Understanding Bioinformatics In memory of Arno Siegmund Baum Understanding Bioinformatics Marketa Zvelebil & Jeremy O. Baum Senior Publisher: Jackie Harbor Editor: Dom…

Slide 1Sequence motifs, information content, logos, and HMMs Morten Nielsen, CBS, BioCentrum, DTU Slide 2 Outline Multiple alignments and sequence motifs Weight matrices…

Slide 1Sequence Alignment and Phylogeny Dr Peter Smooker, [email protected] B I O I N F O R M A T I C S | | | | | | | B I O L O G Y - M A T H - S Slide 2 Uses of…

Bioinformatics I Sequence Analysis and Phylogenetics Winter Semester 2013/2014 by Sepp Hochreiter Institute of Bioinformatics, Johannes Kepler University Linz Lecture Notes…

Slide 1 Scoring the Alignment of Amino Acid Sequences Constructing PAM and Blosum Matrices Slide 2 Proteins are huge molecules made up of large numbers of amino acids. The…

Slide 1 Lecture invitation 8.4. 2015 AI, 14:30 (we will finish earlier this day, at 14:20) How Lab IT Accelerates Pharmaceutical Research For more information, see http://ich.vscht.cz/~svozil/teaching.html…

Sequence Alignment Goal: line up two or more sequences An alignment of two amino acid sequences: 123456789â¦. Seq1: HKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKP…

Molecular evolution, cont. Comparing estimation methods. Application to human and mouse sequences Lecture 16, Statistics 246 March 16, 2004 The resolvent method Müller and…

Computational searches of biological sequences Conceptos básicos Homología y otras relaciones evolutivas (paralógos, ortólogos, xenólogos) Uso preferencial de codones,…

Tutorial 4 Substitution matrices and PSI-BLAST * Agenda Why study distant homologies? Substitution Matrices PAM - Point Accepted Mutations BLOSUM - Blocks Substitution Matrix…