1. sp1_human x egr1_human October 10, 2001 10:50 .. . . . . . 526 RGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCG 575 | | | .: : | :: | : : :. | |:| |||::|| | | 327 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQC..RICM…

Slide 1Autoregulation of Th1-mediated inflammation by twist1 Uwe Niesner, Inka Albrecht, Marko Janke, Cornelia Doebis, Christoph Loddenkemper, Maria H. Lexberg, Katharina…

Slide 1Center for Biological Sequence Analysis Prokaryotic gene finding Marie Skovgaard Ph.D. student [email protected] Slide 2 Center for Biological Sequence Analysis Prokarya…

1.Transcriptional Gene Regulation in Eukaryotes 2. Overview  Gene expression  Transcription  Regulation of eukaryotic transcription  Influence of chromatin structure…

1. Zinc FingerTechnology(Review) Made By: Munish Chhabra Roll no-2K10/BT/008IVth Semester 2. Zinc Finger– Protein motif that forms a compact globularstructure that coordinates…

1. Dr. VARUN GOEL MEDICAL ONCOLOGISTRAJIV GANDHI CANCER INSTITUTE, DELHI 2. • In the 1950s, simultaneous efforts by FrenchandItalianresearchersledto thedevelopment of Daunorubicin.•…

ARTICLE IN PRESS Insect Biochemistry and Molecular Biology Insect Biochemistry and Molecular Biology 36 (2006) 353–365 www.elsevier.com/locate/ibmb Model reactions for…

New strategy for the viral protein structure predictions: “Consensus model” approach to take advantage of sequence diversity Introduction The viral surface proteins are…

Slide 1Emerging patterns of drug resistance and viral tropism in cART-naïve and failing patients infected with HIV-1 subtype C Thumbi Ndung’u, BVM, PhD Associate Professor…

Slide 1Comparative Genomics & Annotation The Foundation of Comparative Genomics Non-Comparative Annotation Three methodological tasks of CG Annotation: Protein Gene Finding…