenand Ed, Mabel and Nick andfamilies. (x)

    We would like to expressour heartelt thanks to every-one or all the lovely owers,cards, ood, visits and phonecalls at this di cult time inthe loss o our mom. Tank

    you or your thoughtulnessand kindness, it is greatly ap-preciated and will always beremembered. God Bless all.~Nick and Mabel Stebeleski(x)

    Our grateul thanks to am-ily, neighbours and riends orall o the thoughtul expres-sions o sympathy shown usduring and ater the loss oour beloved patriarch Har-old. Tanks to Erickson HomeCare and Regional PalliativeCare who made it possible

    or amily to give our lovedone the care he needed.Tanks to Dr. Khandelwal orhis many years o proession-al care given Harold and toDr. Vipul and Mental Healthsta. T anks to all or themany words o comort that

    will not be orgotten. ~Isa-bella Proven and family .

    Te amily o Irene Daggwould like to thank the ol-lowing people or their kind-ness and support in the daysollowing her sudden pass-ing. Te sta at Minnedosahospital or the care o Ireneand our amily, and Natasha

    Pearen or the spiritual careimmediately ollowing Irenespassing. Minnedosa FuneralServices or the proessionaland sensitive care in makingarrangements. o the Clan-

    william ladies, thank you orthe wonderul lunch ollow-ing the uneral. o Elgin Hall,thank you or the support andbeautiul service to celebrateIrenes lie. o all who phonedor called in with ood and kind

    words, your care and compas-sion is appreciated and willnot be orgotten. ~Sincerely,Donald Dagg and the Dagg,Little and Woodcock fami-lies

    MCNA PROVINCE WIDE CLASSIFIEDS CARDS OF THANKS

    myCommunityNeighbours Indeed

    Be a Neighbour...And announce

    these special eventsto your community

    Birth of ChildWeddingWeddingAnniversaries

    25th, 40th, 50th, 60thNew home residency

    You may qualiy or apersonalized keepsakegit ofer complimentso local business andproessional sponsors

    Minnedosa PharmacyGlenndosa Glass 1990 Ltd.

    Minnedosa insurance ServicesBurgess Quality Foods

    Integra TireHeritage Co-op

    Minnedosa TribuneGateway Motel

    Be part of your Community!

    Contact Tillie Johnson204-867-3414