7/27/2019 August9 2013.pdf
1/16
Vol. 131 No. 22 Friday, August 9, 2013
www.minnedosatribune.com
90 cents + tax
We acknowledge the
financial support of the
Government of Canada
through the
Canada Periodical Fund
of the Department of
Canadian Heritage.
and hangin on!
Rockin out
Photo by Jennier Paige
Photo by Darryl Holyk
Teory of a Deadman headlined year ten of Rockin the Fields of Minnedosa.Pictured is lead singer, yler Connolly.
By DARRYL HOLYK
he Heartland Rodeoreturned to Minnedo-sa this August long week-end attracting competitorsand spectators rom near
and ar.Overall, things went
well, said Minnedosa Ro-
deo President, Greg Woy-chyshyn. Te stands were
ull and there were no realinjuries to speak o so thatsalways good.
Te one area that did
experience some strugglesthis year, was the quantityo ood available onsite or
competitors and specta-tors. With the canteen inthe display building not
open, the lone ood vendor
did its best to try to keep up
the demands o the hungrycrowd. T e rodeo com-mittee has already started
talking about options ornext year so that this issuedoes not arise again.
We hope to havesome new exciting ood
vendors or next year to
make sure we are wellstocked throughout the
weekend, said Greg.T e three-day rodeo
weekend kicked of Sat-urday morning with a
Manitoba Barrel RacingAssociation 3D barrel rac-ing event. Later that ater-
noon, the ags o rodeowere carried into the mainarena by riders on horse-
back to open day one o
the Heartland Rodeo. Te
national anthem was sungby six-year-old Echo Des-
jardins. Tis young cowgirl
also competed later in theshow in the Pee Wee BarrelRacing event.
Following the CowboyPrayer, hard hitting ro-deo action kicked of with
hometown cowboy, BenMarcino being the rst to
compete in the barebackevent. Other events in-cluded Saddle Bronc, ieDown Roping, Goat ying,
eam Roping, BreakawayRoping, Barrel Racing,Steer Wrestling, Steer Rid-
ing and Bull Riding.
Continuedon Page 9
Evan Billings takes a sideways fallfrom a bull named Red Skin.
By JENNIFER PAIGE
Every year during the August long weekend excite-ment and energy ll the streets o Minnedosa. Tispast weekend people came rom ar and wide to enjoy a
weekend ull o great music, good riends, and take in ev-
erything Minnedosa has to ofer.en years ago, Rockin the Fields was thought to
be a goner with only good memories o past estivals to
hold onto. But now, ten years later, a dedicated team oorganizers and loyal volunteers have lled the hills oMinnedosa with rock music once again.
Celebrating their 10th year o non-pro t co-oper-ative, Rockin the Fields 2013 saw a non-stop line up obands that d rew a wide range o attendees. Tis years an
avourites included Trooper, Te Trews, Starship featur-ingMickey Tomas, Monster Truck and estival headliner,
Teory of a Deadman .
Over the past several years, Rockin the Fields hasevolved, growing every year, including this year whichsaw attendance grow to just over 2,000 visits per day,
compared to 2004 when daily attendance was only 400.Organizers boast that the estival went as smooth as
ever with no arrests or charges during the three-day mu-
sic est. Te rst aid trailer was also uneventul only see-ing minor scrapes and the odd person who drank beyondtheir limit.
Continued on Page 8
7/27/2019 August9 2013.pdf
2/16
2 Te Minnedosa ribuneFriday, August 9, 2013
$XJXVW+DLUFXW6SHFLDO
:LWK$QLWDLadies Cuts $20.00Mens Cuts $15.00
All Hair Products 25%OFF!!!
Check out our Enjoy Being Active Clothing line!
204-867-253325 Main Street S.
Find us on Facebook
7KH0LQQHGRVD1XUVHV
ZRXOGOLNHWRWKDQNDOOWKDWVXSSRUWHG
RXU6SDJKHWWL6XSSHU
EXUVDU\IXQGUDLVHU
2XUHQWHUWDLQHUV
=DFN.RVFLHOQ\
(PPD-HDQ.RVFLHOQ\
.DWLH:R\FK\VK\Q
6WHYLH2Q\VKNR
$QGDQH[WUDVSHFLDOWKDQNVWR+HDWKHU%UD]HDX
IRUYROXQWHHULQJKHUVXSHUEFDWHULQJVHUYLFHV
:LWKRXW\RXDOOWKLVHYHQWZRXOGQRWEHSRVVLEOH
7KDQNV$JDLQ[
FREE ESTIMATES!Roofng, Sot, Fascia, Eavestrough
SATISFACTION GUARANTEED!!!
By JENNIFER PAIGE
With an extensive listo volunteer ac-tivities, committee boardmemberships and presi-dential positions, localresident, Robert Grahamhas been honoured with anational award or his lie-time o civic-minded con-tributions.
Te Diamond JubileeAward was created in hon-our o the 60th anniversa-ry o Her Majesty QueenElizabeth II and to pay
respects to her six decadeso service. Recipients othe award had to be nomi-nated by ellow commu-nity members to Memberso Parliament o the Legis-lative Assembly. Since thebeginning o 2012, 60,000deserving Canadians havebeen recognized or theiroutstanding achieve-ments that have positivelyimpacted our country,their province or theircommunity.
Bob was a good ftor the award and it is easyto see that he deservesit when you take a lookat his volunteer history,says Brock Alexander, whopenned one o the threenomination letters sent toparliament members. woother letters were writtenby Dave McDonald andBrian Bruce.
We sent in threenomination letters ex-plaining all o the timeBob spends in town, vol-unteering and being an
active, involved commu-nity member , says Mc-Donald. Tis is a very
well deserved award. Bobis always there to help,
just like with Rockin theFields, he has donated alot o time there and doesevery year. Whatever or
whenever you need help,he is there to help out.
Graham has lived inthe southwest corner oMinnedosa or 28 years.I have always been in-
volved in the communitybecause I love this town.It is a great place to liveand raise kids. When youspend some time volun-teering you get to knowpeople, learn about team-
work and get to know thecommunity you l ive in.
Graham has been avolunteer in town or aslong as he has been a resi-dent, a staple at Rockinthe Fields since its con-ception, president o theLittle River Game and Fish
Associatio n or 14 years,
previously a town councilmember, as well as partic-ipating in numerous com-mittees, and undraisingboards.
I like to see things
getting accomplished.One o my avourite proj-ects I have worked on
would probably have tobe the back nine at thegol course. I spent count-less numbers o hours anddays out there, says Gra-ham.Graham was present-
ed with the Diamond Ju-bilee Award on July 11th ata ceremony during the lo-cal mens gol night. I was
very overwhelmed whenI ound out I was nomi-nated and when I was
presented with the medal;there are lots o deserv-ing people that do a lot othings or this town andto be recognized means alot.
Graham honoured for Dedication to Community
Bob GrahamsCommunity Involvement:
Curling Club - previously a member and servedas president or two years. Golf Club - previously served as grounds chairor two years. Currently a member and served as
president or two years. Presently on the executivecommittee as a senior representative and assists
with several projects at the course. Little River Game and Fish Association- hasserved as president or 14 years. own of Minnedosa - during his our year termas councillor, Bob served our years as chairman othe economic development board. Rockin the Fields - volunteered every yearsince Classic Rock began in 1996. Little Saskatchewan River Conservation Dis-trict - currently serves as board member and hasheld the position or six years. Te Minnedosa Regional Events Centre -served or the past our years on the undraisingcommittee. Rotary Club - member or the past our years. Masonic Lodge - previous member. Hockey League - coached or two years.
Photo by Jennier Paige
Bob Graham was recently presented a Diamond
Jubilee Medal in recognition of his many years
of volunteering in the community.
SUBMITTED
his past weekend, theMinnedosa Maver-icks represented the Santa
Clara Baseball League atthe Senior AA Finals in Ha-miota.
Game #1 Baldur (3)Minnedosa (1). Mitch Hut-
ton had 1 hit and scored 1run.Game #7 Minnedosa
(8) Springf eld (2). Win-ning Pitcher Nick Krutke-
wich. John Lawrence had 3hits, 2 RBIs, Scored 1. Zac
Yandeau had 2 hits, 1 RBI,Scored twiceGame #11 Minnedo-
sa (7) Hartney (1). WinningPitcher John Hutton. An-drew Richards had 3 Hits,Scored once. Zac Yandeauhad 2 Hits, Scored twice.
Game #14 - Hamiota(4) Minnedosa (3). JohnHutton went 2 or 3. Zac
Yandeau doubled andscored once.
In the f nal game,Brandon deeated Hamio-
ta 8-3.
Senior AA provincial
baseball results
Ifyourlabelreads
13 /08 /31Itstimetorenew!
Call 867-3816
7/27/2019 August9 2013.pdf
3/16
3Te Minnedosa ribune Friday, August 9, 2013
/8&.
7/27/2019 August9 2013.pdf
4/16
4 Te Minnedosa ribuneFriday, August 9, 2013
Darryl A. Holyk - Publisher & Editor- [email protected]
Letterstothe
Editor
The Minnedosa Tribune Ltd.Box 930 Minnedosa, MB R0J 1E0
Published Friday o each week rom the premises oTe Minnedosa ribune Ltd. 14 - 3rd Ave. S.W.
Minnedosa, MB. R0J 1E0Member o Manitoba Community Newspapers Association
and Newspapers CanadaAudited twice a year by Canadian Media Circulation Audit
TRUSTED CONNECTED TARGETED
Phone: (204) 867-3816Fax: (204) 867-5171Cell: (204) 867 - 7000
Te Minnedosa ribune is independently owned and is theoldest weekly newspaper in the Canadian West and haspublished continuously rom the same premises sinceMarch o 1883. We acknowledge the fnancial support o theGovernment o Canada through the Canada Periodical Fund
(CPF) or our publishing activities.
E-Mail Addresses:
General: [email protected]/printing: [email protected]
Classifeds: [email protected]
www.minnedosatribune.com
T e Minnedosa ribune Ltd. does notguarantee the publication o all submitted articles andphotographs. Tese submissions, are at the discretion o thepublisher and will appear as space permits. Te Minnedosaribune reserves the right to edit any submission as deemednecessary by the publisher.
We are not responsible or ax transmissions or emailsubmissions that are not received. o guarantee that suchsubmissions have been received please confrm with a phonecall or in person.
All contents copyright 2013
Sometime in the late
evening hours o
August 9th or
the early morning
hours o Tuesday,
August 10th, 1993
vandals wreaked
havoc anddestruction at
Minnedosa Cemetery.
65 memorials were
damaged, broken
or smashed.
Minnedosa Crime
Stoppers and
Town Council
immediately ofered
a $1,000 reward to
solve this crime.
Dear Editor,
Canada has weatheredthe storm of the glob-al recession well, but as a
trading nation in the global
economy we are not im-mune to the problems that
countries around the globe
are facing today.
With its focus on job
creation, economic growth,
and long-term prosperity,
Economic Action Plan 2013
is good news for Dauphin-
Swan River-Marquette, and
all of Manitoba. The plan
continues to keep Canada on
track to return to balanced
budgets in 2015-16, and will
keep federal taxes at their
lowest level in 50 years.
Thefi
rst phase of Eco-nomic Action Plan 2013
calls for increased skills and
training support with the in-
troduction of the Canada Job
Grant. This grant will pro-
vide $5,000 when matched
by an employer to help
Manitobans gain access to
training at institutions, such
as community colleges and
trade schools, that will lead
to high-quality, well-paying
jobs.
Manitoba small busi-
nesses will benefit from
Economic Action Plan 2013
with the extension and ex-pansion of the hiring credit
for small businesses. The
hiring credit will save small
businesses across Canada
$225 million in 2013. An
additional $20 million will
be invested to help small
businesses access research
and business development
services at universities andcolleges.
For generations, our
famers have fed Canada and
the world, while providing
jobs and career opportuni-
ties to Canadians. Eco-
nomic Action Plan 2013 will
benefit part-time farmers by
doubling the current deduc-
tion limit under the restricted
farm loss income tax rules
from $8,750 to $17,500.
Further our Government
has increased and indexed
the Lifetime Capital Gains
Exemption from $750,000
to $800,000. Not only will
this ease the burden of plan-
ning for retirement, but it
will make it easier to trans-
fer a family farm, to the next
generation of entrepreneurs.
Further, all farmers and the
agriculture industry will
benefi t from the increase to
spending on competitive-
ness, trade development,
food safety, and environ-
mental programming under
Growing Forward II.
Economic Action
Plan 2013 strengthens our
Government`s commitmentto the improvement of Man-
itobas communities. The
Community Improvement
Fund will provide $32.2
billion, over the next ten
years, to help municipalities
receive stable and predict-
able funding in support of
local infrastructure projects.
The Building Canada Fund
will provide $1.25 billion,
over the next five years, to
support economic infra-
structure projects across
Canada that have a national
and regional significance.
Our Government under-
stands that investments in
Canada`s public infrastruc-
ture are crucial for job cre-
ation, economic growth, and
a higher standard of living
for Manitoba`s families. Al-
together the Conservative
Federal Government has
committed to $70 billion in
stable infrastructure funding
over the next ten years.
In budget 2013 we
have also recognized the
importance of recreationalfi sheries in Canada and the
contribution it makes to the
economy. Our plan invests
$10 million to work with
local conservation and rec-
reational fi shing groups to
enhance and conserve fish
habitat. A further $4 million
will be invested towards
marine conservation, and an
additional $4 million will beprovided to protect our wa-
ters from invasive species.
Economic Action Plan
2013 also confirms our
Government`s support for
hospitals, schools, and other
important health and social
services in rural Manitoba.
In total, Manitoba will re-
ceive $3.4 billion under Eco-
nomic Action Plan 2013 in
federal transfers. This will
include $1.1 billion through
the Canada Health Trans-
fer, $443 million through
the Canada Social Transfer,
$1.8 billion through Equal-
ization, and almost $7 mil-
lion in total transfer protec-
tion. Overall, the Plan willinclude $643 million more
in federal transfer support
to Manitoba than under the
previous Liberal govern-ment.
Economic Action Plan
2013 will ensure the contin-
ued prosperity of the Cana-
dian economy. We are in-
vesting in doctors, workers,
small businesses and farms,
and in rural communities
like those in Dauphin-Swan
River-Marquette.
Sincerely,
Robert Sopuck, MP
Dauphin-Swan River-Mar-quette
Economic Action Plan 2013 brings good news for riding
20 years ago...
SUBMIED
wo more Holes-in-One were recently achieved atMinnedosa Gol and Country Club. On July 31st, NickButler shot one on hole $8 rom 191 yards using an 18 de-gree hybrid. Ten, on August 2nd, Karl Loewen shot oneon hole #12 rom 163 yards using a fve iron.
More Holes-in-One
7/27/2019 August9 2013.pdf
5/16
5Te Minnedosa ribune Friday, August 9, 2013
TOP RATE1 year
1.75%**Rates subject to changeCertain conditions may apply3 year
2.10%*5 year
2.40%*
Dave McDonaldBruce McNabbwww.ricefnancial.com
Call For More Terms & Rates 867-3946
Te Minnedosa ribune welcomes Letters to theEditor. All letters must include the writers ull name,address, and telephone number. Only the writers
name will be published; address and phone numberare required or confrmation. Anonymous letters willnot be published. Letters that are deemed libelous,in bad taste, or describe an incident involving otherpeople, will not be published. Te Minnedosa ribune reserves the right toedit letters based on taste, legality, clarity, andlength. Letters to the Editor can be submitted inperson, sent by mail to Box 930, Minnedosa, MBR0J 1E0, by ax (204) 867-5171, or by email [email protected]
Letters to the Editor
The Minnedosa
& District
Foundation
Congratulations to Hayley Surovy,
2013s recipient of the Verna Averill
Memorial Scholarship. Thisscholarship is awarded to an M.C.I
Grade XII graduate who plans on
becoming a teacher. Hayley is
enrolled at B.U. for the fall and
upon graduating plans to teach
middle years.
By JENNIFER PAIGE
his past Sunday inBowmanville, ON,Minnedosas country duo,Sister Reign took to thestage. Heidi Kornik andJodi McNabb, along with
the Sister Reign band mem-bers, were selected as oneo eight top fnalists or theBoots and Hearts Music
Festivals Emerging Artist
Showcase.Boots and Hearts Music
Festivalis the largest Cana-
dian country music estivaland boast perormanceso more than 30 bandsincluding a mix o super-stars, such as Jason Alden,Miranda Lambert, DierksBently as well as a numbero emerging artists.
Sister Reign was se-lected out o 200 appli-cants to perorm at theestival and participateor the chance to win theemerging artist showcase.Te other seven fnalistsin the running were Jor-dan Mcintosh, Rebekah
Stevens, Abby Stewart,
Te Hollowbodies, Jessica
Mitchell, Te Reklaws, andWes Mack.
Te Reklaws, romCambridge, ON endedup winning the showcase
and were awarded withthe opportunity to openon the main stage in ronto 30,000 in attendanceor Dierks Bently, a mu-sic video agreement withCM, collaboration with asongwriter, studio time inNashville, as well as pro-duction and distributiono a single by a major re-cord company.
Local Country Duo takes part in
Star-studded Music Festival
By JENNIFER PAIGE
Have you recently hadsomeone knockingon your door trying to sell
you something? Te meth-od o the door-to-doorsales is not as popular as itused to be, but i you do re-ceive a door-to-door sales-person in your home, it isimportant to be inormed.
Minnedosa RCMPhas recently received nu-
merous complaints aboutdoor-to-door salespeoplein the area. Local RCMPhave investigated the com-pany and report that theyare a legitimate company
with a license rom thecity.
Te common com-plaint reported to RCMPis repeated visits to unin-terested parties as well asconvincing residents whodo not need the productinto purchasing. However,according to the RCMP thecompany is not doing any-thing illegal.
I your home is ap-proached by a door-to-door salesperson, be sureto ask to see the company
issued identifcation andsellers license or registra-tion. All legitimate door-to-door salespersons arerequired to carry properidentifcation.
Do not be pressuredinto buying anything. I
you are interested in theproduct, ask or sales orproduct inormation andplan to call and order or
visit local stores that sellsimilar products. Alwaysbe sure to compare pric-es as some door-to-doorproducts may be over-priced.
In Manitoba, consum-ers are protected by theConsumer Protection O-fce, which hears, mediates
and investigates consum-er-related complaints orconcerns.
Every province andterritory in Canada alsohas a cooling o period,a specifc number o daysduring which you may
cancel a contract you havemade with a door-to-doorsalesperson or any rea-son. According to the Con-sumer Protection O ceo Manitoba, anyone whopurchases something roma licensed door-to-doorsalesperson has a 10-dayright to cancel.
For more inorma-tion on consumer rights orconsumers rights to can-cel, contact the Consumer
Protection O ce o Mani-toba: Contact: 204-945-3800, oll-ree: 1-800-782-0067, email: [email protected] website: www.gov.mb.ca/cca/cpo/index.html
Be an informed consumer
Photo submitted
Minnedosas Sister Reign poses for a photo at theBoots and Hearts Festival in Ontario.
By JENNIFER PAIGE
My frst week athe ribuneduring August long
weekend has been ullo excitement, amaz-ing volunteer enthu-siasm, town spirit andsome people that sureknow how to rock inthe mud!
As or a little bit
about mysel, I wasborn and raised inBrandon, MB. Liv-ing close to Minnedosa growing up, I spent quite abit o my summer time here. Ater graduating highschool I spent some time travelling beore moving toLethbridge, AB. I attended Lethbridge College andgraduated rom the Communication Arts program
with honours. Ate r graduation I settled in Winnipeg,and began working or a publishing company in thedowntown centre which publishes a number o agri-culture related magazines.
Ater spending some time in the city, I deter-mined that big city lie was not or me. And alas, Iound Te ribune. I am excited to take on this newposition and as I become a regular by-line, please bepatient as I learn names, aces and the ins and outs othe town.
Working in the feld o journalism is a privilegethat provides me with the opportunity to listen, askquestions and tell peoples stories. Tank-you all orthe warm welcome I have received, I look orwardlearning your stories and immersing mysel in thispaper.
Meet our new
reporter, Jennifer
7/27/2019 August9 2013.pdf
6/16
6 Te Minnedosa ribuneFriday, August 9, 2013
7KH0LQQHGRVD5RWDU\&OXEZRXOGOLNHWRWKDQNDOOWKRVHZKRSXUFKDVHGWLFNHWV0D[0F1DEEDQG
WKRVHZKRDWWHQGHGWKH$QQXDO&OXE'UDZ
RQ-XO\
&RQJUDWXODWLRQVWRWKHIROORZLQJZLQQHUV
'DYH%DLOH\
0DF0DUJ'DYLGVRQ
5LFN7D\ORU
0DXULFH.LQJGRQ
)D\H/DUU\&LEXOD
.DWKHULQH0LNH.LQJGRQ
*UHJ&UDVDQWL
'HDQ:DUHKDP
5RE6PLWK
7HUHVD%ULDQ.LOLZQLN
2OLYH7HPSOHWRQ'RULV0F1DEE
'HE3ULWFKDUG
$UQROG.LQJGRQ
'HQQLV0F1DEE
5RVV%XUQVLGH
5D\&KHU\O2UU/LFHQVH5)
Minnedosa Golf ClubMinnedosa Golf ClubExpansion Committee
Cash Calendar Draw Winners
for the Month of July 2013
Lottery License #MGCC3945RF
Eleanor & Dave Marnock $250
Stan Rainkie $50
Jen McDonald $30Martin Woronchuk $30Kevin Hill $30Wayne Cowan $30
$20 Winners^D
dDDEZ^^:d
7/27/2019 August9 2013.pdf
7/16
7Te Minnedosa ribune Friday, August 9, 2013
13082gg05
By RAVENS GLEN WI
Congratulations andbest wishes to Peterand Karen Dymtriw who
will celebrate their 25thwedding anniversary onAugust 10th, we all wishyou many more.
Don and Wendy Fer-guson o Edmonton calledin to visit Ralph and ShirleyPedersen on July 28th.
Gordon and Enid Clark
spent several days at Mani-tou Beach Resort and Spaenjoying the mineral wa-ters there. Tis lake is along narrow basin thatallows water to enter butthere is no drain out, andthe eastern access road hashad to be built up by sev-eral eet.
Friends and neigh-bours gathered last Fridayevening to help Ralph andShirley Pedersen celebratetheir 50th wedding an-niversary with cake, icecream and visiting. On
Saturday, August 3rd, theiractual anniversary date,the amily took them onthe Martese boat cruise atClear Lake and then outor an Anniversary dinner.Congratulations rom all
your riends.Shirley Pederson spentthe long weekend in Bran-don with her sister Bernice
Atkinson and helped hercelebrate her birthday.
Dennis Pedersen isnow an of cial masterangler when he caught a
trophy catsh recently. IanLamb was shing with himand also caught a largecat sh, which they boththen released ater the pic-ture taking! Dennis andBarb Pedersen have had
a young black bear around
their yard easting on theirsaskatoon bushes.Happy birthday wish-
es are sent out to Ida Brad-ley, Peter Weetman and LilFarrend who celebratedbirthdays this past week.Heres wishing you manymore! Lils daughter Lou-ise o Calgary is here visit-ing her mother, and sisterHolly and Albert Shurvelland amily.
Several riends andrelatives attended the babyshower held in Sandy Lakeor the new daughter o
Melissa and Chad Davies.She is another great-nieceor Hilda Davies.
Shannon and CindyDalke, Melanie and ylerspent a week holidaying atGrand Beach in July.Bob and Willine Younghad their amily here tocelebrate Willines specialbirthday at the Royal OakInn. Tey brought theirgrandchildren, Bobby andBrooke home to spendseveral days with them.Rob Young was here on the
long weekend to pick upthe children to take home.Roger, Nancy and amily
were all here or the longweekend to visit, alongwith Robin and StaceyBradley.
NEWDALE NEWS
SUBMITTED
Midwest won thisyears provincialbantam AAA baseballchampionship on Sunday,
August 4th in Morden, MB.Morgan Geekie
pitched a complete gameve-hitter, striking out ninebatters, helping Midwestdeeat host South Central
3-1 in the championshipnal.
o advance to thechampionship game, Mid-
west wound up deeat-ing North Winnipeg 9-4in a semi nal on Sundaymorning. Adam Robidouxhit a three-run home runor Midwest en route to the
victory.Midwest went unde-
eated in the tournament,winning all our o theirround robin games. Teteam now moves on to the
Baseball Canada BantamChampionship, slated totake place August 22nd-26th in Vaughan, ON.
T e squad includesDayton Heino andRyan McLenehan romMinnedosa. MorganGeekie and Blake Mervyn(Strathclair), Riley Sham-ray (Oak River), BrodySmith (Hamiota), DarcyBuhler (Macgregor), ChadKilimnik (Russell), AdamRobidoux (Binscarth),Noah Lemoine (St. Lazare),
Keenan Lewis (Miniota),Nick Kuharski (Neepawa),and Joben Smith (Foxwar-ren).
1993 - Tanks to a do-nation o $2,500 rom theDepartment o NaturalResources, the MinnedosaFish Enhancement Com-mittee is ormed. A localCrime Stoppers Board isalso ormed.
1973 - A spokespersonor Sedco Drilling Co. o
Calgary, AB said his com-pany will be drilling orgas and oil west o SandyLake.
1963 - Rolling RiverSchool Division will paythe Village o Erickson$14,000 or the installa-tion o water and sewerservices to the projectedhigh schools propertyline. T is payment willcover all taxes or 20 years,however, RRSD will haveto pay the usual water
rates.
1943 - Seven cases omeasles are reported inthe Crocus District.
1933 - Ater raids havebeen conducted or ten
years, a still is nally dis-covered in the Bethanyarea. A ne o $200 ischarged to its operator.
1913 - Schools are set tore-open on August 18th.
1903 - Letters patentare issued incorporatingP.J. McDermott, H. Mut-ton, J.W. Tompson, H.F.Maulsen and R.. Sander-son as Minnedosa MillingCompany with a capital o$25,000.
)256$/(%
7/27/2019 August9 2013.pdf
8/16
8 Te Minnedosa ribuneFriday, August 9, 2013
RockinallweekendRockin the Fields photos by Jennifer Paige
Sundays rain turned roads to a muddy mess.
Continued from Page 1
Some heavy rain and cool evening temperatures didnot stop the crowds or campers. Te rain was a bit o a
bummer, but it is expected. Unavorable weather isnt go-ing to stop these people, says Gail McGillvery, a Winni-peg resident, attending her third Rockin the Fields.Tis
estival and the people that attend have the best energy.It is my avourite summer event. Tere is nothing betterthan spending a weekend outdoors, with great music and
great people.
Other perormances throughout the weekend in-cluded FilthyLucre, Te Headpins, Until Red, One Bad
Son, Nuthin But rouble, Te Dust Rhinos as well as nu-merous emerging bands. Attendees also had the oppor-
tunity to participate in a scavenger hunt, a exas holdemtournament, a volleyball tournament, a rock trivia con-test, and many attendees avourite estival extrathebest campsite competition.
As Rockin the Fields continues to grow in atten-dance every year, organizers say they hope to reach 7000-8000 attendees a day, in the uture. Rockin the Fields
2014 presale prices are in efect until August 31st. Duringthe pre-sale, you may also purchase your current or un-occupied campsite, however ater the pre-sale campsites
cannot be held.
Monster ruck plays the main stage.
Monter rucks Jeremy Widerman.David Berenner of T eory of a Deadman.
7/27/2019 August9 2013.pdf
9/16
9Te Minnedosa ribune Friday, August 9, 2013
Continuedrom Page 1
Future rodeo com-petitors had a chance to
try their hand at the alwaysentertaining Muttin Bus-tin event during the main
rodeo intermission. Whilethere were some cashprizes or the top riders,
all young muttin busterswalked away with a bag ochips and drink. We may
see some o these young
cowboys and cowgirlscompeting in Heartland
Rodeo events in the uture.Rodeo is a real am-
ily sport, mentioned an-
nouncer Ivan Ahntholz.Tese olks dont compete
against one another; theyonly compete against theirown last ride or last run.
Following Saturdaysrodeo perormance, thedisplay building came
alive with music and com-radery as the annual ro-deo social gave competi-
tors and spectators alike achance to kick back, relax,enjoy a ew cold ones or
kick up their heels on the
dance f oor to the purecountry sounds oBrothersof the Road. During the so-cial, auctioneer erry Woy-chyshyn Sr. auctioned o
a number o abulous do-nated prizes during a live
undraising auction. Teauction brought in over$1,400 or the local rodeo
committee.Despite the rain, Sun-
days rodeo perormance
went ahead giving com-petitors the added chal-lenge o a mucky rodeo
arena to compete in.T e 2012 edition o
the Minnedosa Rodeo was
named Heartland Rodeo
Associations Rodeo othe Year. Minnedosa also
earned this welldeservedtitle back in 2009.
Logan Bridgeman o Rivers was one o 16High School Tie Down Ropers.
Aaron Lee and Erin Cathcart show of their Team Roping abilities.
Mike Denbow earned a 18.03 inTie Down Roping.
Long Weekend Rodeo Action
Saskatchewans Mason Helmeczi ridesbareback in Mondays High School Rodeo.
Sean Tesarski takesa wild ride on
Payday the bull.
Robyn Denbow races around a barrel Saturday night.
Rodeo photos
by Darryl Holyk
7/27/2019 August9 2013.pdf
10/16
10 Te Minnedosa ribuneFriday, August 9, 2013
By LISA BILCOWSKI
With the Library Sum-mer Reading pro-gram in ull swing, our
weeks have been busy withyoung people spendingtime reading and have un
at the library. Tere havebeen numerous activitydays, a movie day, as well
as a visit rom MagicianRyan Price. Te kids werequite entertained by tricks
that included a visit romSimon the Rabbit and Alexthe Parakeet!
A heads-up to all oureBook readers, eLibrarieshas made some big chang-
es as o August 1st. Tereare some great new up-grades to help make your
loaning experience easierand more convenient. I
you continue to have some
troubles, please give us a
call or drop by and we willdo our best to help you out.
NEW TITLES
Easy Reads
Te French Fry King by Roge
Mr. Kings Tingsby Genevieve Cote
Night Sky Wheel Rideby Sheree Fitch
Juvenile Fiction
Into the Woodsby J. orres
Te Reluctant Journalof Henry K. Larsenby Susin Nielsen
Spirit Wolfby Kathryn Lasky
Young Adult Fiction
40 Tings I Wantto ell You
by Alice KuipersAwaken
by Meg Cabot
My Book Of Life By Angeliby Marine Leavitt
Fiction Novels
Te Accidental Husband by Jane Green
Big Girl Panties
by Stephanie EvanovichDeath Angel
by Linda FairsteinTe Dinner
by Herman Koch
First Sightby Danielle Steel
Te Girl in the Wallby Alison Preston
Revenge Wears Pradaby Lauren Weisberger
Non-Fiction Reading
Bathroom IdeasYou Can Use
by Chris PetersonTe Boys in the Boat
by Daniel James Brown
Pilgrims Wildernessby om Kizzia
Run, Brother, Run
by David BergTe Jugglers Childrenby Carolyn Abraham
Keep on top o whatsgoing on at the library so
you dont miss out on uncontests, activities andprograms of ered in the
community. Visit us at 451st Ave S.E. or www.discoverminnedosa.com. You
can also check us out on
Facebook by searching orMinnedosa Regional Li-
brary. Find book recom-mendations, see what oth-ers are currently reading
and view photos o whatshappening at the Library.
MAIL THIS FORM WITH PAYMENT TO BOX 930,
MINNEDOSA, MB R0J 1E0 PHONE 204-867-3816
NAME:
ADDRESS:
TOWN:
PROVINCE:
POSTAL CODE:Online subscriptions at
www.minnedosatribune.com
Within Manitoba:
$37.29 tax included
Other Canadian locations:
$34.65tax included
New Subscription
Renewal
Subscribe to The Minnedosa Tribune
Library Corner
By DIANE BACHEWICH
Editors note: We apol-ogize or the ollowingerrors rom last weeks re-port.
Bev Marchischuk hadher nephew Dennis andEva Wahoski o Salmon
Arm, BC visiting with her.During Heritage Days,
the rope making demon-
stration was done by An-thony Kowalchuk, ErnieBachewich and Dave Rys-
tephanuk.Shelly, Carlin and Vic-
toria Bedrey o Vanscoy, SK
visited with Diane Bache-
wich and also attended theSichewski-Stasiuk amily
reunion.Under the congratula-
tions to Pam Spitula andGraham Fediuk on their
recent marriage it shouldhave stated that Pam is thedaughter or Dennis andDebbie Spitula.T is weeks report:
Robert and Liz Mandzukhad Lizs brother, Harold
Culp o Orangeville, ONholidaying with them. Teyalso had their daughter
Risa and granddaughterKaiya Adams o St. Cath-erines, ON spending some
time here beore joiningher husband Andres inNelson, BC. Risa has a doc-
tor position at the medical
clinic in Nelson and theywill be making their home
there.Happy birthday to
Nestor Drul who cel-ebrated his 84th birthday
with cofee and cake at theDrop-in Centre.Word has been re-
ceived o the passing o
Dennis Bain, age 65, inFernie, BC. Dennis is theson o the late Mike and
Rosie Bain.Gloria Campbell madea quick trip to Calgary tak-
ing her grandchildrenback. T ey spent sometime with their grandma
Glo.Summer visitors with
Liz and Lorrie Antonation
were Calvin and ammy
Antonation and amily oPincher Creek, AB; Brenda
King, Chris Antonation,Fred Wurmuth o Bran-don, MB; Erin Zurbyk rom
Winnipeg, MB; Matt Kingrom Rivers, MB; Cindyand Joe Zurbyk, Les and
Faye Antonation o Elphin-stone, MB; Michael andLena Shewchuk o Win-
nipeg; Vicky Kiryluik oDauphin, MB; Robert and
Wendy Nykolaishen o Vic-
toria, BC also visited withall other amilies. Tis is a
yearly get-together and itdidnt even rain this year.
Sympathy to the am-ily o Sadley Mushie whopassed away in Brandon.Sadley was born and raised
here in Sandy Lake.Ida Andreychuk has
returned home ater visit-
ing with daughter Glendaand Darrell o SherwoodPark, AB and with son
Mark and amily in Nelson,BC and with her sister-in-laws Mary and Doreen and
amily in Kelowna, BC.Gary and Doreen
Derhak o Calgary, AB are
holidaying or a couple o
weeks with mom, Helen
Derhak and the rest othe amilies. Gary just got
back rom a salmon sh-ing trip to Nootka SoundWilderness Lodge, west oCampbell River on the Pa-
cic Ocean. A good catcho salmon was caught andthis time, the big ones nev-
er got away!John Domaschuk re-
turned home rom an en-
joyable western holidayto Lacombe, AB where hespend some time with son
Blair and amily. He thentravelled to Calgary to seeson Lindsay and while
there visited with Sam
and Donna Backlin and
daughters. From there,Lindsay accompanied his
dad to Kelowna, BC wherethey spent some time withJohns sister Mary andamily and brother Leon-
ard. While there, they cel-ebrated Leonards 80thbirthday. Daughter Holly
and amily o Victoria, BCjoined her ather or a visitalso.
Sympathy is extendedto the amily o the lateJohn Lenkewich, who
passed away at the age o90 years on July 11th at theCharles Wood Personal
Care Home.
SANDY LAKE NEWS
6321625
&223
Shotgun Start: 6:00 p.m.Stableford Scoring
22-3
7/27/2019 August9 2013.pdf
11/16
TO PLACE AN AD
BY PHONE C 867-3816Hours to place, correct or cancel ads:Monday - Friday 9 a.m. - 4 p.m.
BY MAIL CLASSIFIED ADVERISINGT M bu, P.O. Bx 930,
M, Mtb R0J 1E0
BY FAX 204-8675171
BY E-MAIL [email protected]
Te Minnedosa ribune Ltd. reserves the right todelete any words or phrases deemed by Te Minnedosaribune Ltd. to be objectionable, or to reuse to publish anyadvertisement. Te Minnedosa ribune Ltd. shall not beresponsible or any loss or damage to any advertiser or thirdparty resulting rom the ailure o an advertisement to appearin Te Minnedosa ribune Ltd. or rom any error or omission
in any advertisement which is published.
RATES
$9.00 or frst 40 words, additional words .10 each.
Repeat ads - Hal Price.
Classifed Display - $9.00/col. inch each insert.
(Incl. logo, box & bolding, and centering).
Happy Snaps: (Birthday, Engagement, Wedding, Birth, &Graduation)- $16.00 or the frst 20 words and the picture.
Obituaries: $6.50 per col. inch.
Reach the entire province (50 weekly newspapers) $189.00Westman and Eastman: $119.00
All Ads plus 5% G.S..
DeadlinesClassifed advertisements must be submitted no laterthan noon uesday or insertion in the ollowing Fridaysedition. ALL CLASSIFIED ADVERISEMENS MUS BE
PREPAID BEFORE INSERION.
Te Minnedosa ribune is not responsible ortypographical errors published AFER the frst insertion, nordoes it assume responsibility or errors published as a result oan advertisement placed, changed, or cancelled, by telephone.o ensure your advertisement appears correctly please submit it
in person, by ax, mail, or email.
WANTED
11Friday, August 9, 2013The Minnedosa Tribune
TO PLACE AN AD
BY PHONE C 867-3816
Hours to place, correct or cancel ads:Monday - Friday 9 a.m. - 4 p.m.
Y MAIL CLASSIFIED ADVERISING
T M bu, P.O. Bx 930,
M, Mtb R0J 1E0
Y A 2 4- 1 1
BY E-MAIL [email protected]
Te Minnedosa ribune Ltd. reserves the right todelete any words or phrases deemed by Te Minnedosaribune Ltd. to be objectionable, or to reuse to publish anyadvertisement. Te Minnedosa ribune Ltd. shall not beresponsible or any loss or damage to any advertiser or thirdparty resulting rom the ailure o an advertisement to appearin Te Minnedosa ribune Ltd. or rom any error or omission
in any advertisement which is published.
RATES
$9.00 or frst 40 wor s, a itiona wor s .10 eac .
Repeat ads - Hal Price.
Classifed Display - $9.00/col. inch each insert.
(Incl. logo, box & bolding, and centering).
Happy Snaps: (Birthday, Engagement, Wedding, Birth, &Graduation)- $16.00 or the frst 20 words and the picture.
O ituaries: $6.50 per co . inc .
Reach the entire province (50 weekly newspapers) $189.00Westman and Eastman: $119.00
A A s p us 5% G.S..
DeadlinesClassifed advertisements must be submitted no laterthan noon uesday or insertion in the ollowing Friday sedition. ALL CLASSIFIED ADVERISEMENS MUS BE
PREPAID BEFORE INSERION.
Te Minnedosa ribune is not responsible ortypograp ica errors pu is e AFER t e frst insertion, nor
oes it assume responsi i ity or errors pu is e as a resu t oan a vertisement p ace , c ange , or cance e , y teep one.o ensure your advertisement appears correctly please submit it
in person, y ax, mai , or emai .
FOR SALE
GARAGE SALES
COMING EVENTS
REAL ESTATE HAPPY BIRTHDAY
REAL ESTATE
CAMPER
FOR SALE
Selling something? Let
our readers know! Place an adin Te ribuneClassifeds start-ing at $9.00 plus tax. (tn).
Watkins. Call Elaine at204-761-2938 (evenings).
1997 electric Yamahagol cart with charger, canopy,
windshield, club hood andcanvas storage cover; excellentcondition. $3,500. Phone 204-848-7603. (x)
Princess antique bed, 72long, 36 wide, rod iron brass,great condition, $140.00 obo;Sanyo ECR 305 cash registerrom Winnipeg Cash Register
Company, $75.00; York weightset, 230 olding bench, spacesaver, 8-2 1/2 lb weights, 4-5lb
weights, 6-10lb weights, $50.00; ton metal truck tool box 21
wide x 31 high x 5t length,$150.00; wooden shop table on
wheels, 65 length, 24 wide, 3t tall, $50.00; Hammond organ$25.00; wooden o ce desk,5t length, 22 wide x 31 tall,$30.00; o ce desk 4 t length x30 wide x 31 tall, $30.00; 2 endtables and 1 coee table, metal
with assorted clay stone on top,$75.00. For ino call 204-867-2553. (22-3x)
2005 Ameri-Camp Sum-mit Ridge 30 oot long, bump-er hitch-Queen bed(separateroom)- Quad bunks (separateroom)-Sleeps 8- Large Fridge-expandable kitchen table-Pullout soa bed- Large awning-
Sewer, water, propane andcable hookups. Delivery Avail-able. $13,499 OBO 204-573-1412 or 204-761-7803. (21-3)
Looking or something?Our readers may have it! Placean ad in Te ribuneClassifedsstarting at $9.00 plus tax. (tn)
Garage sale undraiseror Robyn Dragans 11 monthmission trip. I you have anyitems to donate, please dropo at 215 2nd St. N.W. or call204-867-0468 or 204-867-1978. Garage sale will take
place at the Minnedosa Cal-vary Church, 52 2nd Ave S.W.on August 17th at 9:00 a.m.(21-2x)
Multiamily yard sale:toys, household items, chil-drens books, petite size cloth-ing on Saturday, August 10th,10:00 a.m. 2:00 p.m., 7-4th
Ave. NE. Cancelled i raining.(x)
NEW HOME FOR SALE
Beautiul, open-concept 1308sq. t. bungalow fnished
top-to-bottom built in 2010.Home eatures walk-out
basement, 3 + 2 bedroomsand 3 bathrooms located in anewly developed residentialarea o Minnedosa. Nicely
landscaped back yardoverlooks the own rom thedeck or rom the brick patioarea below. In-oor heated
double attached garage.Includes main oor laundry
pair as well as stainlesssteel kitchen appliances.oo many extras to list.
$338,000.00Call or text 204 867-7405 or
204 867-7154(18-2x)
1RZ%XLOGLQJ6FHQLF5LGJH(VWDWHV
&RQGRV
8QLWV$YDLODEOH)RUGHWDLOVFDOO
3HWHU+DUULVRQRI6XWWRQ+DUULVRQ5HDOW\
OPEN HOUSESaturday 2 - 3:00 p.m.
Come and Go bridalshower in honour o Kristinaman, bride-elect o RyanHyrsak, to be held on Saturday,
August 10th rom 2:00 4:00p.m. at the home o the groomsparents, Delmar and KarenHrysak, 165 3rd St. S.E. (21-2x)
You are invited to a bridalshower on Sunday, August11th, 2013 in honour o ALwk, daughter o Lenand Pam, engaged to mCm, son o Stew and
Kathy (o Forrest, MB) at theSandy Lake Community Hall at2:00 p.m. Everyone Welcome!(21-2x)
Join us or a bridal show-er in honour o KKut, bride-to-be o Ryan Syn-chyshyn on Sunday August11th rom 2 4 p.m. at 3452nd St. S.E Minnedosa. Pleaseaccept this as your invita-tion. (21-2x)
BRIDALSHOWERS
Kaylan and Bryan Pinutao Minnedosa
are excited to announce
the arrival o their baby girlon
May 26, 2013,Madelynn Rose Marie.
Proud grandparents areMurray and Eileen rott
o Minnedosa,David and Diane Pinuta
o Winnipegand great grandma is
Frances rotto Minnedosa.
(x)
BIRTHANNOUNCEMENT
It took 50 years to
look this good!From your riends at the
Minnedosa Vet Clinic.
Have an upcoming eventyoud like to let everyoneknow about? Get the wordout there with a ComingEvent listing in Te ribune.
Ads starting at $9.00 plus tax.(tn)
UC Bingo at UkrainianHall, uesday nights. Doorsopen at 6:00 p.m. Early bird at7:00 p.m. ollowed by regulargames. License #3359 B1 and3359 BO. (47-tn)
Elphinstone Lions Club,8th annual yard sale. Satur-day, August 17th, 2013, 10:00a.m. 2:00 p.m. at the LionsPark. I bad weather in thehall. ables $10.00 each or3 or $25.00. o book a tablephone 204-625-2423. No out-side ood concessions. Lunch
Available. (21-2x)
Newdale Horticul-tural Society Flower Show.
Wednesday, August 14th,2013. Doors open at 2:00 p.m.Roast Bee supper rom 5:00 7:00 p.m. Adults $10.00 Chil-dren (6-12yrs) $5.00 5 andunder FREE. Everyone Wel-
come! (21-2x)
Te Prayer group romMinnedosa Calvary Church
would like to invite you toa ree BBQ on Wednesday,
August 21st rom 11:30 a.m. 1:00 p.m. at the annersCrossing Park. (22-2)
7/27/2019 August9 2013.pdf
12/16
12 Friday, August 9, 2013 The Minnedosa Tribune
HELP WANTED
NOTICE
DAYCARE
PAINTER
COMING EVENTS
Minnedosa Service toSeniors Congregate Meal
Program serving suppermeals or seniors at theownview Manor 6th fooruesdays, Tursdays,Sundays starting at 5:00p.m. $8.00 dine in, $10.00delivered. Call 204-867-2198 ater 1:00 p.m. on dayo the meal or call 204-867-5190 or all other inquiries.Service to Seniors Menu:
Ag 11h:
Bee stew with biscuits,rolls, potatoes, vegetable,salad, pickles, dessert, tea
or coeeAg 13h:
Roast chicken with gravyand dressing, rolls, potatoes,
vegetable, salad, pickles,dessert, tea or coee
Ag15h:
Grilled pork chops, rolls,potatoes, vegetables, salad,
pickles, dessert, tea orcoee
(12-tn)
Save the Date Satur-day, September 28th Saluteto Broadway eaturing AaronHutton and Friends. icketsales at Co-op September13th, 14th and 20th. Watch ordetails. (x)
Gold Rush Vacation
Bible School is coming toMinnedosa Covenant Churchrom August 19th 23rd, 9a.m. noon. All children rompreschool (age 3+) to gradesix are welcome. Games, Bi-ble stories, crats, prizes andmore! Phone 204-867-2810or more inormation. (22-2)
August 17th at Franklin Hallrom 2:00 4:00 p.m.
60th wedding anniversary orRon and Beryl Parrott.
(-x)
Te MINNEDOSAHORTICULTURAL SOCI-
ETYwants you to come andhelp us celebrate our 100THANNIVERSARY with birth-day cake at the MCCC dur-ing our annual fower show.uesday August 20th rom2:00 to 4:00 p.m. Entries willbe accepted rom 5:00 to9:00 p.m. on Monday August19th and rom 8:00 a.m. to9:00 a.m. on uesday mor-ning August 20th. Books andtags are available at the AgO ce and Flowers on Main.
All exhibitors are very wel-come. Everyone is welcometo view the displays rom 2:00to 7:00 p.m. Te Junior Awardprogram is at 7:30 p.m. and
sale o veggies and fowers at8:00pm. NO Admission - rain-bow auction on site. (22-2)
Kingdon Electric is nowworking exclusively on theprojects o one general con-tractor and so will not be ac-cepting work rom any othercustomers. I apologize or anyinconvenience, and wouldlike to thank past customersor their support. (21-2x)
Qualied Painter with25 years experience. All workguaranteed. Call Blaine at204-874-2399. (43-tn)
Mcavishs Ice CreamParlour at Clear Lake requires
ull-time or part-time help.For interview, phone 1-204-848-7366. (19-4x)
Little Sprouts ChildcareHome is SAYING in Minne-dosa!!! I currently have oneInant/Preschool spot andthree School-Age spots avail-able starting ASAP. I am a li-censed ECE II, and providetons o outdoor play as wellas developmentally appropri-ate activities. I also providetwo snacks and a hot home
cooked lunch daily. We goon eld trips within walkingdistance o my house, andoten spend all day exploringoutside! I am open 7:30 a.m.- 5:00 p.m., Monday-Friday.Please call Karen at (204)867-3626 or email shaash79@
yahoo.ca, or more inorma-tion or to book a spot! ( 16-tn)
Little Wonders CountryDaycare near Erickson has var-ious spots available or Augustand September. I also have oneull time inant/preschool spotavailable late August. I you
would like more ino please callLynne at 204-636-2931 (21-5x)
Instructor Clinical Nursing
Half-Time Term (.5) from August 2013 up to June 2015School of Health Sciences & Community Services
Neepawa Rural Bachelor of Nursing Site
Red River College is a leader in applied learning and innovation. Our talented team of employees is passionate about education,innovation and student success. We offer competitive salaries, extensive benefits, and the opportunity for personal and professionalgrowth in a rewarding career. Together, we are going places.
Duties: The primary responsibility of this position is to teach, mentor, supervise and evaluate nursing students in the clinicalpractice settings for the Red River College LPN to BN Neepawa rural location. Other responsibilities include maintaining clear andcurrent communication and consultation with the Neepawa site classroominstructor and the RRC main campus, the rural programcoordinator and the Clinical Course Leader.
Qualification Requirements:Required:
Baccalaureate Degree in Nursing. Applicants with a Diploma in Nursing and significant clinical expertise may beconsidered
Registration or eligibility for registration with the College of Registered Nurses of Manitoba Experience and competence as a practitioner in the areas of medical, surgical and gerontological nursing Interpersonal communication competence and the ability to relate to a diverse nursing student population Computer skil ls Cultural sensitivity Commitment to lifelong learning
Assets: Previous clinical teaching experience
Conditions of Employment:x This position may be required to work evenings
We seek diversity in our workplace. Aboriginal persons, women, visible minorities and individuals with disabilities areencouraged to apply.
Competition Number: 2013-117
Closing Date: August 23, 2013
Salary Range: $28.19 to $41.88 per hour
*The successful candidate with a Masters or PhD in a related field will receive anEducational Supplement of $2,725 or $5,450 per annum respectively pro-rated on anhourly basis.
Apply to: Red River CollegeC410 - 2055 Notre Dame AvenueWinnipeg, MB R3H 0J9Fax: 204-694-0750e-mail: [email protected]
We thank all applicants for their interest, but only those selected for an interview will be contacted.
For more information and other employment opportunities, visit www.rrc.ca/employment, http://www.rrc.ca/hiringprocess ,www.rrc.ca/peopleplan & www.rrc.ca/about.
*(1(5$/0$1$*(5675$7+&/$,5&223
7KH&RRSHUDWLYH5HWDLOLQJ6\VWHP&56LVDXQLTXHPXOWLELOOLRQGROODURUJDQL]DWLRQEDVHGRQWKHIXQGDPHQWDOSULQFLSOHVRIFRRSHUDWLRQ,WLVFRPSULVHGRIDQHWZRUNRIDSSUR[LPDWHO\DXWRQRPRXVUHWDLOFRRSHUDWLYHVDFURVV:HVWHUQ&DQDGDDORQJZLWKWKHLUEUDQFKRSHUDWLRQVDQG)HGHUDWHG&RRSHUDWLYHV/LPLWHG)&/)&/LVWKHZKROHVDOLQJPDQXIDFWXULQJDUPRIWKH&56
ZKLFKSURYLGHVWKHUHWDLOFRRSVZLWKDUDQJHRISURGXFWVDQGVHUYLFHV6WUDWKFODLU&RQVXPHUV&RRS/WGLQYLWHVDSSOLFDWLRQVIRUWKHSRVLWLRQRI*HQHUDO0DQDJHU5HSRUWLQJWRDQHOHFWHG%RDUGRI'LUHFWRUVWKH*HQHUDO0DQDJHULVUHVSRQVLEOHIRUDOODVSHFWVRIWKH&RRSVRSHUDWLRQLQFOXGLQJPDUNHWLQJPHUFKDQGLVLQJILQDQFLDOPDQDJHPHQWKXPDQUHVRXUFHVDQGPHPEHUDQGERDUGUHODWLRQV7KHRSHUDWLRQLQFOXGHV)RRG+RPH&HQWUH*HQHUDO0HUFKDQGLVH/LTXRU/RWWHU\$JUR3HWUROHXPDQG3XPSV7KHVXFFHVVIXOFDQGLGDWHVKRXOGKDYHSULRUUHWDLOPDQDJHPHQWH[SHULHQFHZKLFKLQFOXGHVRYHUVHHLQJDODUJHVWDIIFRPSOHPHQW7KHLQGLYLGXDOPXVWDOVRKDYHGHPRQVWUDWHGVWURQJOHDGHUVKLSH[FHSWLRQDOFRPPXQLFDWLRQDQGLQWHUSHUVRQDOVNLOOVDQGVWURQJSODQQLQJDQGRUJDQL]DWLRQDOVNLOOV6WUDWKFODLU&RQVXPHUV&RRSRIIHUVDFRPSHWLWLYHVDODU\DFRPSUHKHQVLYHEHQHILWVSDFNDJHKRXVLQJDQGH[FHOOHQWRSSRUWXQLWLHVIRUDGYDQFHPHQW7RDSSO\SOHDVHVHQGDFRYHUOHWWHUDQGUpVXPpWRWKHHPDLODGGUHVVEHORZRU
6WUDWKFODLU&RQVXPHUV&RRSHUDWLYH/WG
%R[6WUDWKFODLU0E5-&
$WWQ'DUUHQ5R]GHEDHPDLOGBUR]GHED#KRWPDLOFRP
:HWKDQNDOODSSOLFDQWVIRUWKHLULQWHUHVWEXWRQO\WKRVHFDQGLGDWHVFRQVLGHUHGIRUDQLQWHUYLHZZLOOEHFRQWDFWHG&ORVLQJ'DWHIRU$SSOLFDWLRQVLV0RQGD\$XJXVW
WK
/(602))$7,1&&ODVV'ULYHUZDQWHG+DXOLQJ
*UDLQRIZRUNZLWKLQ
0DQLWRED&RPSHWLWLYHZDJHV
)D[UHVXPHWR
RU3KRQH/HVDW
7KH0RXQWDLQ*ULOO5HVWDXUDQWDWWKH(ONKRUQ5HVRUWLV
QRZKLULQJIRU
)$//:,17(56(59,1*326,7,216
6WDII$FFRPPRGDWLRQVDUHDYDLODEOH
3OHDVHVHQGUHVXPHWR6WHSKDQLH3LFDUG
VWHSKDQLH#HONKRUQUHVRUWPEFD
EQUAL TRANSPORTEdson, Alberta
CLASS 1 DRIVERSNEEDED
$35 PER HOUR(w/experience)
H2S CERTIFIED,OFF ROAD
EXPERIENCEREQUIRED,
FLUIDS HAULINGEXPERIENCEPREFERRED
COMPANY PAIDBENEFITS & BONUSES
SEND RESUME &DRIVERS ABSTRACTIN CONFIDENCE TO:
EMAIL: EDSON@
EQUALTRANSPORT.CA
FAX: (780) 728-0068
(22-2)
Town of Minnedosa
The Town o Minnedosa is accepting tenders or:
RFQ 2013-07 2nd St NW Water & Sewer
General information
The supply and installation o approx 84m o 150mm water line and
150mm sewer line along 2nd St NW.
To include:
150mm C900 pipe
150mm SDR35 sewer pipe
One manhole structure
One Mueller fre hydrant and associated par ts
Supply o backfll material and removal o excess waste material
Final landscaping, top soil and grass sowing
Any required road repairs associated with the works.
Any enquiry concerning the content o this Request or Quotation
should be directed to Kevin Marcino at 204- 867-0037 or
Sealed Tenders marked 2nd St NW WATER & SEWER will be
accepted at the Town o Minnedosas Civic Centre, 103 Main Street
South, Box 426 Minnedosa, MB R0J 1E0 until 4:30 p.m. on Friday August
23, 2013. Fax: (204) 867-2686 Email: [email protected]
Any or all of the quotations may not be necessarily accepted.
TENDER
HELP WANTED
7/27/2019 August9 2013.pdf
13/16
13Friday, August 9, 2013The Minnedosa Tribune
IN MEMORIAM
In loving memory oour dear niece and cousin,Jacqueline Kaye Lawson
who passed away onA 12, 2009.
Loving memories never die
As years roll onand days pass by
In our hearts yourmemory is kept
Of one we lovedAnd will never forget.
Kim, Brenda, Jennier,Natasha and Eric Moran
(x)
J 16, 1985
A 12, 2009
In Memory oour daughter and a sister,
Jacqueline Lawsonwho will never be orgotten.
As time goes on,We try to take your memory
with us in everything we do.No one knows our heartache,
Only those who havelost can tell
Of the grief we bear in silenceFor the one we loved so well.
You are someone specialWho we love and
miss beyond words.
Lovingly,Dad, Mom and Jef Lawson.
(x)
In loving memory oJacqueline Kaye Lawson.
Four years have gone by butmemories never die.
Your smile, your enthusiasm,your willing ways.
Tese memories will never beforgotten,
You will be in our heartsforever.
Missing you alwaysGramma Johnson
(x)
PastershankJanuary , - Tuesday,
July th, It is with great sadness thatour amily announce thepassing o eenie Pastershankon uesday, July 9th, 2013 atthe Sandy Lake Personal CareHome at the age o 98.
eenie was born in theHarrison area on January 26,
1915. She attended schooling atthe Martin Dale School. eenie
married Frank Pastershank inOlha, MB on June 14, 1932.
Tey armed at Wisla , Manitoba until1937, then moved to Elphinstone. Frank and eenie moved toMinnedosa in 1971 when they retired rom arming.
eenie was devoted to her husband, amily and riends. Shepicked many pails o wild ruit or her amily over the years.
Also was a very avid gardener and provided many jars o ruit,vegetables and pickles.
For many years she enjoyed playing Bingo and cards withamily and riends.
eenie was predeceased by her late husband Frank o 58 years;inant son Larry; her parents Joseph and Mary Kristalovich, as
well as her nine siblings, three sister-in-laws and three brother-in-laws.
eenie is survived by her son, Edward (Sylvia) Pastershank;daughters, Helen (Ed) Antonsen, Mabel (Nick) Stebeleski; vegrandchildren; nine great grandchildren and our great-greatgrandchildren. She is also survived by sisters, Lavinia, Regina,and brothers, Nick, Joe and numerous nieces and nephews.
Te uneral service was held Saturday, July 13, 2013 at theSandy Lake Holy Ghost Ukrainian Catholic Church with Fr.Emil Kardasinec o ciating. Interment ollowed at the CatholicCemetery. I riends so desire, donations may be made to theSandy Lake Personal Care Home tub und.
Raes Funeral Service o Shoal Lake was in care o
arrangements.Vichnaya Pomyat!
Harold Ernest ProvenJanuary , - July ,
Tere was peace in the Little Saskatchewan River Valley, as thesun rose July 16, 2013 when Harold Ernest Proven died. He wassurrounded by his amily, in the place he loved best!
Harold was born January 15, 1926 in the FairmountDistrict. So began the lie o a man who touched thelives o so many people. He was the youngest o six childrenborn to Fred and Hazel Proven. Harold was only our monthsold when his ather died, leaving his mother, Hazel to raise Stan,Elmor, Helen, Margaret, Jim and Harold. Harold was the last o his
generation.Harold is survived by his loving wie o 65 years, Isabella; ve sons,
Garry (Debra), David, Randall, Richard (Amy) and Douglas (Cindy);ten grandchildren, Kerry (im), Bronwyn, Danika, imothy, Gena,
Evan, Ayma, Donald (Roselle), Michael and Jonathon; six greatgrandchildren, Ashley, Victoria, Kyla, Brooklyn, aner and Mason; and many nieces, nephews andcousins.
He received his education at Basswood. Harold took his army basic training then returned toBasswood to begin work with a local carpenter, om Hymers. So began his love o woodworking. Hereceived his certicate in Cabinet Making at the Manitoba echnical Institute and then worked withMusselwhite Woodworking in Minnedosa.
Harold was a nishing carpenter at Rivers Base or two years. In 1950 Harold and Isabella relocatedto Melita, where Harold established his own Cabinet Making Shop. In 1954 they moved to Calgary,
where Harold obtained his Journeyman Carpenter certication.In 1960 Harold and Isabella moved their amily back to Basswood becoming the third generation
o Provens on NE 3-16-19. Harold began arming and continued to build homes and do cabinetry.He was a trustee o the Basswood School Board and a Councillor with Harrison Municipality and
Minnedosa Hospital Board or six years. He served on the Basswood United Church Board and wasvery involved in the Onanole Seniors Centre.
Harold was a charter member o Local 516 o the National Farmers Union, serving as local Vice-President, District 6 Director and was elected to the National Board and National Executive asRegion Five Coordinator or our years.
Harold was an activist, advocate or peace, social justice and human rights. Lielong involvementsincluded Project Ploughshares, Marquis Project, ools or Peace, Eco-justice and the Council oCanadians.
His travels took him to China, Cuba and across Canada rom Ottawa to Vancouver Island.Harold was the recipient o several awards, which included the Global Citizenship Award and
the National Farmers Union Grassroots Leadership Citation or loyal service to the arm union
movement.Harold and Isabella retired to Onanole in 1990 to the home that Harold and his sons built. His
double garage became his workshop. Tere he spent many happy hours making diamond willowcanes, stools, tables and numerous items rom a variety o wood in his shop. Clocks and picturerames were crated rom wood recycled rom the old barn at the arm. His generosity ound manyo these items given as gits with the signature H.E.P.
A celebration o Harolds lie took place July 27, 2013 at the home o son, David.I desired, donations may be made in Harolds name to the Canadian Diabetes Association, 200-
310 Broadway, Winnipeg, MB. R3C 0S6 or to a charity o your choice.Love Is Forever.
OBITUARIES
Bob Harrington
A 2, 1994
Sunshine fades andShadows fall
But sweet remembranceOutlasts all
Sadly missed by Diane, Jill,Karen and Family.
Irene Marie DaggSeptember , - July ,
With heavy hearts, the amily o Irene Marie Dagg announceher sudden passing July 24, 2013. Irene was born September26, 1929 at Mossbank Saskatchewan to Casper and MattieJohnson, and was the youngest o our children. Irene movedto Manitoba in 1945 to nish her education and attend normalschool. Upon completing normal school Irene had severalteaching positions.
In 1951, while teaching at Crocus school Irene met DonaldDagg. Te two were married in Clanwilliam on July 17, 1954.
Irene and Donald lived briey in Clanwilliam beore settlingon the Dagg amily arm south o town. March 28, 1958 Ireneand Don welcomed their rst child Murray, who was soonollowed by a daughter Janice on June 1, 1959. Irene loved the
arm lie and enjoyed the years they spent there. In the early1990s Don and Irene moved back into Clanwilliam, this is
where Irene spent the remainder o her years.Irene had many interests including baking, bird watching,
doing crossword puzzles and gardening. She was active in theEmanuel Lutheran Church in Clanwilliam until its closing andollowing that continued to devote time daily to Bible study.
Irene was predeceased by her sister Clara, Brother Oscar,brothers in law Bud and Gordon, and sister-in-law Evelyn. Letto mourn her is her husband o 59 years Donald, son Murrayand daughter Janice (Brian), grandchildren Brent (Candice),Christina (Cam), Jonathon (Destiny), Jefery (Joanne), Charles(Lyndie), great grandchildren Kira, Elizabeth, Emilie, Rhiannon,Elise, Stella, Kae-Lynn, and Evangeline, sister Myrtle, NephewEugene, and nieces Irene, Lynn, and Lois, as well as manyextended amily and riends.
Funeral services were held July 27, 2013, with Elgin Hallo ciating. Interment ollowed at St. Johns Cemetery.
Pallbearers were Brent Little, Cam Woodcock, Jon Dagg, JefDagg, Charlie Dagg and Andrew Richards. Minnedosa FuneralServices in care o arrangements.
Memorial donations may be made to the Heart and StrokeFoundation.
Charles IrvineSunday, July ,
Charles Irvine o Brandon, beloved husband o the late Florence
Irvine, and dear ather o Maxine Harvey and Blair Shaggy Irvine,
passed away peaceully at his residence, Fairview Home, on
Sunday, July 7, 2013 at the age o 93 years.
Charlie attended remaine School. In 1941, he enlisted in the
Royal Canadian Army Corps. Ater training at Red Deer, Alberta,he went overseas in March 1942. Charlie was sent to Sicily in July
1943 and also saw service in Italy, Holland and Germany, returning
home August 14, 1945. Charlie had many stories to tell during his
time overseas or World War II. During this time, he also met all his
Scottish relatives and spent quality time with all the aunties.He married Florence Jessie Chambers in Rapid City, MB on
July 2, 1960 and lived in Rapid City on the arm until retiring intoMinnedosa. Charlie had ond memories growing up in the valley. He laughed
at his stories o his childhood with his three sisters. One o the stories involved sledding down thebig hill behind the barn. He skated on and swam in the river nearby with the Christie and Andrewboys. Charlie enjoyed hunting with riends and brother-in-law, Bill Gibbons. He also enjoyedshing with riends and brother-in-law, Roy Attridge. Charlie was active in the Rapid City Legionand remaine Community Club. He attended many district card games and dances and Christmasconcerts. Charlie coached hockey with another Dad when Blair was playing hockey. Charlie armedor years, worked at International in Brandon and worked at Morris in Minnedosa. He relaxed by
watching the birds, watching sports on television and reading the newspaper. Charlie loved peopleand visiting with everyone. He was well known or his jokes and teasing. Charlie was very ond o
his grandchildren and spent many weekends at the Minnedosa beach watching them swim andplay. He became a great grandparent in 2009 and 2013.
Charlie will live on in the hearts o son, Blair (Shaggy) and daughter, Maxine, grandchildrenChris, Becky, great grandchildren Mason and Charlee, sister Jessie Gibbons, cousins, nieces andnephews and riends. We are grateul or the happiness he brought to our lives. Predeceased byparents Charles and Isabella Irvine, wie Florence, sisters Isabella and Lily, son-in-law Gord.
Te celebration o Charlies lie was held at Rapid City United Church, Rapid City, MB onTursday, July 11, 2013. Should riends so desire, donations are welcomed to Cancer Care ManitobaFoundation, 1160 675 McDermot Avenue, Winnipeg, MB R3E 0V9 or https://www.cancercaredn.mb.ca
Charlie, you will be remembered.Messages o condolence may be placed atwww.brockiedonovan.com. Arrangements were in
care o Brockie Donovan Funeral & Cremation Services, Brandon.
7/27/2019 August9 2013.pdf
14/16
M & MAUTO BODY
All Auto Body Repairs
Ph: 867-20835 Main St.North
Friday, August 9, 2013 The Minnedosa Tribune
ACCOUNTING
Income Tax Filing Farm and Business Accounting Payrolls Government form filing
Phone 867-5550Fax 867-5808
116 Main St. S.
Minnedosa, MB R0J 1E0
Tax Ser v i c e& A c co u n t i n g
Parish BackhoeServices
Septic Systems Weeping tiles
Water Sysyems Basements
All types of excavation
Certifed in waste
water management
Call: Ian874-2134 or 867-0383
BIRBIRCHCHCONSTRUCTION
CommercialResidential
GENERAL
CONTRACTORS
LTD.
867-0400
0r
867-7506
PRAIRIE CONCRETEMinnedosa - 867-3853
Ready Mix ConcreteConcrete orms, Rebar, Wire Mesh,
Weeping Tile, Concrete Sealer, Snap Ties
All at Competitive
prices
Specializing in water & sewerinstallation & repair
All types of excavation Basements, Demolition Snow removal Gravel, Topsoil Sales of septic tanks
Tony 867-7582
Kirk 867-0180
Clint Moffat
& Sons Ltd.OFFICE
867-3356
Sand & Gravel Products
Excavating
Water & Sewer
Installations
Site Preparation
Landscaping
Snow Removal
ALLARD
YAKUBCHAK
WIRCHCERTIFIED GENERAL
ACCOUNTANTS
George Allard, C.G.A.*
Gateway Street
Onanole, Mb
848-7413
Howard Wirch, C.G.A*
9-515 4th Ave
Shoal Lake, MB
759-2680
Dauphin Office - 15 1st Ave S.W.
Phone: 638-3005
Fax: 638-5817*Denotes Professional Corporation
CONSTRUCTION ELECTRICAL
BURTON
Enterprises Ltd.
Air Conditioning,Heating & Electrical
30 Years
Ex perience!!
Bus : 867-3950
Fax:
867-2340
Refridgeration
70 Main St, S.Minnedosa, MB.
Personal Tax Returns
Farm Returns
Business Returns
Cash Back
Phone: 867-5124
14
EAVESTROUGH
$1'FRQWLQXRXVSUHQLVKHGHDYHVWURXJK
6LGLQJ5RRQJ6RIW)DVFLD&ORVHGFHOO
3RO\XUHWKDQH6SUD\IRDP%ORZLQ$WWLF:DOO
)LEUH,QVXODWLRQ)LUH5HWDUGHQW&RDWLQJ
PFUHDO#OLYHFD
AUTO CONSTRUCTION
B
BA SSWO OD
A SS
WOOD
A
A UTO
UTO B
BODY
ODY
A ND
A ND G
G LA SS
LA SS
WILD LIFE COLLISION EXPERTS
WEST ST., BASSWOODPHONE: 874-2270
E-GLASS REPLACEMENT
& REPAIRS
Catharine M Gijsbers.Certified General Accountant.Professional Corporation - 213 2NDStreet NEBox 385, Minnedosa MB R0J 1E0
x Personal & Corporate Income Taxx Accounting and payroll servicesx AgExpert Analyst Certified Advisorx V.I.P. InstallerGroup trainerTel: 867-3884 Cell: 867-0190Email: [email protected]
AC
FINANCE
Minnedosa
Credit
UnionMain line867-6350
Joanne Clarke867-6364
Susan Glasgow867-6353
Alayna McTavish867-6354
Debbie Strelczik867-6359
Lori McNabb867-6360
Harvey Wedgewood867-6363
Carol Dalrymple867-6367
Carol Taylor867-6368
Kim Robinson867-6352
Jeff Dusessoy
867-6369Sylvia Firby867-6361
Candice Brown867-6362Brad Ross867-6366
Fax867-6391
MCU MCU
BookThisSpotforonly$13.74per
week!
Gwen UsickAlternate Broker
Ph: 867-4657Fax: 867-2150
PRAIRIEMOUNTAINIndependently Owned
and Operated
6KRDO/DNH%GP%DWK
EXQJDORZRQFRUQHUORW0RGHUQNLWFKHQQXPHURXVUHFHQW
XSJUDGHVLQFOXGLQJLQVXODWLRQVLGLQJIDVLDVRIWHDYHVVKLQJOHV[GHFNPXFKPRUH0/6
6WUDWKFODLU,PPDFXODWH%GP%DWKRSHQFRQFHSWPRELOHKRPHRQDODUJHORWRDNFDELQHWVFDWKHGUDOFHLOLQJ[GHFNVKHGJUHHQKRXVHHWF0/6
0LQQHGRVD6WRQHKHULWDJHEGPEDWKKRPHIHDWXUHV
RULJLQDOGHWDLOHGKDUGZRRGXQLTXH[WXUHVLQVXODWHGEDVHPHQWLVVROG
ZLWKWRZQORWV7KHUHLVDVLQJOHJDUDJH
GRXEOHLQVXODWHGJDUDJHZLWKLQRRUKHDWHLQIRUFHGFHLOLQJVKHGVFLUFXODU
GULYHZD\0/6
Take a tour on realtor.ca or our websitewww.remax-prairie mountain-npwa.mb.com
(ULFNVRQ+REE\)DUPRQDFUHV
UHFHQWO\UHQRVTIWVWRUH\FKDUDFWHU%GP
%DWKKRPHUHSODFHVQXPHURXVRXWEXLOGLQJVD
%GPJXHVWKRXVHYHJHWDEOHJDUGHQDQGPXFKPRUH0/6
0LQQHGRVD4XDOLW\%GP%XQJDORZZLWK
DWWDFKHG26VLQJOHFDUJDUDJH*'2RQDGHHSORWFORVHWRGRZQWRZQ0DLQEDWKODXQGU\+(JDVIXUQDFHFHQWUDODLUSDWLRYHJHWDEOHJDUGHQ$UHDOJHP0/6
50RI2GDQDKVTIWKRPHZLWKPXQLFLSDOZDWHU
EGPEDWKWULSOHFDUJDUDJHQHZHUZLQGRZV7KHUHDUHIHQFHGSDVWXUHV[VKHGEDUQVKD\ODQGJURRPHGZDONLQJSDWK
YHJHWDEOHIUXLWJDUGHQVDOOORFDWHGRQ
DFUHV0/6
1(:
/,67,1
*
Rick Taylor 867-7551
/RW0LQQHGRVD%HDFK&RWWDJHDW0LQQHGRVD/DNHZLWKQLFHYLHZV7KLVEHGURRPSLHFHEDWKFRPHVIXOO\IXUQLVKHGDWDQDIIRUGDEOHSULFH6FUHHQHGGHFNRYHUORRNVWKHYDOOH\DQGODNH&RWWDJHLVZLQWHUL]HG
DQGKDV$&DQGFDEOH79
WK6W1(8QLTXHEHGURRPEDWKIDPLO\KRPHLQGHVLUDEOHODNHDUHD*UHDWSDWLRDQGGHFNZLWKKRWWXERXWGRRUUHSODFHDQGEHDXWLIXO[LQJURXQGSRRO9HU\ZHOOPDLQWDLQHGKRPHVLWVRQORWDQGIHDWXUHVVN\OLWPDLQEDWKZLWKSRXUHGPDUEOHVXUURXQGDQGVRDNHUWXE)LQLVKHGEDVHPHQWKDVDIDPLO\URRP
ODUJHEHGURRPSLHFHEDWKPHGLDURRPXWLOLW\VWRUDJHDQGIRRWFHLOLQJV
VW6W1:
ELOHYHOKRPHIHDWXUHVEHGURRPVIXOOEDWKVQLVKHGEDVHPHQWFHQWUDODLUDQGDLUH[FKDQJH+DUGZRRGWLOHQHZFDUSHWQHZGRRUVDQGGHFNZLWKJODVVUDLOLQJ'RXEOHGHWDFKHGJDUDJH
ZLWKQHZVKLQJOHV
QG6W1:
7KLVVTXDUHIRRWEHGURRPKRPHLVYHU\WLG\DQGZHOO
PDLQWDLQHG+RPHIHDWXUHVODUJHEHGURRPVPDLQRRUXWLOLW\URRPDQGFHQWUDODLUFRQGLWLRQLQJ1HZVKLQJOHVPRVWO\QHZHUZLQGRZV
$SSOLDQFHVLQFOXGHG
VW6W1(0LQQHGRVD7KLVVTIWEXQJDORZKRPHLVORFDWHGLQDJUHDWDUHDDQGIHDWXUHVDIDPLO\URRPRIIWKHNLWFKHQODUJH
GLQLQJURRPDQGEDVHPHQWUHFURRP0DLQRRUEDWKZLWKMHWWHGWXEDQGSLHFHEDVHPHQWEDWK)RUFHGDLUJDVIXUQDFHFHQWUDODLUDQGZDWHUVRIWHQHU
'RXEOHGHWDFKHGJDUDJH
WK$YH6:9HU\VROLGVTIWEHGURRPEXQJDORZZLWKDIHQFHG\DUGDQG
WRZQYLHZ8SGDWHGZLQGRZVVLGLQJLQVXODWLRQQHZVKLQJOHVIHQFHDQGQHZODPLQDWHRRULQJ/RFDWHGRQDTXLHWVWUHHWFORVHWRVFKRRODQGGRZQWRZQ
/LYLQJLQ\RXU
&RPPXQLW\
VW$YH1:
*UHDWVWDUWHUKRPHQHDUVFKRRO6KLQJOHVVLGLQJDQGDOOZLQGRZVXSGDWHGVLQFH0DLQRRU
EHGURRPDQGEHGURRPVXSSHURRU/DUJHEULJKWNLWFKHQDQGODUJHOLYLQJ
URRPZLWKKDUGZRRGRRU%LJIHQFHG\DUG
1(:/,67,1*
6WUDWKFODLU6SDFLRXVEHGURRPKRPHRQODUJHORWLQ6WUDWKFODLU/DUJHHQWUDQFHOHDGVWRWKH
VSUDZOLQJHDWLQNLWFKHQZLWKDQDEXQGDQFHRIRDNFDELQHWV7KHGLQLQJURRPDQGVXQNHQOLYLQJURRPDUHYHU\
QLFHZLWKORYHO\ZRRGZRUNDQGKDUGZRRGRRULQJ7KHQLVKHG
EDVHPHQWKDVDVHFRQGNLWFKHQDQGFRXOGVHUYHDVDPRWKHULQODZVXLWH7KLVKRPHLVLQH[FHOOHQWFRQGLWLRQDQGKDVEHHQ
QLFHO\XSGDWHGWKURXJKRXW
'0LQQHGRVD%HDFK7KLVFR]\FRWWDJHDW0LQQHGRVD/DNHLVDUHDOFKDUPHU.LWFKHQVXQNHQOLYLQJ
URRPEHGURRPVDQGDSLHFHEDWKURRPDOODGGWRWKHOLYHDELOLW\7KHGHFNRYHUORRNVDVPDOO\DUGZLWKDUHSLW6XPPHUVDWWKHODNHFDQEH
DIIRUGDEOH
1(:/,67,1*
RECYCLING
aluminum brass zinc steel
e-waste lead
catalytic converters stainless steel
batteries copper
www.urbanmine.ca
204.774.0192
72 Rothwell RoadWinnipeg, MB
(1 block south of IKEA)
The trusted name inmetal recycling
We Do It All!Social Tickets, Raffle Tickets, Business
Cards, Receipt Books, Flyers, Posters,
Colour Copying
867-3816
Tribune Printing
7/27/2019 August9 2013.pdf
15/16
RESTAURANT
PRINTING
More than just a
Newspaper!
We offer a full line of
Custom Printing.
Posters, Brochures, Invoices,
Envelopes, Business Cards,
Letterhead, Tickets, Invitations
and MORE! We also provide
Colour Photocopying, Photo
Reproductions and Faxing.
Visit us at:
14 3rd Avenue S.W.
Minnedosa, MB
Monday - Friday
9 a.m. to 12 noon &
1 p.m. to 4 p.m.
Phone 867-3816
LEGAL
Alexander
Jackson
Law Office
B-116 Main St S
Minnedosa, MB
867-39
81htt
p
:
//
www.
aj
a
xl
aw.c
a
SIMS & COMPANYLaw Ofce
Norman H. Sims, Q.C.
76 Main Street South
MINNEDOSA t 867-2717
HANDYMAN
REAL ESTATE
Burgess Law
Office
51 Main Street S
Minnedosa
867-2935
INSURANCE
Drivers Licenses, AutopacGeneral Insurance
Bruce McNabb & Dave McDonald
867-3946
MINNEDOSA
INSURANCE SERVICES
WAHOSKIMECHANICAL LTD.
PLUMBING
HEATING
GAS FITTING
AIR CONDITIONING
204-867-3121or
204-476-5185
GORD KELLYPlumbing & Heating
Gas Fitting
ph: 867-2084
cell: 867-0346
SERVICES
T A C
Ventures Inc.
WasteManagement &
Contracting(204)476-0002
Garbage RemovalBin Rentals
Construction DemolitionRenovating
Household clean upEstate clean ups
The Minnedosa Tribune Friday, August 9, 2013 15
PAINTING
#6350/1"*/5*/(
.YRNA$HARLES)OME$ELL
ALCOHOLICSANONYMOUS
If you like to drink and canThat's your business
If you want to stop and can'tThat's our business.
P.O. Box 36or 867-3966
Alanon - 867-3308Alateen - 867-5121
867-3401 MinnedosaMtg. Times: 8:00 pm Tuesdays
MoodDisorders
Associationof Manitoba
Support GroupMeetings held at
Minnedosa Hospital Boardroomevery 2nd Tuesday of the monthat 6:30 p.m. For more info call:
Lora Hay 826-2773Connie Finlay 867-2556
L
L E
EO
O N
N A
A
S
SS
S T
T U
U D
D I
I O
O O
O F
F I
I M
M A
A G
G E
E
Family Hair Care
Family Hair Care
Wax
ingWax
ing Pedicures
PedicuresManicures
Manicures LCN Nails
LCN Nails
Pedique
Pedique Tanning
Tanning
Massage
Massage
867-2287
867-228767 Ma
in St.67 Ma
in St.
St. Alphonsus
Catholic Church142 4th St, NW.
Minnedosa, MB 867-3831
Mass Sunday 9:00 a.m.
142 4th St, NW.
Minnedosa, MB 8673831TRADING
FRONTIERTRADING STORE867-5551
Gently Used Furniture
Clothing & Misc. Items
Donations
Estate Sales
Pick-up & Deliveries
SERVICES
SELF-HELP
Drug Problem?Narcotics
Anonymous can help
Meetings every
Tuesday &
Saturday at 7 p.m.at Calvary Temple,
221 Hamilton Street,
Neepawa, MB
LakesideSeptic Service
Potable waterdelivery.
Book your portabletoilets.
Small tool rentals.Bryon Gaiser
867-2416Cell: 867-7558
CALL ME... FOR ALL YOUR
REAL ESTATE NEEDS
www.suttonharrison.com
PETER HARRISONPhone/Text 867-5444
JOHNSTONYARD CARE SERVICES
Lawn Mowing & Trimming
Yard Clean Up Aerating & Power Raking
Garden Tilling
Eavestrough Cleaning
Hedge Trimming
Small Branch Trimming
Window Washing
Other Odd Jobs
Cory Johnston Minnedosa
(204) 476-4705
www.johnstonyardcare.com
RAINKE'SSewage Service
JIM BEAUMONT476-2483
Owner/OperatorCell: 476-6591
Dennis: 476-2766
23 Hour Service
RANKIES
People Helping People
- Committed to Caring -
Phone (204) 857-6100
Fax (204) [email protected]
www.centralplainscancercare.com
SEPTIC
PLUMBING
MLA
LEANNE ROWAT, M.L.A.
Minnedosa
114 Main St. S.
Ofce Hours
Constituency
Ph: (204) 867-2297
Fax: (204) 867-3641
Winnipeg
Ph: (204) 945-0258
Fax: (204) 945-5921
Mon. - Fri.9:00 - 5:00
Riding Mountain Constituency
Written Quotes InsuredPremium Finishes
Book you winter jobs NOW!
Working Area:From Brandon to Clear Lake
Residential, Farm, Commercial Interior/ExteriorPowerWashing& Spray PaintingAvailable References Available
Need it Painted?Call T.H.E.M.!
Cell 204-868-8 088 Email: [email protected]
Cell 204-868-8 088 Email: [email protected]
!
GRAINHAULING
Ford FarmsCustom Grain Hauling
Call Mark at
204-867-0120
Book this spot$5.52/week
Call 204-867 3816
BookThisSpotforonly$13.74per
week!CREI
GHTON
S
Handyman ServiceInterior/Exterior
RenovationsCabinets, Countertops
All FlooringDrywall and Taping
Ceramic TileDecks, Fences, Garages
and More!
204-868-0382 BookThisSpotforonly$11.07per
week!
Essential ChoiceBody Balance
Registered Massage Therapy
Reiki Master/Teacher
Indian Head Massage
Pranic Healing & BodyTalk
2048673983
694 - 3 St. NE Minnedosa
DarwinMatthewsTV ANDAPPLIANCESALESAND SERVICE
Your Shaw Direct,LG, Samsung, Bell
Danby DealerComputer Sales and Service
Systems, Monitors &Accessories
Minnedosa, MB
Phone 867-3164
E-mail: [email protected]
Dari Isle
204-867-3601
Call for pick-upor dine in.
HomemadeBurgers!
Soft Ice Cream!
SALES
Fences, Decks,
Shingles & More
Pierre Sr. 2048680266
FULLY INSURED
SELF-HELP
Brian HornerGrain & Fertilizer
Hauling
204-867-7182
BookThisSpot
foronly$13.74per
week!
Book this spot$5.52/week
Call 204-867 3816
7/27/2019 August9 2013.pdf
16/16
16 Te Minnedosa ribuneFriday, August 9, 2013
2012 FORD F-150 XLT Super Cab 4x45.0L V8 Sweet!......$26,750
2013 Ford Escape SE AWDLeather and NAV.......$29,950
2012 Ford Taurus Limited AWDWOW! The Ultimate!....$27,995
2012Chevrolet Malibu LTA Treat to Drive.......$18,750
www.wilsonswheels.ca
204-867-2699
WK$YHQXH6:
0LQQHGRVD
&DOO3HWHU+DUULVRQ
13082aa00
Enrol today for full or part time in
the day, evening or by distance.
Classes begin September 2013
Mature Student High School204.725.8735
IS IT TIME TO
?
AUCTIONS
2 Day Estate Museum AuctionAug 17 & 18 Strathclair, MBHorse & Buggy Items, 7 Vin-tage Autos, Red Indian ins, 84
Years o collecting www.mey-ersauctions.com 204-476-6262.
AUTOMOTIVE
Guaranteed approval driveaway today! We lend money toeveryone. Fast approvals, bestinterest rates. Over 500 vehiclessale priced or immediate de-livery OAC. 1-877-796-0514.
www .y our app rov edo nl in e.com.
FINANCIAL SERVICES
MoneyProvider.com. $500Loan and +. No Credit Re-used. Fast, Easy, 100% Se-cure. 1-877-776-1660.
FOR SALE
A LAS! An iron flter thatworks. IronEater! Fully pat-ented Canada/U.S.A. Re-moves iron, hardness, smell,manganese. Since 1957. Visitour 29 innovative inventions:
www .b ig ir on dr il li ng .c om .Phone 1-800-BIG-IRON.
BAERIES FOR EVERY-
HING Automotive, arm,construction, AV, marine,cycle, gol carts, solar. Phones,tools, radios, computers, etc.Reconditioned, obsolete, andhard-to-fnd batteries. SOLARpanels, inverters, and acces-sories. Te Battery Man Wpg.1-877-775-8271 www.battery-man.ca
Restless Leg Syndrome & LegCramps? Fast Relie In OneHour. Sleep At Night. ProvenFor Over 32 Years. www.all-calm.com Mon-Fri 8-4 ES1-800-765-8660
SAVE! NEW! WRAPPED! NewBed Line - Queen Pillow-op Bed Set $395! (King set
$595.00) (6-piece BedroomSuite including Pillow-opBed set $900). 12 DrawerQueen Storage Bed $495! 5piece 42 round drop lea set$459. SOLID RUSIC OAK a-ble Set 60 to 96 (No Veneer)6-high back padded chairs$2,295 ($4,200 value)! Leather3-Piece Set! Soa, Love Seat &Chair. Sacrifce $1,495, Store
Value $3,100. (Can Separate)Call: 204-571-1971. Brandon.
MANUFACTURED HOMES
HOMES, COAGES & More.RMI - Ready to Move in. Call
1-888-733-1411; rtmihomes.com. Red ag Sale on now!
MOBILE HOMES
FAMILY WANED! New 2012SRI home 1672 sq.t. 3 bed-rooms, 2 baths, SS appliances& more. Can be re-located.$145,000. Glendale MobileHome Sales 204-724-7907
New 2013 SRI mobile homemodels AVS-20631 and AV-667 are now onsite or view-ing. Custom order your newhome now or all delivery.Glendale Mobile Home Sales,Brandon 204-724-7907
REAL ESTATE
Real Estate: Shoal Lake, MB.Last our exclusive gol courselots with all services at the ap-proach. Easy access to lake.Priced to sell $30,000. Phone204-365-7161.
STEEL BUILDINGS
SEEL BUILDINGS/MEALBUILDINGS 60% OFF! 20x28,30x40, 40x62, 45x90, 50x120,60x150, 80x100 sell or bal-ance owed! Call 1-800-457-2206 www.crownsteelbuild-ings.ca
Te amily o eenie Paster-shank would like to expressour heartelt gratitude to thepeople who provided supportat this di cult time. Your actso kindness through cards, owers, phone calls, gits oood are greatly appreciated.Special thanks to Fr. EmilKardasinec or his beauti-ul service, the pall bearers,cross bearer, Ernie Malchukand choir, alter server PeterMiko. Also thanks to RobertEwanyshyn or his violin soloo Amazing Grace during theinterment. Te church ladiesor preparing and serving thedelicious lunch. Te peoplethat took such good care oMom at the Sandy Lake Per-sonal Care Home. Specialthank you to the palliativecare ladies that stayed withmom when we couldnt bethere, you were all awesome.Tanks to Raes Funeral Ser-
vice or their kind and caringproessional services. Yourkindness will not be orgot-ten. ~ Edward, Sylvia, Helenand Ed, Mabel and Nick andfamilies. (x)
We would like to expressour heartelt thanks to every-one or all the lovely owers,cards, ood, visits and phonecalls at this di cult time inthe loss o our mom. Tank
you or your thoughtulnessand kindness, it is greatly ap-preciated and will always beremembered. God Bless all.~Nick and Mabel Stebeleski(x)
Our grateul thanks to am-ily, neighbours and riends orall o the thoughtul expres-sions o sympathy shown usduring and ater the loss oour beloved patriarch Har-old. Tanks to Erickson HomeCare and Regional PalliativeCare who made it possible
or amily to give our lovedone the care he needed.Tanks to Dr. Khandelwal orhis many years o proession-al care given Harold and toDr. Vipul and Mental Healthsta. T anks to all or themany words o comort that
will not be orgotten. ~Isa-bella Proven and family .
Te amily o Irene Daggwould like to thank the ol-lowing people or their kind-ness and support in the daysollowing her sudden pass-ing. Te sta at Minnedosahospital or the care o Ireneand our amily, and Natasha
Pearen or the spiritual careimmediately ollowing Irenespassing. Minnedosa FuneralServices or the proessionaland sensitive care in makingarrangements. o the Clan-
william ladies, thank you orthe wonderul lunch ollow-ing the uneral. o Elgin Hall,thank you or the support andbeautiul service to celebrateIrenes lie. o all who phonedor called in with ood and kind
words, your care and compas-sion is appreciated and willnot be orgotten. ~Sincerely,Donald Dagg and the Dagg,Little and Woodcock fami-lies
MCNA PROVINCE WIDE CLASSIFIEDS CARDS OF THANKS
myCommunityNeighbours Indeed
Be a Neighbour...And announce
these special eventsto your community
Birth of ChildWeddingWeddingAnniversaries
25th, 40th, 50th, 60thNew home residency
You may qualiy or apersonalized keepsakegit ofer complimentso local business andproessional sponsors
Minnedosa PharmacyGlenndosa Glass 1990 Ltd.
Minnedosa insurance ServicesBurgess Quality Foods
Integra TireHeritage Co-op
Minnedosa TribuneGateway Motel
Be part of your Community!
Contact Tillie Johnson204-867-3414