PSZ 19:16 (Pind. 1/07)
UNIVERSITI TEKNOLOGI MALAYSIA
DECLARATION OF THESIS / UNDERGRADUATE PROJECT PAPER AND COPYRIGHT
Author’s full name :
Date of birth :
Title :
Academic Session:
I declare that this thesis is classified as:
I acknowledged that Universiti Teknologi Malaysia reserves the right as follows:
1. The thesis is the property of Universiti Teknologi Malaysia.
2. The Library of Universiti Teknologi Malaysia has the right to make copies for the purpose
of research only.
3. The Library has the right to make copies of the thesis for academic exchange.
Certified by:
SIGNATURE SIGNATURE OF SUPERVISOR
(NEW IC NO. /PASSPORT NO.) NAME OF SUPERVISOR
Date : Date :
NOTES : * If the thesis is CONFIDENTAL or RESTRICTED, please attach with the letter from
the organization with period and reasons for confidentiality or restriction.
√
CONFIDENTIAL (Contains confidential information under the Official Secret
Act 1972)*
RESTRICTED (Contains restricted information as specified by the
organization where research was done)*
OPEN ACCESS I agree that my thesis to be published as online open access
(full text)
ALI ADEL DAWOOD
1st NOVEMBER 1966
CLONING OF INFLUENZA B NS1 GENE IN Escherichia
THE EFFECT OF ETHNO/LINGO DIVERSITY ON coli
2009/2010
S2925947 DR. CHAN GIEK FAR
3rd
DECEMBER 2010 3rd
DECEMBER 2010
“I hereby declare that I have read this thesis and in my/our
opinion this thesis is sufficient in terms of scope and quality for the
award of the degree of Master of Science (Biotechnology)”.
Signature : .....................................................................
Name of Supervisor : Dr. CHAN GIEK FAR
Date : 3rd DECEMBER 2010
i
CLONING OF INFLUENZA B NS1 GENE IN Escherichia coli
ALI ADEL DAWOOD
A dissertation submitted in partial fulfillment of the
requirements for the award of the degree of
Master of Science (Biotechnology)
FACULTY OF BIOSCIENCES AND BIOENGINEERING
UNIVERSITI TEKNOLOGI MALAYSIA
NOVEMBER 2010
ii
Hereby, I declare that this thesis entitled “Cloning of influenza B NS1 gene in
Escherichia coli” is the result of my own research except as cited in the
references. The thesis has not been accepted for any degree and is not
concurrently submitted in candidature of any other degree.
Signature : ................................
Name : Ali Adel Dawood
Date : 3rd
DECEMBER 2010
iii
To my beloved parents& my wife;
Thanks for the dim of light when all I see were darkness…
Thanks for giving me the best things in my life …and finally
Thanks for your sacrifices to make me a better person each day….
iv
ACKNOWLEDGEMENT
In the Name of Allah, the Most Benevolent, Most Merciful
Firstly, I thank Allah for giving me the patience, persistency and his
blessings throughout my completing this project. I would like to express my
utmost gratitude and special appreciation to my supervisor Dr. Chan Giek Far,
for encouragement, guidance, support, advices and care helped me in all the
time of research and writing of this thesis.
I am deeply indebted and grateful to my family especially my mother,
father and my wife for their love, support and praying for my success in every
time, their patience and kindness in helping and guiding me in every part of this
project. No word can express my appreciation for their love.
Special thanks to all the staffs of the Faculty of Biosciences and
Bioengineering and members of the labs for not only helping me with my study
but also making my stay in the lab a very pleasurable and memorable one.
Sincere appreciation and thanks are also extended to all staff of Mosul
College of Medicine especially members of the Department of Anatomy for
their encouragement, guidance, advices even in some words.
Last but not least, I would like to thank to people and everyone who has
helped me direct or indirectly towards completing this research project.
v
ABSTRACT
The non-structural NS1 protein of influenza B virus is a multi-
functional virulence protein which is involved in the transport of viral RNA.
Inside the host cell, NS1B antagonizes and inhibits the α/β interferon system
which is induced as host antiviral response. Moreover, it prevents the activation
of double-stranded-RNA activated protein kinase (PKR) by binding to dsRNA
and inhibits the maturation of GAS8 (gene of tumor suppressor). NS1 protein is
utilized as a target for diagnostic of influenza viruses in infected animals.
pUC57 carrying NS1 synthetic gene of influenza B was attempted to be
transformed into Escherichia coli strain BL21(DE3). NS1B was extracted and
attempted to be cloned into prokaryotic expression vectors pET-32b, pET-32a,
pQE-81L and pQE-80L, respectively using restriction digestion enzymes (SacI,
PstI and HindIII). Then, recombinant DNA was attempted to be transformed
into Escherichia coli strains BL21(DE3) and DH5α.
vi
ABSTRAK
Protein non-struktur NS1 virus influenza B adalah virulensi pelbagai
fungsi dan terlibat dalam pengangkutan RNA virus. Di dalam sel perumah,
NS1B menghalang sistem interferon α/β yang menyebabkan tindakbalas
antivirus oleh perumah. Selain itu, protein NS1 mencegah pengaktifan double-
stranded RNA-aktif protein kinase (PKR) dengan cara mengikat dsRNA dan
menghalang pematangan GAS8 (gen tumor supresor). NS1 protein digunakan
sebagai target untuk diagnostik terhadap virus influenza pada haiwan yang
dijangkiti. pUC57 membawa gen NS1 sintetik influenza B diklonkan ke dalam
Escherichia coli strain BL21(DE3). NS1B diekstraksi dan diklon ke vektor
ekspresi prokariotik pET-32b, PET-32a, pQE-81L dan pQE-80L masing-
masing dengan menggunakan enzim pembatas (SacI, PstI dan HindIII).
Kemudian DNA rekombinan ditransformasikan ke dalam strain Escherichia coli
BL21 (DE3) dan DH5α.
vii
TABLE OF CONTENTS
CHAPTER TITLE PAGE
DECLARATION ii
DEDICATION iii
ACKNOWLEDGEMENTS iv
ABSTRACT v
ABSTRAK vi
TABLE OF CONTENTS vii
LIST OF TABLES xii
LIST OF FIGURES xiv
LIST OF SYMBOLS/ABBREVIATIONS xvi
LIST OF APPENDICES
xix
1 INTRODUCTION 1
1.1 Influenza 1
1.2 Influenza virus 1
1.3 Problem statement of the study 2
1.4 Objective of the study 2
1.5 Scope of the study 3
1.6 Significant of the study 3
2 LITERATURE REVIEW 4
2.1 Overview of influenza 4
2.1.1 Influenza infection 4
viii
2.1.2 Treatment 6
2.1.3 Preventative measures for human
Influenza virus 7
2.1.4 Isolation of influenza virus 7
2.2 Influenza virus 8
2.2.1 Viral genome 8
2.2.2 Types of influenza virus 8
2.2.3 Lifecycle of influenza virus 10
2.3 Influenza B virus 11
2.4 Nonstructural (NS1) protein 14
2.4.1 Nonstructural protein NS1 of
Influenza B virus 15
2.4.2 function and influences of NS1
protein 17
2.4.2.1 NS1B binds to ISG-15
protein 18
2.4.2.2 NS1B inhibits and antagoni-
-sts α/β interferon system 19
2.4.2.3 NS1 inhibits nuclear export
of mRNA 21
2.4.2.4 NS1 protein interacts with
GAS8 22
2.4.2.5 NS1 protein inhibits pre-
mRNA 23
2.4.2.6 NS1 protein prevents
activation of PKR 24
2.5 Previous studies of cloning and expression
of NS1 gene 25
3 MATERIALS AND METHODS 29
3.1 Experimental Design 29
ix
3.2 Materials 35
3.2.1 Bacterial strains 35
3.2.2 Chemicals 35
3.2.3 pET vectors 35
3.2.4 pQE vectors 37
3.2.5 NS1B Synthetic Gene 38
3.3 Methods 40
3.3.1 Liquid and solid media preparation 40
3.3.1.1 Luria Bertani agar and
broth 40
3.3.1.2 Preparation of ampicillin
stock solution 40
3.3.2 Preparation of competent cells 41
3.4 Transformation pUC57-NS1B into E. coli
BL21(DE3) competent cells 41
3.5 Isolation of pUC57-NS1B plasmid 42
3.6 Agarose gel electrophoresis 43
3.7 Isolation of pET-32b plasmid 44
3.8 Single digestion 44
3.9 DNA Extraction 44
3.10 Determination of DNA concentration 45
3.11 Ligation NS1B with pET-32b 46
3.12 Transformation of recombinant product 46
3.13 Isolation of pQE-81L plasmid 47
3.14 Amplification of NS1B gene using
Polymerase Chain Reaction (PCR) 47
3.14.1 Primer design 47
3.14.2 Polymerase chain reaction 48
3.15 Double digestion using PstI and HindIII
restriction enzymes in one step 49
3.16 Double digestion using restriction
x
enzymes in two steps 50
3.17 Ligation and transformation into DH5α 51
3.18 Screening of positive colonies 52
3.18.1 Chelex 100 extraction method 52
3.18.2 PCR amplification and gel
electrophoresis to detect NS1B 53
3.19 Isolation of pET-32a plasmid 53
3.20 Amplification of NS1B gene using
Polymerase Chain Reaction (PCR) 54
3.20.1 Primer design 54
3.21 Double digestion using SacI and HindIII
restriction enzymes in one step 55
3.22 Double digestion using SacI and HindIII
restriction enzymes in two steps 55
3.23 Ligation, transformation into E. coli BL21
(DE3) and and screening of colonies 57
3.24 Isolation plasmid (pQE-80L) 57
3.25 PCR amplification, double digestion,
ligation, transformation into DH5α and
screening of colonies 58
4 RESULTS AND DISCUSSION 59
4.1 Transformation of pUC57-NS1B into
E. coli BL21(DE3)
4.2 Cloning of pET-32b-NS1B into E. coli
59
BL21(DE3) 59
4.3 Cloning of pQE-81L-NS1B into E. coli
DH5α 61
4.4 Cloning of pET-32a-NS1B into E. coli
BL21(DE3) 65
4.5 Cloning of pQE-80L-NS1B into E. coli
xi
DH5α 68
4.6 Confirmation of ligation 69
5 CONCLUSION AND FUTURE WORKS 71
5.1 Conclusion 71
5.2 Future works 72
REFERENCES 74
Appendices A-B 79-80
xii
LIST OF TABLES
TABLE NO. TITLE PAGE
3.1 Single digestion components in PCR tube
using HindIII 44
3.2 Ligation mix components of pET-32b and
NS1B 46
3.3 The pUC57 primers for PCR of NS1B gene
from pUC57-NS1B 48
3.4 PCR reaction components of pUC57-NS1B 48
3.5 PCR cycle 49
3.6 Double digestion components in PCR tube
using PstI and HindIII 50
3.7 Double digestion components in PCR tube
using HindIII(1st step) 50
3.8 Double digestion components in PCR tube using
PstI(2nd
step) 51
3.9 The pQE primers for PCR 53
3.10 Primers containing SacI and HindIII restriction
enzyme sites used to amplify NS1B gene 54
3.11 Double digestion components in PCR tube
using SacI and HindIII 55
3.12 Double digestion components in PCR tube using
HindIII(1st step) 56
xiii
3.13 Double digestion components in PCR tube using
SacI(2nd
step) 56
3.14 Primers containing SacI and HindIII restriction
enzyme sites used to amplify NS1B gene 57
xiv
LIST OF FIGURES
FIGURE NO. TITLE PAGE
2.1 Life cycle of influenza virus 10
2.2 Influenza virus structure 11
2.3 Electron microscope image of influenza B 13
2.4 Influenza virus particles on cells lining 14
2.5 Homology modeling of RNA binding domain
of NS1B 16
3.1 Flow chart of experimental design 30
3.2 Cloning of pET-32b-NS1B into E. coli
BL21(DE3) 31
3.3 Cloning of pQE-81L-NS1B into E. coli DH5α 32
3.4 Cloning of pET-32a-NS1B into E. coli
BL21(DE3) 33
3.5 Cloning of pQE-80L-NS1B into E. coli DH5α 34
3.6 pET-32 vectors 36
3.7 pQE-80L vector 37
3.8 pQE-81L vector 38
3.9 pUC57-NS1B gene construct 39
4.1 Restriction digestion by HindIII. 60
4.2 Transformation of pET-32b-NS1B into
competent E. coli BL21(DE3) 61
4.3 Plasmid isolation and digestion of pUC57-
xv
NS1B and pQE-81L 62
4.4 PCR amplification of NS1B 63
4.5 Transformation of pQE-81L-NS1B into
competent DH5α 64
4.6 PCR of recombinant pQE-81L-NS1B 65
4.7 Miniprep of pUC57-NS1B and PCR
amplification of NS1B 66
4.8 Transformation of pET-32a-NS1B into
competent E. coli BL2(DE3) 67
4.9 PCR of recombinant pET-32a-NS1B 67
4.10 Transformation of pQE-80L-NS1B into
competent DH5α 68
4.11 PCR of recombinant pQE-80L-NS1B 69
4.12 PCR amplification 70
xvi
LIST OF SYMBOLS/ ABBREVIATIONS
AMP - Adenosine monophosphate
ATP - Adenosine triphosphate
bp - Base pairs
BSA - Bovine Serum Albumin
α/β - Alfa / Beta interferon
˚C - Degree Celsius
cDNA - Clone deoxyribonucleic acid
del NS1 - Deletion nonstructural 1
dH2O - Deionized water
dNTP - Deoxynucleoside triphosphate
DNA - Deoxyribonucleic acid
dsRNA - double-stranded RNA
E. coli - Escherichia coli
EDTA - Ethylene diamenetetraacetate
ELISA - Enzyme linked immunosorbent assay
g - Gram
GAS - Growth arrest specific gene
GST - Glutathione S-transferase
HA - Hemagglutinine
His-Tag - Histidine tagged
IFN - Interferon
IPTG - Isopropyl β-D-1-thiogalactopyranoside
IRF - Interferon regulator factor
xvii
ISG - Interferon stimulate gene
kb
KDa
-
-
Kilo base
Kilo dalton
LB - Luria Bertani
LPAI - Low pathogenicity avian influenza
M - Molar
mM - Milmolar
MCS - Multi cloning site
ml - Milliliter
mg - Milligram
min. - Minutes
µg - Microgram
µl - Microliter
µm - Micromter
MgCl2 - Magnesium chloride
mRNA - Messenger ribonucleic acid
NA - Neuraminidase
NEP - Nuclear export protein
NES - Nuclear export sequence
ng - Nanogram
NLS - Nuclear localization sequence
NMR - Nuclear Magnetic Resonance
NS1 - Nonstructural 1
OD - Optical density
PACT - Protein activator of the interferon-induced protein
kinase
PCR - Polymerase chain reaction
PKR
RNA
-
-
Protein kinase
Ribonucleic acid
xviii
RNP - Ribonucleoprotein
rpm - Rotation per minute
RT-PCR - Reverse transcription polymerase chain reaction
SDS-PAGE - Sodium Dodecyl Sulphate- Polyacrilamide Gel
Electrophoresis
sec. - Seconds
SIV - Simian immunodeficiency virus
ssRNA - Single strand RNA
TAE - Tris-acetate-EDTA
Tris
U6 SnRNA
-
-
2-hydroxymethyl-2-methyl-1,3-propanediol
U6 small nuclear ribonucleoprotein
UV - Ultraviolet
V - Volts
xix
LIST OF APPENDICES
APPENDEX TITLE PAGE
A NS1B gene sequence (870 bp) of Influenza B virus
(B/Taiwan/45/2007)
79
B NS1B protein sequence (281 amino acids)
80
1
CHAPTER 1
INTRODUCTION
1.1 Influenza
Influenza is a contagious respiratory viral illness of global importance.
The disease was caused by influenza viruses known as flu. The most common
symptoms of the flu are chills, fever, sore throat, muscle pains, severe headache,
coughing, weakness and general discomfort. Some influenza viruses can cause
more severe diseases than the common cold like pneumonia. Influenza viruses
spread around the world and can be transmitted through the air by coughs,
sneezes, creating aerosols containing the virus. This can also be transmitted by
direct contact with infected animals or humans (Metreveli et al., 2006; Spickler et
al., 2009).
1.2 Influenza virus
Influenza viruses have unique features of reverse sense single strand
RNA. They have been classified into three distinct types: A, B and C. Influenza B
viruses are mainly found in humans. These viruses can cause epidemics in human
populations, but have not been responsible for pandemics. Influenza B viruses
2
comprised of single group of hemagglutinin and neuraminidase antigens since
their first isolation in 1940 (Nerome et al., 1998). Influenza B viruses are
categorized into lineages rather than subtypes and are also classified into strains.
Influenza B viruses undergo antigenic drift, though it occurs more slowly than in
influenza A viruses (Metreveli el al., 2006; Spickler et al., 2009). Twelve
antigenic variants were distinguished by a panel of monoclonal antibodies
appeared to circulate in the 1981–1982 epidemic season in Japan. The
evolutionary lineages of influenza B viruses since 1988 have been represented by
two epidemic strains B/Victoria/2/87 and B/Yamagata/16/88 (Nerome et al.,
1998).
1.3 Problem statements of the study
The main problem of this study is to clone NS1B gene in pET-32b, pET-
32a, pQE-81L, and pQE-80L vectors for transformation into Escherichia coli
BL21(DE3) and DH5α.
1.4 Objective of the study
The objective of this research was to clone of NS1B synthetic gene into
pET-32b, pET-32a, pQE-81L, and pQE-80L vectors. The recombinant constructs
were transformed into E. coli hosts.
3
1.5 Scope of the study
The scope of this study encompassed the cloning of NS1B gene of
influenza B into pET-32b, pET-32a, pQE-81L, and pQE-80L vectors, which are
subsequently transformed into competent E. coli BL21(DE3) and DH5α.
1.6 Significant of the study
Recombinant NS1 fusion protein of high purity is more significant for
detection of antigenicity. Successful cloning and overexpression of NS1 gene are
useful for specific diagnostic and further applications. This reverse genetic system
will allow studies to explore the functions of NS1B domains during the
replication cycle and to assess their contributions to the pathogenesis and
virulence of influenza B virus.
4
CHAPTER 2
LITERATURE REVIEW
2.1 Overview of influenza
2.1.1 Influenza infection
Historically, Influenza A is responsible for occasional pandemics
affecting millions of people worldwide. It’s often associated with considerable
morbidity and mortality. During the years 1918-1920, influenza virus caused one
of the most destructive disease outbreaks in world history and later become
known as the Spanish flu pandemic. It resulted in the death of an approximately
50-100 million people thus, this influenza pandemic killed more people than the
World War 1 (Metreveli et al., 2006).
Since, the diseases occurred in the United States in 1924-1925, and then
emerged in 1929 in a much milder form. This virus continued to circulate in
humans until 1957. It was then replaced by another human influenza virus called
the Asian flu virus. Pandemic influenza A viruses emerged three times during the
last century: in 1918 (H1N1 subtype), in 1957 (H2N2), and in 1968 (H3N2).
5
Currently both H3N2 and H1N1, a late fifties variants that re-appeared in 1977and
remained co-circulate in humans (Metreveli et al., 2006).
Influenza B can also cause similar symptoms as Influenza A, but
generally in a milder form. Influenza C viruses infect mammals only and
generally without cause disease. They are genetically distinct from A and B types
(Metreveli et al., 2006).
The human influenza viruses are transmitted from person to person.
Infected adults usually begin to shed influenza A viruses the day before the
symptoms appear, and are infectious for 3-5 days after initial signs. Young
children can shed virus up to six days before, and 10 days or more after they
become ill. Severely immunocompromised individuals may remain infectious for
weeks or months. Humans can transmit influenza viruses to ferrets, and
occasionally to swine and rare cases from person-to-person spread, including a
localized outbreak among recruits at a military base which have been reported in
humans infected with swine influenza viruses. No cases of sustained transmission
have been reported in humans infected with the avian influenza viruses. Fecal
shedding of the avian H5N1 virus has been documented in a child with diarrhea.
Transmission of this virus across the placenta may also be possible (Spickler et
al., 2009).
In poultry, there are two forms of disease. Low pathogenicity avian
influenza (LPAI) viruses generally cause asymptomatic infections and mild
respiratory. High pathogenicity avian influenza (HPAI) viruses cause severe
disease that can kill up to 90-100% of a poultry flock. The severity of zoonotic
avian influenza varies with the virus. Generally, avian influenza viruses do not
spread efficiently in mammals, and infections remain limited to individual
animals or small groups (Spickler et al., 2009).
6
Other avian influenza viruses can also undergo cross-species
transmission. LPAI H9N2 viruses have become endemic in poultry in parts of
Asia and the Middle East may be of particular concern. Recently, they were found
in pigs with respiratory disease and fatal paralysis in China. In addition, H9N2
viruses have been infected humans. As of January 2009, human H9N2 infections
have been significantly less severe than those caused by avian HPAI H5N1
viruses. Epidemics occur every few years, due to small changes in the influenza
viruses. Human pandemics, resulting from antigenic shifts, were most recently
reported in 1918, 1957 and 1968 (Spickler et al., 2009).
2.1.2 Treatment
Antiviral drugs are available for influenza treatment in the United States.
Amantadine and rimantadine (adamantanes) are active against human influenza A
viruses, if treatment begun within the first 48 hours. Zanamivir and oseltamivir
are used effective for both influenza A and influenza B. Treatment usually results
in milder symptoms and recovery one day sooner. Side effects including
neuropsychiatric events may appear. Drug resistance develops rapidly in viruses
exposed to amantadine or rimantadine and may emerge during treatment. For
example, during the 2006-2008 flu seasons, human influenza viruses circulating
in the United States and Canada exhibited high resistance to amantadine and
rimantadine. Laboratory studies have shown that influenza viruses can also
become resistant to zanamivir and oseltamivir. However, this appears to be less
common than resistance to adamantanes (Spickler et al., 2009).
7
2.1.3 Preventative measures for human influenza viruses
An annual vaccine is available for influenza A and B. Both inactivated
(injected) and live (intranasal) vaccines may available. The vaccine is given in the
fall before the flu season. It contains the viral strains which are most likely to
produce epidemics during the following winter, and is updated annually (Spickler
et al., 2009).
2.1.4 Isolation of influenza virus
Human influenza A and influenza B infections can be diagnosed by virus
isolation, detection of antigens or nucleic acids, or retrospectively by serological
test. The viruses can be isolated in cell lines or chicken embryos, and also can be
identified by hemagglutination inhibition tests. Antigens can be detected in
respiratory secretions by immunofluorescence or enzyme-linked immunosorbent
assays (ELISA). Commercial rapid diagnostic test kits such as (Directigen® Flu A
test) can provide a diagnosis within 30 minutes. Reverse transcription polymerase
chain reaction (RT-PCR) techniques are also available; besides the serological
tests which include complement fixation, hemagglutination inhibition and
immunodiffusion. A rising titer is necessary to diagnose human influenza when
using serological tests. RT-PCR can be used for the diagnosis of influenza C and
avian influenza viruses (Spickler et al., 2009).
8
2.2 Influenza virus
2.2.1 Viral genome
The viral genome consists of eight segments of reverse single stranded
RNA or called negative polarity. A total of 11 known proteins are encoded by the
genome. The three largest segments (1, 2 and 3) encode polymerase proteins,
PB1, PB2 and PA that are responsible for RNA synthesis. Segment numbers 4 and
6 encode surface proteins which are hemagglutinin (HA) and neuraminidase (NA)
that are involved in attachment to the host cell and fusion between the viral
envelope and cellular membrane, and release of virus particles. The 5th segment
encodes a nucleoprotein (NP) that protects the viral RNA, but also has other
functions. The 7th segment encodes the M1 and M2 proteins. M1 is a matrix
protein that covers the inner surface of the viral membrane. The last segment
encodes two proteins: non-structural protein 1 (NS1) and nuclear export protein
(NEP). NS1 and NEP are involved in various aspects in the process of taking over
the host cell (Metreveli et al., 2006).
2.2.2 Types of influenza virus
Influenza viruses have been classified into three distinct types A, B and
C. Influenza viruses are found in a number of species including birds, swine,
horses, dogs beside humans. Influenza A viruses include the avian, swine, equine
and canine influenza viruses, as well as the human influenza A viruses. Influenza
A viruses were classified into subtypes based on two surface antigens, the
hemagglutinin (H) and neuraminidase (N) proteins. There are 16 hemagglutinin
antigens (H1 to H16) and nine neuraminidase antigens (N1 to N9). These two
9
proteins are involved in cell attachment and release virions from cells, and are
also major targets for the immune response. Limited subtypes are found in each
species of mammal. Influenza A viruses were also classified into strains. Strains
of influenza viruses are described as their types, hosts, place of first isolation,
strain number, year of isolation, and antigenic subtype. For example, the
prototype strain of the H7N7 subtype of equine influenza virus which first was
isolated in Czechoslovakia in 1956 is A/eq/Prague/56 (H7N7) (Spickler et al.,
2009).
Limited information is available on the subtypes found in other species
of birds. Subtypes that have been found in ratites include H3N2, H4N2, H4N6,
H5N1 H5N2, H5N9, H7N1, H7N3, H9N2, H10N4 and H10N7. Isolates from
cage birds usually contain H3 or H4. However, infections with high pathogenicity
subtypes containing H7 or H5 can also occur (Spickler et al., 2009).
Human influenza A viruses are mainly found in humans, and they can
also infect ferrets and sometimes swine. Experimental infections have been
reported in raccoons. Human viruses can also replicate in the nasal epithelium of
experimentally infected horses. H1N1, H1N2 and H3N2 viruses are currently in
general circulation in humans. The H1N2 viruses appeared most recently. These
viruses were first seen in human populations in 2001, probably as a result of
genetic reassortment between the H3N2 and H1N1 viruses. H2N2 viruses
circulated in the human population between 1957 and 1968 (Spickler et al., 2009).
Influenza C viruses are not classified into subtypes, but are classified
into strains. Each strain is antigenically stable, and accumulates few changes over
time (Spickler et al., 2009).
10
2.2.3 Lifecycle of influenza virus
Life cycle of influenza virus is started through attachment to sialic acid
receptor of the host cell. However, strains vary in their affinities for different
sialyloligosaccharides. Hemagglutinin is a viral glycoprotein binds to the cell
receptor sialic acid. The virus receptor bound is taken into the cell by endocytosis.
Viral envelope fuses with the lipid bilayer of the vesicle and releasing the viral
ribonucleoprotein (RNP) into the cell cytoplasm. Then RNP is transported into the
nucleus. New viral proteins are translated from transcribed mRNA and the viral
RNA is replicated from the negative stranded templates. The new viral RNA is
encapsidated by the nucleoprotein and transported to the cell surface where
envelope hemagglutinin and neuraminidase components are incorporated from the
cell membrane. Progeny virion is formed and then released from the cell by
budding (Metreveli el al., 2006).
Figure 2.1 Life cycle of influenza virus (Metreveli el al., 2006)
11
2.3 Influenza B virus
Influenza B virus is an envelope virus, belonging to the family
Orthomyxoviridae. It contains 8 segments of negative sense single-stranded RNA
virion (Palese et al., 2007). Until now, it is still unknown why influenza B does
not have many natural hosts like influenza A and can be antigenily drifted (Hai et
al., 2008). Influenza B viruses have only one subtype and evolve under three
major lineages: B/Lee/40virus like variants, B/Victoria/2/87- like variants and
B/Yamagata/16/88- like strains (Nerome et al., 1998; Hai et al., 2008).
Figure 2.2 Influenza virus structure
(http://micro.magnet.fsu.edu/cells/viruses/influenzavirus.html)
Influenza B viruses comprised of a single group of hemagglutinin and
neuraminidase antigens since the first isolation in 1940. For this difference, it has
been shown that numerous influenza A viruses circulate in wild and domestic
12
animals such as wide variety of bird species, swine, equine, seals, whales and
mink. Indeed, since has reported in early 1970s. This is in sharp contrast that
influenza B viruses have not been isolated from animals other than humans. These
differences in epizootic background may lead to evidence that influenza B viruses
have no antigenic shift observed (Nerome et al., 1998).
Despite the lack of antigenic shift, a number of antigenic variants of B
viruses have been isolated during periods of widespread influenza virus activity
since its first isolation in 1940. Particularly, it is noteworthy that a higher number
of monoclonal variants of influenza B viruses have been detected in the same
epidemic season than influenza A viruses. For example, twelve antigenic variants
distinguished by a panel of monoclonal antibodies appeared to circulate in the
1981–1982 epidemic seasons in Japan. Thus, evolution of influenza B virus is
definitely characterized by coexistence of several antigenic variants in the same
epidemic period of influenza A virus in which a single dominant virus
predominates in a single epidemic period (Nerome et al., 1998).
The first demonstrated of influenza B viruses have evolved in multiple
lineages which can cocirculate for considerable periods of time. The continuing
analysis of recent epidemic viruses from evolutionary point of view showed that
there have been two distinct lineages of influenza B viruses since 1988, being
represented by the two epidemic strains B/Victoria/2/87 and B/Yamagata/16/88,
respectively. The evolutionary rate of influenza B viruses was reported to be
lower than of human influenza A viruses. It is still uncertain why the former virus
is able to survive for a long period of time without antigenic drift in the
hemagglutinin glycoprotein (Nerome et al., 1998).
Common cold is caused by influenza B and is milder than type A
viruses. However, some cases lead to severe diseases but rarely morbidity
(Spickler et al., 2009). Most virion segments encode structural protein from
reverse RNA. On the other hand, the segment number 8 encodes nonstructural
13
proteins typically 890 nucleotides which encode for two different proteins:
nonstructural protein NS1 (26 KDa) and nuclear export protein NEP (11 KDa)
which was previously known as NS2 (Spickler et al., 2009, Palese et al., 2007).
Until now, it is still uncertain why former virus is able to survive for a
long period time without antigenic drift. Recently, antigenic analysis along with
investigation of genomic structure, systematic deletion and insertion mutations
have occurred in the same nucleotide regions of hemagglutinin molecule of
influenza B viruses (Nerome et al., 1998).
Figure 2.3 Electron microscope image of influenza B
(http://www.wellcome.ac.uk/Education-resources/Teaching-and-education/Big-
Picture/All- issues/Epidemics/WTD028128.htm)
14
Figure 2.4 Influenza virus particles on cells lining
(http://www.wellcome.ac.uk/Education-resources/Teaching-and-education/Big-
Picture/All- issues/Epidemics/WTD028128.htm)
2.4 Nonstructural (NS1) protein
Influenza NS1A protein consists of 230-237 amino acids, which are
divided into two major domains: N-terminal RNA-binding domain, which
comprises the first 73 amino acids residues forming symmetric homodimer
insolution. On the contrary, the influenza NS1B protein comprises of 281 amino
acids. The first 93 amino acids is N-terminus. This domain is responsible for
15
binding with nucleolin. Other domain is located in C-terminal of protein body.
This domain is known as an effector domain which interacts with many viral and
cellular factors. It involves in translation and post-transcriptional processing of
RNA (Manasatienkij et al., 2008).
NS1 protein persists only in the infected animal cells and not in
vaccinated animals, so that, these vaccinated animals are not producing NS1
protein specific antibodies and this is allows differentiation between vaccinated
and natural infected animals (Fang-kun et al ., 2008). Hence, this may path the
way of utilizing NS1 protein as a target for diagnostic of influenza viruses.
The crystal structure of the NS1B protein has not yet been solved.
Computer modeling based on the crystal structure of the N-terminal domain of the
NS1A protein has been allowed alignment of the N-terminal RNA-binding
domains of the two proteins, which are thought to possess similar α-helical
structures (Donelan et al., 2004).
2.4.1 Nonstructural protein NS1 of influenza B virus
The RNA-binding domain (N-terminus domain) of the NS1B protein is
93 amino acids in length and thus 20 amino acids larger than that of the NS1A
protein. The RNA binding domain has a molecular weight of approximately 22.7
KDa and the three-dimensional structure has not yet been determined.
Nonetheless, sequence alignment of the RNA-binding domains of the NS1A and
NS1B proteins suggested that the RNA binding domain of the NS1B protein
exhibits a dimeric six-helical chain fold similar to that of the NS1A protein,
except that there are large loops between the three α- helices in each chain (Yuan
et al., 2002).
16
The three-dimensional structure of the NS1B (1-93) RNA-binding
domain is based on NMR solution structure of the NS1A (1-73) RNA-binding
domain and a sequence alignment of NS1A. The large surface loops between the
α-helices in the NS1B model contain 21 amino acids residues. Because these
loops appear as insertions in the sequence alignment, these amino acids are left
unconstrained in the structure calculations, so that homology modeling approach
does not predict a specific structure for these loops. The ribbon representations of
the predicted structure of NS1B (1-93) were shown in (Fig. 2.5). The loop 1
(residues 24–36) of polypeptide chain 1 is located between the N and C-terminus
domain respectively, of the chain 2. Loop 2 (residues 64–71) of polypeptide chain
1 is located near the N-terminus of the same chain, and by symmetry loop 2 of
chain 2 is located near the N-terminus of chain 2 (Yuan et al., 2002).
Figure 2.5: Homology modeling of RNA binding domain of NS1B
R53, R50, R53׳and R50׳ are the RNA binding residues (Yuan et al., 2002)
17
2.4.2 Functions and influences of NS1 protein
Previous studies suggested two nonexclusive explanations for the strong
general impact of the NS1B gene deletion on viral replication. First, the NS1B
protein may play an important role in counteracting the activity of antiviral gene
products that are expressed in Vero cells in an IFN-independent manner. A second
possible explanation for restriction of the NS1B virus in Vero cells might be a
critical contribution of the NS1B protein to the principal viral replication process
rather than an effect on the host cell (Dauber et al., 2003).
The nonstructural NS1A protein (26 KDa) of influenza virus has been
shown to enter and accumulate in the nucleus of virus-infected cells
independently of any other influenza viral protein (Greenspan and Palese, 1988).
NS1A contains two nuclear localization sequences (NLS1 and NLS2), and a
nuclear export sequence (NES). A nucleolar localization sequence (NoLS) has
been reported for some strains, and is concomitant with NLS2 (Hale et al., 2008).
NLS mediate the active nuclear import of NS1 via binding to cellular
importin-α. Translocation of NS1 into the nucleus is extremely rapid. NLS1 is
highly conserved, monopartite, and involves three residues also involved in
binding dsRNA. NLS2 is absent from the NS1 proteins of a large number of virus
strains. It is difficult to describe a function to this sequence with regard to viral
replication. Concurrent with NLS2 is a functional nucleolar localization signal
(NoLS), which includes additional basic residues. Despite this, the nucleolar
function of NS1 is unknown (Hale et al., 2008).
The NLSs of the influenza B virus NS1 proteins are located within the
RNA-binding domains at the N-terminal 93 amino acids. NLSs overlapping with
an RNA-binding domain have been described for other viral regulatory proteins,
including UL69 of human cytomegalovirus and human immunodeficiency virus
that promote nuclear export of the respective viral mRNAs. RNA binding and
18
nuclear imports are mutually exclusive in the Rev protein, thereby ensuring that
exported viral mRNAs do not return immediately to the nucleus. Although, it has
not yet been determined whether, the NS1B protein is involved in the transport of
viral RNA. It is possible that this overlap indicates a similar regulatory
mechanism. The NLS of the NS1B protein was necessary but not sufficient to
mediate speckle association, which is required the whole N-terminal domain
(Schneider et al., 2008).
At the early infection, NS1B protein revealed a highly dynamic
intracellular localization and accumulates in nuclear speckle which is an important
for efficient virus replication. At the late stage of infection, NS1B protein
accumulates in the cytoplasm which depends on the interaction with another
transported proteins and RNAs which could be regulated by an exposed export
signal (Schneider et al., 2008).
2.4.2.1 NS1B binds to ISG-15 protein
The RNA-binding domain at the N-terminal residue and the adjacent
94–103 regions are required for the binding of interferon stimulate gene (ISG-15)
(Yuan et al., 2001 and Krug et al., 2003). This site is located in one of the surface
loops of this domain. The NS1B proteins are required for dsRNA binding (Yuan
et al., 2002). However, ISG-15 and dsRNA can bind to the N-terminal 103 amino
acid long fragment of the NS1B protein. ISG-15 protein does not have detectable
effect on the binding of dsRNA. The N-terminal region of the NS1B protein binds
not only dsRNA but also a specific cellular protein (Yuan et al., 2002). Unique
biological activities of the NS1B protein are indicated by its deficiency to inhibit
pre- mRNA processing, which has ability to bind to the antiviral response gene
product ISG-15 and to inhibit its conjugation to cellular proteins (Yuan et al.,
2001).
19
NS1B protein has prevented the conjugation of the ubiquitin-like ISG-15
protein to cellular target proteins, which may additionally benefit the activation of
such antiviral reactions (Donelan et al., 2004). Moreover, NS1 protein was
showed bind non-specifically to all ssRNAs and has greater binding activity
(Hatada et al., 1992).
The major goals is to determine the role of the N-terminal, 93 amino
acid RNA-binding domain in ISG-15 binding, whether it is required because it
maintains the dimerization, and hence proper folding of the NS1B protein, or
whether it contains part of the binding site for the ISG-15 protein. However, the
binding dsRNA to the N-terminal domains of the NS1A and NS1B proteins are
well established in vitro (Hatada et al., 1992, Lu et al., 1994). The specific
function of this dsRNA binding during virus infection remains elusive. The NS1
proteins are at a distinct disadvantage in competing with these cellular proteins for
dsRNA (Yuan et al., 2002).
2.4.2.2 NS1B inhibits and antagonists α/β interferon system
NS1 protein is involved in virulence and inhibition of the α/β interferon
system during virus infection (Donelan et al., 2004; Garcia-Sastre et al., 1998).
Efficient replication of influenza viruses and most other viruses necessitates are
suppressed of antiviral responses mediated by the α/β interferon system, which is
an important part of the immune responses of vertebrates (Dauber et al., 2006).
The NS1B protein is identified as a viral factor that antagonizes
interferon induction and boosts viral replication (Dauber et al., 2003). On the
contrary, Dauber and his coworkers found that analysis of these viral mutants
demonstrated inhibition of α/β interferon production is largely independent of the
dsRNA binding activity of NS1 but critically relies on the presence of the C-
20
terminal part of the protein. The dsRNA shielding does not appear to be sufficient
to prevent IFN induction by influenza B virus (Dauber et al., 2006).
The roles of dsRNA binding by NS1B protein are to promote viral
replication and to inhibit of antiviral responses. Dauber (2003) has generated a set
of isogenic influenza B viruses with mutations that either affected NS1 dsRNA
binding or introduced a large C-terminal truncation. By using in vitro binding and
reporter gene assays, it was established in previous studies that the larger C-
terminal part (amino acid 94 to 281) of NS1B protein contains can suppress
activation of the IFN-β promoter by Sendai virus infection (Donelan et al., 2004).
The observed lack of activity of the N-terminal domain of NS1 towards
IFN inhibition in influenza B virus-infected cells underscores the important role
of the C-terminal part of the protein in this process, which presumably involves an
RNA-independent mechanism. Further analyses of the intracellular RNA and
protein targets of the NS1 domains appear to be promising strategy not only to
learn more about details of the IFN suppressive activities of influenza viruses but
also about the factors and mechanisms that drive cellular responses to virus
infections in general (Dauber et al., 2006).
NS1B protein is not related to its ability to antagonize the interferon
(IFN) induced host antiviral response, since NS1/B/Lee virus is significantly
impaired in its ability to replicate even in IFN-deficient systems, such as VERO
cells and 6-day-old eggs (Dauber et al., 2003). Deletion of the truncated NS1B
gene residues from (1-93) protein showed that RNA-binding activity correlated
with β interferon promoter inhibition. In addition, a recombinant influenza B virus
with NS1 deleted induces higher levels of IRF-3 activation. NS1B protein
prevents the nuclear translocation of interferon regulator factor (IRF-3) and
especially β interferon induction in virus-infected cells. It was shown that, the
expression of the NS1B protein complements the growth of influenza A virus
with NS1A deleted (Donelan et al., 2004).
21
Inhibition of IFN- β synthesis correlates with the inhibition of IRF-3
nuclear translocation. This study found that the C-terminal domain of the NS1B
protein possesses IFN antagonist activity, so that deletion of this region would
result in a virus that is more attenuated than the wild-type virus. Viruses
containing mutations within the NS1B N-terminal domain that adversely affect
binding to dsRNA may also prove to be promising live attenuated vaccine
candidates (Donelan et al., 2004).
On the other hand, the role of dsRNA binding by the influenza B virus
NS1 protein is to promote viral replication and to inhibit of antiviral responses.
However, dsRNA binding was necessary for inhibiting protein kinase (PKR)
activation and enable efficient viral replication. The blockade of PKR activities by
both of the NS1 A and B is a common theme in many virus families, highlighting
that this enzyme is a key factor of the cellular antiviral response (Dauber et al.,
2006).
2.4.2.3 NS1 inhibits nuclear export of mRNA
The NS1 protein also functions inhibition rather than facilitation of
nuclear export of mRNA (Qian et al., 1993). The RNA-binding domain binds to
the poly (A) sequence in mRNAs. The effector domain and RNA binding domain
of NS1 protein represses transcription. Interactions between proteins that regulate
nuclear mRNA export and their nuclear targets will be varied and complex (Qian
et al., 1993).
Cytoplasmic as well as nuclear localization of the NSI protein occurred
only when the effector domain was present and was inactivated by a point
mutation. A possible explanation from the observation even wild-type NSI protein
has some affinity for one or more cytoplasmic targets. Specifically, the small
22
amount of the wild-type NS1 protein that is present in the cytoplasm has been
shown to be associated with ribosomes and polysomes. It has not been established
whether this ribosome associated NS1 protein has any function. This study
showed that interactions between proteins that regulate nuclear mRNA export and
their nuclear targets will be varied and complex depending on the interaction of
transcription factors with their protein targets (Qian et al., 1993).
2.4.2.4 NS1 protein interacts with GAS8
Growth arrest-specific (GAS) genes are expressed preferentially in
cultured cells that have entered a quiescent state following serum deprivation or
growth. Eleven GAS genes have been identified from a variety of biological
functions, including the control of microfilament organization, nerve cell growth
or differentiation, apoptosis, tyrosine kinase receptor activity, and negative and
positive control of the cell cycle. GAS8 is located at 16q24.3 and was found to be
a common deletion present in breast and prostate carcinomas. It was shown as a
potential tumor suppressor gene. The GAS8 gene consists of 11 exons spanning
approximately 25 kb. GAS8 protein associates with microtubules in vitro and in
vivo (Zhao et al., 2009).
Zhao and coworkers (2009) found that neither RNA binding domain nor
the effector domain of NS1 protein interacts with GAS8. Deletion analysis
revealed that the N-terminal 260 amino acids of GAS8 were able to interact with
NS1. Examination of the localization of GAS8 protein in cells revealed that two
types of localization existed: Golgi and cytoplasmic. This phenomenon was even
observed in the same types of cells. The Golgi apparatus localization is dependent
on intact microtubules and in cell-cycle regulated. Although, the function of GAS8
has not yet been determined, the effect of the association between GAS8 and NS1
on virus infection is unknown. The mammalian GAS8 gene is a possible tumor
23
suppressor that was previously identified as one of several genes that are up-
regulated upon growth arrest. GAS8 was expressed in HeLa, CV-1, A549, and
DU145 cells. NS1 inhibited the maturation of GAS8 mRNA. This is consistent
with the fact that transient expression of NS1 in mammalian cells leads to
retention of polyadenylation RNA in the nucleus and inhibition of pre-mRNA
splicing (Zhao et al., 2009).
2.4.2.5 NS1 protein inhibits pre-mRNA
Lu and coworkers (1994) found the NS1 protein inhibits pre-mRNA
splicing both in vitro and in vivo by associating with the spliceosomes that are
formed from pre-mRNA. He found that NS1 protein associates with U6 snRNA
(one of the basic protein of spliceosome) in infected cells. A fraction of NS1 was
also detected in association with ribosomes and polysomes in cytoplasmic
fractions of infected cells (Lu et al., 1994).
The nuclear export and splicing of pre-mRNAs are competing
processes. Genetics of these processes have been best studied in yeast by the
isolation and characterization of pre-mRNA processing. These studies found that
some of the protein factors involved in the splicing reaction might act as RNA
helicases and suggesting that dsRNA unwinding processes are necessary for
spliceosome assembly and release of the mRNA from the splicing complex. NS1
mRNA is poorly spliced to yield NS2 mRNA. However, inactivation of the NS1
gene led to a substantial increase in the splicing efficiency, as shown by the
relative accumulations of NS1 and NS2 mRNAs (Fortes et al., 1994).
24
2.4.2.6 NS1 protein prevents activation of PKR
NS1 protein prevents the activation of double-stranded-RNA (dsRNA) -
activated protein kinase (PKR) by binding to dsRNA. Activation of PKR results
in down regulation of cellular translation and is believed to be part of an antiviral
defense strategy in mammalian cells. Host proteins interacting with the NS1
protein during infection have been characterized. The identification of such
proteins is of great interest. Hence, they may influence the host range and
virulence of influenza virus strains. Such a hypothesis is supported by studies of
influenza viruses with mutated or heterologous NS1 alleles which showed altered
growth characteristics in different cells. By using the yeast interaction trap, it has
identified NS1-I by its ability to bind to NS1. It was demonstrated the
conservation of the interaction of NS1-I with six different human and avian
influenza virus NS1 proteins, suggesting that there is a role for the NS1–NS1-I
interaction during the virus life cycle. Overexpression of a truncated of NS1-I
protein would affect the normal course of infection and detailed mapping of the
interacting domains of NS1. NS1-I interaction should reveal whether one or more
of the temperature- sensitive mutations and identified NS1 protein can be
correlated with reduced ability to bind NS1-I (Wolf et al., 1996).
PKR needs to be activated via a conformational change that is brought
about by binding to either of its activators, double-stranded RNA (dsRNA) or the
PACT protein. Other studies were carried out a series of in vitro experiments to
determine whether the NS1 protein could be utilized a common mechanism to
inhibit PKR activation by both PACT and dsRNA, despite their different modes
of activation. They demonstrated that the direct binding of the NS1A protein to
the N-terminal region of PKR can serve as such a common mechanism and this
binding does not require the RNA binding activity of the NS1A protein (Li et al.,
2006).
25
2.5 Previous studies of cloning and expression of NS1 gene
NS1 gene from various influenza viruses had been cloned. This gene
was successfully expressed in Escherichia coli (Binns et al., 1996, Young et al.,
1983, Hatada et al., 1992). Antibody of NS1 was detected in serum sample from
ponies’ experimental infected cell with influenza virus without the animals being
vaccinated with whole inactivated virion. While determination of NS1 antigens
were appeared to be located in the C-terminal half of the protein. However, NS1
protein appears only in infected cells. Using NS1 protein as a diagnostic marker
for influenza virus infections in the presence of high levels of antibodies of
influenza hemagglutinin generated by recent vaccination is an attractive
alternative. NS1 protein from equine influenza virus its entirety or in part as a
fusion protein with glutathione S-transferase (GST) in a diagnostic tests for
detection this type of virus (Binns et al., 1996).
Electrophoresis in slab gels (12.5%) in the presence of SDS was used to
observed NS1 protein. ELISA was carried out on sera experimental samples to
test for the presence of anti-NS1 antibodies. ELISA results on control animals’
positive showed 60% of detection level which were similar to the 79% of
detection for naive animals, while in vaccinated animals was 26% (Binns et al.,
1996).
NS1 gene was isolated from equine influenza virus A/equine 2/Suffolk
/89(H3N8), cloned into pGEX-3X vector and transformed in E. coli TG1
competent cell. Recombinant protein was observed by SDS-PAGE and
immunoblot analysis was carried out to detect the antigens. ELISA diagnostic was
usefulness depending upon duration of the antibodies response to NS1 following
the initial infection. Detection efficiency of about 70% would be useful for batch
testing training yards (Birch-Machin et al., 1997).
26
The antigenic determinants of NS1 protein are situated in C-terminal
domain. Highly homologous regions are present at the position of the Miami/63
and Suffolk /89 NS1 proteins and clearly indicate that these proteins should be
capable of eliciting a similar immune response. Combination antibody response
with a cytotoxic T –cell response if elicited would be indicated that NS1 protein
could be an important component of future vaccines in equines and other species
(Birch-Machin et al., 1997).
pET-28 vector was employed to express the NS1 gene under the control
of the T7 promoter and fused with His·Tag sequences. NS1 gene from Influenza
A (H9N2) was cloned and highly expressed to about 37.4% of the total cellular
protein, and nearly 95% after purification. Utilizing IPTG inducer besides lactose
inducer had no effect on the growth of host cells (Fang-kun et al., 2008). The
antigenicity of the recombinant protein was demonstrated in Western-blotting test
by using positive sera from pigs. This way was not only laying the foundation for
development of ELISA antibody test for differentiation diagnosis between
vaccinated and naturally infected pigs, but also facilitating the monitoring and
eradication of SIV. This procedure focused on the antibody titer in pigs infected
with influenza virus without interference by vaccinated antibody titers and this
allows the differentiation between the vaccinated and the naturally infected pigs
(Fang-kun et al .,2008).
pQE-80L, the other type of vector with 6xHis-tag, was used to express
NS1 protein of influenza A/Chicken/TH/KU14/04 (H5N1). The NS1 gene was
inserted into pQE-80L using T4 DNA ligase. Ligation product was transformed
into subcloning efficiency DH5α competent cell by heating shock of the cells at
42°C for 20 seconds. The transformed E. coli was plated on LB agar containing
100μg/ml ampicillin. The transformants were screened by PCR using specific
primers. IPTG was used to induce E. coli. The recombinant NS1 proteins were
purified by precipitation and affinity chromatography and characterized by SDS-
PAGE and western blot analysis. The amount of NS1 protein purified by the
27
precipitation method was less than that purified under denatured conditions and
contained a small amount of E. coli protein. To confirm the expression, the fusion
protein was reacted with anti-histidine monoclonal antibodies and was indicated
specifically with antibodies raised against the NS1 protein (Manasatienkij et al.,
2008). The recombinant proteins produced in E. coli were not post-translationaly
modified. However, in some cases, it may be more effective antigens than the
recombinant proteins produced in insect cell systems (Manasatienkij et al., 2008,
Spencer et al., 2007). It was unknown whether the lack of modification in the NS1
protein would enhance its serological activities (Manasatienkij et al., 2008).
The plasmid pGEX- NS1B encodes a protein consisting of GST fused to
the NS1 protein of influenza B/Yamagata/1/73 virus. The wild type NS1 cDNA
was subcloned into the pGEX-5X-1 vector between the XhoI and EcoRI
restriction sites. The pGEX-NS1B (1-93) plasmid was constructed by in frame
insertion of the GST ORF in front of the coding region from 1 to 93 amino acids
of the NS1B protein. Similarly, pGEX-NS1 (94-281) was constructed by fusing
the GST ORF to a cDNA encoding from 94 to 281 amino acids of the NS1B
protein. Fusion proteins were expressed in E. coli BL21 and purified using
glutathione-sepharose beads. NS1B mutant cDNAs were also cloned into
pCAGGS vectors for expression in mammalian cells. On the other hand, NS1A
was expressed in trans by transfecting MDCK cells with plasmid pCAGGS as a
result, these cells support del NS1A virus replication. In order to determine
whether expression of the NS1B protein complements the growth of del NS1A
virus, del NS1A transfected MDCK cells with pCAGGS-NS1B plasmid.
Expression of NS1B protein was able to complement the growth of the del NS1A
virus to levels slightly lower than those seen when the NS1A protein was
expressed in trans. Hence, the results indicated that the NS1 protein of influenza
B virus can functionally replace the NS1 protein of influenza A virus in this assay
(Donelan et al., 2004).
28
Other rapid diagnostic method for detection of antigens in nasal swabs
of test animals and immune-PCR were established. It is a highly sensitive way to
detect NS1 protein (Ozaki et al., 2001).
29
CHAPTER 3
MATERIALS AND METHODS
3.1 Experimental Design
pUC57 plasmid carrying NS1B synthetic gene was cloned and
transformed into competent E. coli strain BL21(DE3). Figure 3.1 shows the
general flow chart of experimental design for each vector that started from
plasmid isolation, restriction digestion, agarose gel electrophoresis, ligation,
transformation and screening of colonies. In the first attempt (Figure 3.2), pET-
32b was amplified in E. coli strain BL21(DE3). Plasmid miniprep was done for
pUC57-NS1B and pET-32b. Then, single digestion was done using HindIII
enzyme. Ligation, transformation and screening colonies were done on clones of
BL21(DE3). In the second attempt (Figure 3.3), plasmid miniprep was done for
pUC57-NS1B and pQE-81L, which was amplified in E. coli strain DH5α. Double
digestion, was done using PstI and HindIII enzymes. Ligation, transformation and
screening colonies were done on clones of DH5α. In the third attempt (Figure
3.4), plasmid miniprep was done for pUC57-NS1B and pET-32a. NS1B gene
containing SacI and HindIII restriction enzyme sites were PCR amplified from
pUC57-NS1B. Double digestion was done using SacI and HindIII enzymes.
Ligation, transformation and screening colonies were done on clones of
BL21(DE3). In the fourth attempt (Figure 3.5), plasmid miniprep was done for
pUC57-NS1B and pQE-80L. Double digestion was done using SacI and HindIII
30
enzymes. Ligation, transformation and screening colonies were done on clones of
DH5α.
Restriction digestion using Hind III
Figure 3.1 Flow chart of experimental design
Isolation of pUC57-NS1B and expression vectors from E.
coli strains
Restriction digestion using SacI, PstI and HindIII enzymes
DNA agarose gel electrophoresis and extraction
Ligation of NS1B gene with vectors and transformation into
E. coli competent strains
Screening of colonies and PCR amplification
Plasmid isolation, digestion, gel electrophoresis
31
pET-32b pUC57-NS1B
Single digestion with HindIII Single digestion with HindIII
pET-32b vector (5899bp) NS1B gene (870bp)
Ligation
pET-32b – NS1B
Screening of colonies
Figure 3.2 Cloning of pET-32b-NS1B into E. coli BL21(DE3)
NS1B gene
HindIII HindIII
T7 promoter
HindIII
T7 promoter
NS1B
HindII
I HindII
I
Transformation into E. coli BL21(DE3)
32
pQE-81L
Double digestion with PstI and HindIII
pQE-81L vector (4753bp) NS1B gene (870bp)
Ligation
pQE-81L – NS1B
Screening of colonies
Figure 3.3 Cloning of pQE-81L-NS1B into E. coli DH5α
HindIII PstI
pQE for
NS1B
PstI HindIII
Transformation into E. coli DH5α
pQE for
PCR amplification of NS1B gene using
pUCfor and pUCrev primers
NS1B gene
HindIII PstI
33
Double digestion with SacI and HindIII
pET-32a vector (5900bp) NS1B gene (870bp)
Ligation
pET-32a – NS1B
Screening of colonies
Figure 3.4 Cloning of pET-32a-NS1B into E. coli BL21(DE3)
pET-32a PCR amplification of NS1B gene using
NS1BforSacI and NS1BrevHindIII primers
NS1B
T7 promoter
SacI
HindIII
Transformation into E. coli BL21(DE3)
NS1B gene
HindIII SacI
T7 promoter
HindIII
SacI
34
pQE-80L
Double digestion with SacI and HindIII
pQE-80L vector (4751bp) NS1B gene (870bp)
Ligation
NS1B
pQE-80L – NS1B
Screening of colonies
Figure 3.5 Cloning of pQE-80L-NS1B into E. coli DH5α
HindIII SacI
pQE for
pQE for
Transformation into E. coli DH5α
SacI HindIII
PCR amplification of NS1B gene using
NS1BforSacI and NS1BrevHindIII primers
NS1B gene
HindIII SacI
35
3.2 Materials
3.2.1 Bacterial strains
Two strains of Escherchia coli were used in this study - BL21(DE3) and
DH5α. These strains are commonly used as a host for cloning and protein
expression in molecular biology labs because they have the simplest genomic and
foreign DNA can be transformed easily. On the other hand, use of E. coli as a host
enables large quantity production of recombinant proteins (Leonhartsberger,
2006).
3.2.2 Chemicals
Most chemicals were of analytical and molecular biology grade obtained
from Sigma-Aldrich, Merck, GenScript, Promega, QIAGEN, Yeastern Biotech
and GeneAll. All restriction enzymes, DNA polymerase were purchased from
Promega. Ligase enzyme was obtained from Yeastern Biotech. Primers used for
PCR amplification were synthesized by 1st Base Laboratories Sdn. Bhd. Plasmid
miniprep and gel extraction kits were purchased from GeneAll and QIAGEN. The
pET and pQE vectors were ordered from Novagen and QIAGEN, respectively.
3.2.3 pET vectors
pET is a bacterial plasmid designed to enable quick high quantity
production of desired protein. pET-32a (5900bp), and pET-32b (5899bp) contain
36
several elements like: LacI gene, T7 promoter which is specific to T7 RNA
polymerase, Lac operator which is poly linker, f1 origin of replication, ampicillin
resistance gene and colE1 origin of replication (Blaber et al.,1998).
pET-32a is designed for cloning and high-level expression of peptide
sequences comprise of 109 amino acids Trx• Tag™ thioredoxin protein. Cloning
sites are available for cloning and producing fusion proteins. The plasmid also
contains cleavable His• Tag® and S• Tag™ sequences for detection and
purification (LaVallie et al., 1993).
Figure 3.6 pET-32 vectors
(http://www.lablife.org/p?a=vdb_view&id=g2.nm7d74YBP4q6Utqf6tNu_Ho-).
37
3.2.4 pQE vectors
The pQE series have been designed to allow tightly regulated 6xHis-
tagged protein expression in any E. coli host strain. The vectors are based on the
pQE-30 series and include a lacIq repressor gene. pQE-80L and pQE-81L vectors
have a cis-lacIq gene that overexpresses the lac repressor, strongly suppressing
protein expression from the lac promoter before induction with IPTG (QIAGEN,
2001).
Figure 3.7 pQE-80L vector
(ttp://www.lablife.org/p?a=vdb_view&id=g2%2eL3YawzFqJIzZU2TasKbNJ)
38
Figure 3.8 pQE-81L vector
(http://www.lablife.org/p?a=vdb_view&id=g2%2eL3YawzFqJIzZU2TasKbNJ)
3.2.5 NS1B Synthetic Gene
The synthetic NS1B gene was installed from synthetic oligonucleotides
and PCR products by GenScript (USA). Fragment was cloned into pUC57 into
EcoRV site.
39
MCS of pUC57
Figure 3.9 pUC57-NS1B gene construct (GenScript, 2009)
40
3.3 Methods
3.3.1 Liquid and solid media preparation
3.3.1.1 Luria Bertani agar and broth
LB medium was prepared by dissolving tryptone (4g), yeast extract (2g)
and sodium chloride (4g) in deionized water and it was made up to 400 ml. For
LB agar, 2% of agar was added. The contents were mixed and autoclaved at 121
°C for 20 minutes. For LB broth or agar containing 50µg/ml ampicillin, 10 ml of
ampicillin from stock solution of 2mg/ml was added to the media. For LB broth or
agar containing 100µg/ml ampicillin, 20 ml of ampicillin from stock solution of
2mg/ml was added to the media. The ampicillin solution was added to the
medium after it was cooled to 55°C.
3.3.1.2 Preparation of ampicillin stock solution
Ampicilin powder (Sigma-Aldrich) of 0.1g was dissolved in 50 ml of
sterile deionized water and filtered by using Sartobind nylon filter of size 0.2µm.
41
3.3.2 Preparation of competent cells
DNA is very hydrophilic molecule that does not normally pass through a
bacterial cell membrane. Bacteria need to be made "competent" in order to uptake
foreign DNA. Two strains of E. coli BL21(DE3) and DH5α hosts were used in
transformation. E. coli was grown overnight in 10ml of LB broth at 37°C with
shaking at 200rpm. The cells were chilled for 10 minutes on ice. Then, the cells
were centrifuged at 4°C for 10 minutes at 3000 rpm. After that, the supernatant
was discarded and the pellet was gently resuspended in 10ml of 0.1M calcium
chloride. Then, cells were incubated for 20 minutes on ice. The cells were spun
again at 4°C for 10 minutes at 3000 rpm. For long term storage, the cells were
resuspended in 1ml of 0.1M calcium chloride plus 15% glycerol and aliquoted
into 0.2ml suspension and stored at -80°C. It is the best to use fresh competent
cell for transformation.
3.4 Transformation pUC57-NS1B into E. coli BL21(DE3) competent
cells
pUC57-NS1B (2µl) was added to competent cells and kept on ice for
approximately 20 minutes and this was heat shocked at 42°C for 45seconds.
Immediately, the tube was placed back on ice for at least 2 minutes. Then, 1ml of
LB broth was added and incubated with agitation at 37°C for 1 hour at 200rpm.
The cells were very briefly spun and 700μl of supernatant was removed. The cells
were resuspended and plated out evenly using a sterile glass spreader at 100µl on
LB agar containing 50µg/ml ampicillin. The plates were incubated overnight at
37°C. Each colony was streaked on LB agar containing 100µg/ml ampicillin and
the plates were incubated overnight at 37°C.
42
3.5 Isolation of pUC57-NS1B plasmid
E. coli BL21(DE3) containing pUC57-NS1B was cultured overnight in
LB broth containing 100µg/ml ampicillin at 37°C with shaking at 200rpm. The
plasmids were isolated using plasmid miniprep kit from GeneAll. The cells were
harvested by centrifuging at 4000rpm for 5 minutes. The supernatant was
removed and the pellet was resuspended by pipetting thoroughly in 250µl of
buffer S1. The solution was transformed to a new 1.5ml microcentrifuge tube.
Then, 250µl of S2 buffer was added. The solution was gently mix by inverting
tube for 10 times and incubated for 2 minutes until the cell suspension became
clear. 350µl of buffer S3 was added to the solution and immediately inverted
gently for 10 times before centrifuged for 10 minutes at 14000rpm. PD column
was placed in a collection tube. Clear solution was transferred to the PD column
by pipetting while white pellet formed remained in the microcentrifuge tube. The
PD column was spun at 8000rpm for 30 seconds at room temperature. The flow-
through was discarded and the PD column was placed back in the collection tube.
500µl of buffer AW was added to the PD column and spun at 8000rpm for 30
seconds. The flow-through was discarded and the PD column was placed back in
the collection tube. Then the PD column was washed by adding 700µl of buffer
PW. The column was then centrifuged at 8000rpm for 30 seconds. The flow-
through was discarded and the PD column was placed back in the collection tube.
Additional centrifugation was done at 14000rpm for 1 minute. Next, PD column
was transferred into a new 1.5ml of microcentrifuge tube.
DNA was eluted by adding 50µl of elution buffer to the centre of the PD
column. After 2-minutes stand at room temperature, the tube was centrifuged at
14000rpm for 1 minute. The product was run on 1% agarose gel to check
whether the plasmid DNA is successfully isolated from E. coli before being
kept at -20°C.
43
3.6 Agarose gel electrophoresis
Agarose gel electrophoresis is widely used in molecular biology labs to
separate DNA strands by size, and to estimate the size of the separated strand by
comparing with the known fragments (DNA ladder). This is achieved by pulling
negatively charged DNA molecules through an agarose matrix with an electric
field. The concentration of the agarose depends on the size of the DNA fragments
to be separated.
50X of TAE buffer was prepared from EDTA (186g, pH 8), Tris base
(242g), and glacial acetic acid (57.1ml), and the solution was made up to 1000ml
with deionized water. The final pH was 8.5 and autoclaved at 121°C for 20
minutes. 1X TAE buffer was diluted from 50X TAE buffer by mixing 20ml of
50X TAE buffer with 980ml of distilled water. 0.5g of agarose powder was added
to 50ml of 1X TAE buffer and was boiled in microwave for 1 minute and then left
to cool down. 5µl of ethidium bromide was added to the agarose gel. The gel
casting tray was assembled in gel tank and well forming comb was inserted into
slots on casting tray. The agarose gel was poured into the gel casting tray. After
the gel was solidified in 30 minutes, the comb was removed carefully. The tray
containing agarose gel was placed into electrophoresis chamber and 1X TAE
buffer was added to cover the gel.
To prepare sample, 5µl of the DNA was mixed with 1µl of 6X loading
dye. 6µl of 1kb DNA ladder was used as a marker. The sample and the marker
were loaded separately into wells and the gel was run at 100V for 50 minutes.
After gel running, power supply was turn off. The gel was removed from the
casting tray and was viewed on a UV transilluminator and documented by using
GeneFlash.
44
3.7 Isolation of pET-32b plasmid
The same protocol as described in section 3.5 for plasmid miniprep was
used to isolate pET-32b from E. coli BL21(DE3).
3.8 Single digestion
pUC57-NS1B and pET-32b were digested using HindIII and the
following components were mixed in PCR tube:
Table 3.1: Single digestion components in PCR tube using HindIII
pUC57-NS1B 16.8µl pET-32b 16.8µl
Acetylated BSA 0.2µl Acetylated BSA 0.2µl
Buffer E 2µl Buffer E 2µl
HindIII enzyme 1µl HindIII enzyme 1µl
Total 20µl 20µl
The reactions were incubated at 37°C for 5 hours. The digestion
products were then purified by gel extraction to remove the buffer and restriction
enzymes.
3.9 DNA Extraction
The digestion product needs to be purified before further use. Following
electrophoresis, the NS1B band with the size of 870bp and pET-32b at size nearly
6000bp were cut out with a clean sharp scalpel from the gel. The gel slices were
45
separately put inside 2ml microcentrifuge tube. The tubes were weighed before
and after putting in the gel. Three times volume of QG solution buffer was added
to one volume of gel as mentioned in the protocol of QIAGEN gel extraction kit.
The solution was incubated at 50ºC for 10 minutes and vortexed at each 2
minutes. One volume of isopropanol was added to the sample and mixed. The
sample was applied to the QIAquick column and centrifuged at 13000rpm for 1
minute. The flow-through was discarded and the column was placed back. This
step was repeated till all the sample was passed through the column. Then, 0.5ml
of QG buffer was added to column and centrifuged at 13000rpm for 1 minute. The
flow-through was discarded. Then, the column was placed back, washed by
adding 0.7ml of PE buffer and centrifuged at 13000rpm for 1 minute. The flow-
through was discarded and centrifuged again to remove all PE buffer. The column
was transferred to a new 1.5ml microcentrifuge tube and 50µl of elution buffer
was added to the centre of column. It was stood at room temperature for 2-5
minutes and then centrifuged at 13000rpm for 1 minute. The product was kept in -
20ºC.
3.10 Determination of DNA concentration
The measuring of DNA concentration was carried out by using Nanodrop
Spectrophotometer. The DNA concentration and purity was measured by using 1
μl of the sample. An OD260: OD280 ratio of purified plasmid is to be found in
the expected range of 1.8 and 2.0. 1 µl of distilled water was used to initialize the
instrument and 1µl of elution buffer was used as a blank.
46
3.11 Ligation NS1B with pET-32b
T4 DNA Ligase was used in ligating the vector and the insert gene.
DNA ligases catalyze the formation of a phosphodiester bond between adjacent
nucleotide with the hydrolysis of ATP to AMP and inorganic phosphate. NS1B
and digested pET-32b with HindIII were ligated and the following components
were mixed in PCR tube:
Table 3.2: Ligation mix components of pET-32b and NS1B
1st mix 2
nd mix
pET-32b 1µl 2µl
NS1B 3µl 4µl
10X ligation buffer A 1µl 1µl
10X ligation buffer B 1µl 1µl
YEA T4 DNA ligase 1µl 1µl
dH2O 3µl 1µl
Total 10µl 10µl
The reactions were incubated in thermocycler at 22°C for 20 minutes
followed by inactivation at 65°C for 10 minutes. The ligation mix was kept at 4°C
for transformation. It is better to directly transform the ligation mix into
competent cells.
3.12 Transformation of recombinant product
The constructed recombinant plasmid prepared as described in section
3.11 was transformed into E. coli BL21(DE3) competent cells. The ligation mix
(10μl) was added to 100µl of competent cells and incubated on ice for 20 minutes.
47
The cells were heat shocked at 42°C for 45 seconds. Tube was immediately
placed back on ice for at least 2 minutes. 1ml of LB broth was added to the tube.
Then, tube was incubated at 37°C for 1 hour with shaking at 200rpm. Cells were
collected by centrifugation at 10,000 rpm for 30 seconds. 0.7ml was removed
from supernatant and the cells were resuspended. The cells (100µl) were spread
out on LB agar containing 50µg/ml ampicillin. IPTG (5µl) and X-gal (10µl) were
spread on the plates for 1 hour prior to use. Some cells were plated out on LB agar
as a control. The plates were incubated at 37°C for overnight.
3.13 Isolation of pQE-81L plasmid
The same protocol as described in section 3.5 for plasmid miniprep was
used to isolate pQE-81L from E. coli DH5α.
3.14 Amplification of NS1B gene using Polymerase Chain Reaction
(PCR)
3.14.1 Primer design
Primers were designed based on the upstream and downstream region of
NS1B gene of pUC57 vector. The characteristics of the primers are as described
in Table 3.3.
48
Table 3.3: The pUC57 primers for PCR of NS1B gene from pUC57-NS1B
Primers Sequences (5׳3-׳) Length(bp) % of GC Content Melting
Temp.(°C)
pUC for 5׳-
GTAAAACGACGG
CCAGTGA-3׳
19 52-6 60.2
pUC rev 5׳-
CAGGAAACAGCT
ATGACC-3׳
18 50.0 57.6
3.14.2 Polymerase Chain Reaction (PCR)
Using micropipette, a PCR reaction was prepared by pipetting the
following reagents into PCR tube:
Table 3.4: PCR reaction components of pUC57-NS1B
Go Taq DNA polymerase 0.25µl
5X Green buffer 10µl
dNTP 1µl
MgCl2 5µl
Forward primer (pUCfor) 0.2µl
Reverse primer (pUCrev) 0.2µl
dH2O 32.35µl
pUC57- NS1B 1µl
Total 50µl
49
The PCR process was initiated with initial denaturation step at 94ºC for
5 minutes. The process continued with the denaturation, annealing and extension
steps. The reaction conditions for each step in PCR cycle were as follows:
Table 3.5: PCR cycle
Steps Temperature Time
Denaturation 94ºC 30 sec.
Annealing 50ºC 30 sec.
Extension 72ºC 1 min.
The above cycle was run for 25 cycles. Then the cycle was continued by
further extension at 72ºC for 7 minutes. Then, the sample was run on gel
electrophoresis as described in section 3.6. The PCR products were purified by
using the protocols as mentioned in section 3.9 prior to digestion with PstI and
HindIII restriction enzymes.
3.15 Double digestion using PstI and HindIII restriction enzymes in one
step
NS1B amplified gene and pQE-81L were digested using PstI and
HindIII restriction enzymes and the following components were mixed in a PCR
tube:
50
Table 3.6: Double digestion components in PCR tube using PstI and HindIII
pQE-81L or NS1B gene 15.8µl
Acetylated BSA 0.2µl
10X Multicore enzyme buffer 2µl
HindIII enzyme 1µl
PstI enzyme 1µl
Total 20µl
The reactions were incubated at 37ºC for 5 hours. Then, gel
electrophoresis was done and extracted using the same protocols mentioned in
sections 3.6 and 3.9. The extracted product was used for ligation reaction.
3.16 Double digestion using restriction enzymes in two steps
The following components were mixed in PCR tube for the first
digestion for NS1B amplified gene and pQE-81L:
Table 3.7: Double digestion components in PCR tube using HindIII(1st step)
pQE-81L or NS1B gene 15.8µl
Acetylated BSA 0.2µl
Buffer E 2µl
HindIII enzyme 2µl
Total 20µl
The reaction was incubated at 37ºC for 5 hours. Then, the reaction was
observed by gel electrophoresis and extracted using the same protocols as
51
mentioned in sections 3.6 and 3.9. The extracted product was used for the second
digestion. The following components were mixed in PCR tube:
Table 3.8: Double digestion components in PCR tube using PstI(2nd
step)
First digestion product 15.8µl
Acetylated BSA 0.2µl
Buffer H 2µl
PstI enzyme 2µl
Total 20µl
The reaction was incubated at 37ºC for 5 hours. Then, the reaction was
observed by gel electrophoresis and extracted using the same protocols as
mentioned in sections 3.6 and 3.9. The extracted product was used for ligation
reaction.
3.17 Ligation and transformation into DH5α
Ligation and transformation of pQE-81L-NS1B into E. coli DH5α
competent cells were done using the same protocol as mentioned in sections 3.11
and 3.12.
52
3.18 Screening of positive colonies
Colonies grown on LB agar containing 30µg/ml ampicillin were isolated
and further streaked on LB agar containing 100µg/ml ampicillin. The plates were
incubated at 37°C for overnight. Colony PCR was used as the screening method.
3.18.1 Chelex 100 extraction method
Chelex 100 resin is highly purified, and most suitable for DNA
applications. It is composed of styrene divinylbenzene copolymers with paired
iminodiacetate ions. Chelex 100 is very effective in binding metal contaminants
with a high selectivity for divalent ions, without altering the concentration on non-
metal ions. One benefit of using the Chelex extraction is that divalent heavy
metals which introduce DNA damage at high temperature can be removed. The
extraction was set up under aqueous alkaline conditions, as the Chelex 100
suspension was prepared in TE buffer
(http://www.nfstc.org/pdi/Subject03/pdi_s03_m03_01.htm).
10% Chelex 100 was used to extract DNA. 100µl of chelex solution was
added into 1.5ml microcentrifuge tube and the number of tubes was prepared
according to the numbers of colonies to be screened. Each tube was labeled as the
number of colonies. A scrap of each colony was removed using toothpick,
resuspended and vortexed with the Chelex suspension for 5 to 10 seconds. The
samples were incubated at 95ºC for 5 minutes with agitation 400rpm. Then, the
samples were centrifuged at 12000rpm for 5 minutes. The supernatant was used
for PCR amplification. The samples were kept in 4ºC for further studies.
53
3.18.2 PCR amplification and gel electrophoresis to detect NS1B
For screening of colonies, sequencing primers of pQE-81L vector were
used the characteristics of the primers used are as in Table 3.9. The PCR
amplification and gel electrophoresis were as mentioned in sections 3.14.2 and
3.6.
Table 3.9: The pQE primers for PCR
Primers Sequences (5׳3-׳) Length(bp) % of GC Content Melting
Temp.(°C)
pQE for 5׳-
CGGATAACAATTTC
ACACAG-3׳
20 40.0 56.3
pQE rev 5׳-
GTTCTGAGGTCATT
ACTGG-3׳
19 47.4 58.0
3.19 Isolation of pET-32a plasmid
The same protocol as described in section 3.5 for plasmid miniprep was
used to isolate pET-32a from E. coli BL21(DE3).
54
3.20 Amplification of NS1B gene using Polymerase Chain Reaction
(PCR)
PCR amplification of NS1B gene from pUC57-NS1B was done using
the same protocol mentioned in section 3.14.
3.20.1 Primer design
The forward and reverse primers were designed to contain SacI and
HindIII restriction sites for endonucleases digestion. The characteristics of the
primers design are shown in Table 3.10.
Table 3.10: Primers containing SacI and HindIII restriction enzyme sites used to
amplify NS1B gene
Primers Sequences (5׳3-׳) Length(bp) % of GC Content Melting
Temp.(°C)
NS1B forSacI
GAGCTCATGGCGAA-׳5
CAAT-3׳
18 50.0 57.0
NS1B revHindIII
AAGCTTCTAATTGT-׳5
CTCC-3׳
18 38.9 53.1
55
3.21 Double digestion using SacI and HindIII restriction enzymes in one
step
NS1B amplified gene and pET-32a were digested using SacI and HindIII
and the following components were mixed in PCR tube:
Table 3.11: Double digestion components in PCR tube using SacI and HindIII
pET-32a or NS1B gene 15.8µl
Acetylated BSA 0.2µl
10X Multicore enzyme buffer 2µl
HindIII enzyme 1µl
SacI enzyme 1µl
Total 20µl
The reaction was incubated at 37ºC for 5 hours. Then, the reaction was
observed by gel electrophoresis and extracted using the same protocols as
mentioned in sections 3.6 and 3.9. The extracted products were used for ligation
reaction.
3.22 Double digestion using SacI and HindIII restriction enzymes in two
steps
The following components were mixed in PCR tube for the first
digestion for NS1B amplified gene and pET-32a:
56
Table 3.12: Double digestion components in PCR tube using HindIII(1st step)
pET-32a or NS1B gene 15.8µl
Acetylated BSA 0.2µl
Buffer E 2µl
HindIII enzyme 2µl
Total 20µl
The reaction was incubated at 37ºC for 5 hours. Then, the reaction was
observed by gel electrophoresis and extracted using the same protocols as
mentioned in sections 3.6 and 3.9. The extracted product was used for the second
digestion. The following components were mixed in PCR tube:
Table 3.13: Double digestion components in PCR tube using SacI(2nd
step)
First digestion product 15.8µl
Acetylated BSA 0.2µl
Buffer J 2µl
SacI enzyme 2µl
Total 20µl
The reaction was incubated at 37ºC for 5 hours. Then, the reaction was
observed by gel electrophoresis and extracted using the same protocols as
described in sections 3.6 and 3.9. The extracted product was used for ligation
reaction.
57
3.23 Ligation, transformation into E. coli BL21 (DE3) and screening of
colonies
Ligation, transformation into E. coli BL21(DE3) and colony screening
were done using the same protocols as mentioned in sections 3.11, 3.12 and 3.18.
The primers used for PCR were T7 promoter and T7 terminator primer. The
characteristics of the primers used are shown in Table 3.14.
Table 3.14: Primers containing SacI and HindIII restriction enzyme sites used to
amplify NS1B gene
Primers Sequences (5׳3-׳) Length(bp) % of GC Content Melting
Temp.(°C)
T7 promoter 5׳-
TAATACGACTCACA
CAAGGG-3׳
20 40.0 56.3
T7 terminator 5׳-
GCTAGTTATTGCTC
AGCGG-3׳
19 52.5 60.2
3.24 Isolation plasmid (pQE-80L)
The same protocol as described in section 3.5 for plasmid miniprep was
used to isolate pET-32a from E. coli BL21(DE3).
58
3.25 PCR amplification, double digestion, ligation, transformation into
DH5α and screening of colonies
The same protocols as described in sections 3.20, 3.21, 3.22, 3.17 and
3.18 were used.
59
CHAPTER 4
RESULTS AND DISCUSSION
4.1 Transformation of pUC57-NS1B into E. coli BL21(DE3)
Transformation of pUC57-NS1B synthetic gene construct into
competent E. coli BL21(DE3) was successfully done. The colonies were
maintained using LB agar containing 100µg/ml ampicillin and incubated
overnight at 37°C. Plasmid isolation of pUC57-NS1B from E. coli BL21(DE3)
was done using GeneAll miniprep kit and the presence of pUC57-NS1B was
verified by agarose gel electrophoresis.
4.2 Cloning of pET-32b-NS1B into E. coli BL21(DE3)
Single restriction digestion was done for pUC57-NS1B and pET-32b by
using HindIII enzyme which recognizes 5׳A▼AGCTT 3׳ sequence.
The restriction digestion of pUC57-NS1B was successful and NS1B
gene (870 bp) was separated and this is shown in Figure 4.1. pET-32b was also
linearized and its presence was verified by the band of 5.9kb in Figure 4.1.
60
Figure 4.1 Restriction digestion by HindIII.
M: 1 kb Marker, Lane 1, 2: pUC57 and NS1B gene, Lane 3: pET-32b
Subsequently, the NS1B gene was cloned into pET-32b vector and
transformed into competent E. coli BL21(DE3). After overnight incubation,
colonies were observed and this is shown in Figure 4.2.
8000
6000
5000
3000
2500
2000
1500
1000
750
pET-32b (5.9kb)
pUC57 (2.7kb)
NS1B (0.87kb)
M 1 2 3
61
Figure 4.2 Transformation of pET-32b-NS1B into competent E. coli
BL21(DE3)
Colonies were streaked on LB agar containing 100 µg/ml ampicillin and
spread with IPTG and X-gal. X-gal is used to indicate whether a cell expresses
the β-galactosidase enzyme, which is encoded by the lacZ gene, in a technique
called blue/white screening or X-gal screening. X-gal dye is cleaved by β-
galactosidase yielding galactose and 5-bromo-4-chloro-3-hydroxyindole
(http://www.fermentas.com/en/products/all/reagents/r094-xgal). All colonies were
observed to be blue in color. Hence, the insertion of NS1B gene into pET-32b
vector gave negative result. This may due to recircularization of the vector. The
attempts to increase the ratio of gene: vector insert was done. However, the
cloning steps were not successful.
4.3 Cloning of pQE-81L-NS1B into E. coli DH5α
We attempted the directional cloning approach of NS1B gene into pQE-
81L vector. Double digestion was done for pQE-81L by using PstI and HindIII
enzymes. As for pUC57-NS1B, it was first digested with HindIII enzyme and the
result is shown in Figure 4.3.
Colonies
62
Figure 4.3 Plasmid isolation and digestion of pUC57-NS1B and pQE-81L
M: 1kb Marker, Lane 1 and 2: pUC57-NS1B digested with HindIII, Lane 3:
Miniprep of pUC57-NS1B, Lane 4: Double digestion of pQE-81L, Lane 5:
Miniprep of pQE-81L.
PstI enzyme recognizes the 5׳ CTGCA▼G 3' sequence and HindIII
enzyme recognizes 5׳A▼AGCTT 3׳ sequence. Figure 4.6 shows the isolation and
digestion of the vector and gene. Lane 1 and 2 shows the successful digestion of
pUC57-NS1B with HindIII enzyme and the band of NS1B is of correct size
(870bp). Lane 4 shows the double digestion of pQE-81L by using PstI and
HindIII and the band is of correct size (4.8kb) but in this way still unknown
whether the digestion correct complete or not. Plasmid miniprep for both pUC57-
NS1B and pQE-81L were verified in lane 3 and 5.
Because the concentration of NS1B gene extracted was low (4.7 ng/µl)
and this would affect the next step of digestion, so PCR amplification was done to
increase the concentration of NS1B by using primers designed for pUC57. A band
6000
5000
3000
2500
2000
1500
1000
750
M Lane 1 2 3 4 5
pQE-81L
(4.8kb)
NS1B
(0.87kb)
63
of the correct size was shown in lane 1 of Figure 4.4, indicating successful
amplification. Then, PCR product was extracted, double digested with PstI and
HindIII and used for cloning into pQE-81L. The transformed colonies were
shown in Figure 4.5.
Figure 4.4 PCR amplification of NS1B
NS1B
1000
750
M Lane 1
Lane 2 5 6 7
64
Figure 4.5 Transformation of pQE-81L-NS1B into competent DH5α
After transformation, colony PCR was carried out with pQEfor (5׳-
CGGATAACAATTTCACACAG-3') and pQErev (5'-
GTTCTGAGGTCATTACTGG-3') primers. However, all the colonies screened
gave negative result. As shown in Figure 4.6, the size of amplified band is smaller
than 300bp, indicating that only the pQE-81L vector was transformed to cells
without the cloning of NS1B gene. The right band size to be expected is nearly
1000bp.
Colonies
65
Figure 4.6 PCR of recombinant pQE-81L-NS1B
4.4 Cloning of pET-32a-NS1B into E. coli BL21(DE3)
PCR amplification was done on pUC57-NS1B to amplify NS1B gene
with a newly designed primers NS1BforSacI (5׳-GAGCTCATGGCGAACAAT-
and NS1BrevHindIII (5'-AAGCTTCTAATTGTCTCC-3') which introduced (׳3
SacI and HindIII restriction sites to NS1B for directional cloning of the gene into
pET-32a. The amplified NS1B gene is shown in Figure 4.7.
1000
300
M clone 21 22 23 24 25 26 27 28 29 30 31 32
66
Figure 4.7 Miniprep of pUC57-NS1B and PCR amplification of NS1B
M: 1kb marker, Lane1: Miniprep of pUC57-NS1B, Lane 2: PCR amplification of
NS1B gene
The HindIII enzyme recognizes 5׳A▼AGCTT 3׳ sequence while SacI
enzyme recognizes 5׳ GAGCT▼C 3׳ sequence. The gene was extracted, double
digested with SacI and HindIII and used for cloning into pET-32a. The
transformed colonies were shown in Figure 4.8. The colonies were screened by
PCR. pET-32a vector’s universal primers, namely T7 promoter (5'-
TAATACGACTCACTATAGGG-3') and T7 terminator (5'-
GCTAGTTATTGCTCAGCGG-3'). All colonies screened gave negative result.
As shown in Figure 4.9, the size of amplified band is smaller than 750 bp,
indicating that only the pET-32a vector was transformed into the cells without the
cloning of NS1B gene. The right band size to be expected is nearly 1500 bp.
3000
2500
1000
NS1B
M Lane 1 Lane 2
3 4
67
Figure 4.8 Transformation of pET-32a-NS1B into competent E. coli
BL2(DE3)
Figure 4.9 PCR of recombinant pET-32a-NS1B
M: 1 kb Marker, Lane 1-14: Clone from 62-75
Colonies
1500
750
M 1 2 3 4 5 6 7 8 9 M 10 11 12 13 14
68
4.5 Cloning of pQE-80L-NS1B into E. coli DH5α
The amplified NS1B gene containing SacI and HindIII sites was
extracted, digested and cloned into pQE-80L vector. The transformed colonies
were shown in Figure 4.10. After transformation into DH5α, colony PCR was
done using pQEfor and pQErev primers. All screened colonies yield negative
result. The result is shown in Figure 4.11. This result showed that only the pQE-
80L vector was transformed into cells without the cloning of NS1B. The right
band size to be expected is nearly1000bp.
Figure 4.10 Transformation of pQE-80L-NS1B into competent DH5α
Colonies
69
Figure 4.11 PCR of recombinant pQE-80L-NS1B
M: 1kb Marker, Clone number from 83-92
4.6 Confirmation of ligation
Ligation and transformation of pET-32a-NS1B into E. coli BL21(DE3)
and pQE-80L-NS1B into E. coli DH5α yield negative result. Therefore, to
confirm whether ligation had happened, PCR amplification was done on the
ligation. 1µl of ligation mix for pET-32a-NS1B and pQE-80L-NS1B were
amplified. The result shown in Figure 4.12 indicated that the fragments without
insert were amplified.
300
M Clone
83 84 85 86 87 88 89 90 91 92
70
Figure 4.12 PCR amplification
M: 1kb Marker, Lane 1: fragment without gene insert from pET-32-NS1B, Lane
2: fragment without gene insert from pQE-80L-NS1B
750
300
M Lane 1 2
83 84 85 86 87 88 89
90 91 92
71
CHAPTER 5
CONCLUSION AND FUTURE WORKS
5.1 Conclusion
Nonstructural protein NS1 is used for identification and differentiation
between the vaccinated and naturally infected animals. Vaccinated animals have
not produced nonstructural protein (Fang-kun et al., 8002). The function of NS1
protein during viral multiplication remains unclear, although a possible regulatory
role in viral replication has been suggested from studies of temperature sensitive
mutant of NS1 (Binns et al., 1993). Dauber and coworkers (2003) found that
reverse genetic system studies may allow to explore the function of NS1B during
the replication cycle and to assess their contributions to the pathogenesis and
virulence of influenza B (Dauber et al., 2003).
pUC57 plasmid carrying NS1B gene was successful transformed and
isolated from E. coli BL21(DE3). Designed primers used for PCR of NS1B
showed successful amplification.
First screening of pET-32b-NS1B colonies using white/blue method
gave negative result. Similar negative results were observed when screening
colonies of pQE-81L-NS1B, pET-32a-NS1B and pQE-80L-NS1B. Screening of
colonies for pQE-81L-NS1B and pQE-80L-NS1B revealed a band under the size
72
300bp, which is not as the expected band size of 1000bp. Screening of colonies
for pET-32a-NS1B showed a band of the size nearly 750bp, which is not as the
expected band size of 1500bp. Screening of colonies for all vectors used showed
only plasmids without any insertion of the NS1B gene.
Cloning NS1B into pET-32b using single restriction digestion with
HindIII, pQE-81L using double restriction digestion with (PstI and HindIII), pET-
32a using double restriction digestion with (SacI and HindIII), pQE-80L using
double restriction digestion with (SacI and HindIII) gave unexpected result. This
result may relate to re-ligation of digested vector for single digestion and
uncompleted digestion for vectors of double restriction digestion.
5.2 Future works
A further construction of NS1 gene into pET32a, pET-32b, pQE-80L
and pQE-81L vectors should be performed with best precaution of procedures to
avoid any contamination and the use of appropriate restriction enzymes with high
efficiency to get recombinant construction. The NS1B gene can also be cloned
into other expression vectors according to the open reading frame and use other
host.
In the future, it is suggested that the overexpression of the constructed
recombinant into expression system are being studied and work on purification
can also be performed using immobilized affinity chromatography resin. NS1B
protein can be analyzed by Sodium Dodecyl Sulphate –Polyacrylamide Gel
Electrophoresis (SDS-PAGE) analysis.
73
More studies to determine immunogenicity of influenza NS1B fusion
protein by using Western blotting or Enzyme-linked immunosorbent assay
(ELISA) methods should be carried out.
74
References
Binns, Matthew, and Ely. (1996). Expression of the non-structural protein NS1
111of influenza virus and detection of anti-NS1 antibody in serum. European
111Patent Office. Application no: 96300681.2
Birch-machin, I., Rowan, A., Jane Pick, J., Mumford, J., and Binns, M. (1997).
111Expression of the non structural protein NS1 of equine influenza a virus :
111detection of Anti-NS1antibody in post infection equine sera. Journal of
111Virology methods: 255-263.
Blaber, M. (1998). Spring. Web Page for Lecture 25 of Molecular Biology and
111Biotechnology Course: Prokaryotic Expression Vectors.
Dauber, B., Heins, G., and Wolff, T. (2003). The Influenza B Virus
111Nonstructural NS1 Protein Is Essential for Efficient Viral Growth and
111Antagonizes Beta Interferon Induction. Journal of Virology: p. 1865–1872.
Dauber, B., Schnider, J., and Wolff, T. (2006). Double-Stranded RNA Binding of
111Influenza B Virus Nonstructural NS1 Protein Inhibits Protein Kinase R but
111Is Not Essential To Antagonize Production of Alpha/Beta Interferon. Journal
111of Virology: p. 11667–11677.
Donelan, N., Dauber, B., Wang, X., Basler, C., Wolff, T., and Garcı´a-Sastre, A.
111(2004). The N-and C- Terminal Domains of the NS1 protein of Influenza B
111Virus Can Independently Inhibit IRF-3 and Beta Interferon Promoter
111activation. Journal of Virology: p.11574-11582.
75
Fang-Kun, W., Xio-Fang, Y., Yi-cheng, W., Cun, Z., Li-huan, X., and Si-dang,
111L. (2008). Cloning, Prokaryotic Expression, and Antigenicity Analysis of
111NS1 Gene of H9N2 Swine Influenza Virus. gricultural Sciences in China :
1117(7): 895-900.
Fortes, P., Beloso, A., and Ortin, J. (1994). Influenza VirusNs1 protein inhibits
111pre-mRNA splicing and blocks mRNA nucleocytoplasmic transport. The
111EMBO Journal: vol.13 no.3 pp. 704-712.
Garcı´a-Sastre, A., Egorov, A., Matassov, D., Brandt, S., Levy, D., Durbin, J.,
111Palese, P., and Muster, T. (1998). Influenza A virus lacking the NS1 gene
111replicates in interferon-deficient systems. Virology 252:324–330.
Greenspan, D., Palese P., and Krystal, M. (1988). Two Nuclear Location
111Signals in the Influenza Virus NS1 Nonstructural Protein. Journal of
111Virology, p: 3020-3026.
Hai, R., Martinez-Sobrido, L., Fraser, K., Allyon, J., Garcia-Saster, A., and
111Palese, P. (2008). Influenza B Virus NS1-Truncated Mutants: Live-
111Attenuated Vaccine Approach. Journal of Virology: p. 10580–10590.
Hale, B., Randall, R., Ortin, J., and Jackson, D. (2008). The multifunctional NS1
111 protein of influenza A viruses. Journal of General Virology: p. 89, 2359-
1112376.
Hatada, E., Takezawa, T., and Fukuda, R. (1992). Specific binding of influenza
111A virus NS1protein to the virus minus-sense RNA in vitro. Journal of
111General virology:73,17-25.
76
Krug, R., Yuan, W., Noah, D., and Latham, A. (2003). Intracellular warfare
111between human influenza viruses and human cells: the roles of the viral NS1
111protein.Virology, 309:181-189.
LaVallie, R., DiBlasio, A., Kovacic, S., Grant, L., Schendel, F. and McCoy, M.
111(1993) Bio/Technology 11, 187–193.
Leonhartsberger, S. (2006). E. coli Expression System Efficiency Secretes
111Recombinant Proteins into Culture Broth. Bioprocess internantional. 4(4),
11110-14.
Li, S., Min, J., Krug, R., and Sen, G. (2006). Binding of the influenza A virus
111NS1 protein to PKR mediates the inhibition of its activation by either PACT
111or double-stranded RNA. Journal of Virology: 349, 13-21.
Lu, Y., Qian, X., and Krug, R. (1994).The influenza virus NS1 protein: a novel
111inhibitor of pre-mRNA splicing. Genes Dev: 1817-1828.
Manasatienkij, W., Lekcharoensuk, P., and Upragarin, N. (2008). Expression
111and Purification of NS1 Protein of Highly Pathogenic Avian Influenza Virus
111H5N1 in Escherichia coli. Kasetsart J. (Nat. Sci.) 42: 485 – 494.
Metreveli, G. (2006). Expression of influenza virus nonstructural protein 1
111(NS1). Swedish University of Agricultural Sciences.
Nerome, R., Hiromoto, Y., Sugita, S., Tanabe, N., Ishida, M., Mastumoto, M.,
111Lindstrom, S., Takahashi, T., and Nerome, K. (1998). Evolutionary
111characteristics of influenza B virus since its first isolation in 1940: dynamic
111circulation of deletion and insertion mechanism.Arch Virol.143:1569-1583.
77
Ozaki, H., Sugiura, T., Sugita, S., Imagawa, H., and Kida, H. (2001).Detection
111of antibodies to the nonstructural protein (NS1)of influenza A virus allows
111distinction between vaccinated and infected horses .Veterinary Microbiology
11182:111-119.
Palese, P., and Shaw, L. (2007). Orthomyxoviridae: the viruses and their
111replication, p. 1647–1689.
Qian, X., Alonso-caplen, F., and Krug, R. (1993). Two Functional Domains of
111the Influenza Virus NS1 Protein Are Required for Regulation of Nuclear
111Export of mRNA. Journal of Virology: p. 2433-2441.
Schneider, J., Dauber, B., Mele´n, K., Julkunen, I., and Wolff, T. (2008).
111Analysis of Influenza B Virus NS1 Protein Trafficking Reveals a Novel
111Interaction with Nuclear Speckle Domains. Journal of Virology; p. 701–711.
Spickler, A. (2009). FluGrippe, avian influenza, Grippe Aviair, Fowl Plaque,
111Swine influenza, Hog Flu, Pig Flu, Equine influenza, Canine influenza.
111Lowa State University, College of Veterinary Medicine, Ames, Lowa.
Wolff, T., Oneili, R., and Palese, P. (1996). Interaction Cloning of NS1-I, a
111Human Protein That Binds to the Nonstructural NS1 Proteins of Influenza A
111and B Viruses. Journal of virology; p. 5363–5372.
Young, F., Desselberger, U., Palese, P., Ferguson, B., Shatzman, A. and
111Rosenberg, M. (1983). Efficient expression of influenza virus NS1
111nonstructureal proteins in Escherichia coli. Proc. Natl. Acad. Sci. USA. 80,
1116105- 6109.
78
Yuan, W., and Krug, M. (2001). Influenza B virus NS1 protein inhibits
111conjugation of the interferon (IFN)-induced ubiquitin-like ISG15 protein.
111EMBO J. 20, 362–371.
Yuan, W., Aramini, J., Montelione, G., and Krug, R. (2002). Structural Basis
111for Ubiquitin-like ISG 15 Protein Binding to the NS1 Protein of Influenza B
111Virus: AProtein–Protein Interaction Function That Is Not Shared by the
111Corresponding N-terminal Domain of the NS1 Protein of Influenza
111AVirus.Virology 304:291-301.
Zhao, L., Xu, L., Zhou, X., Zhu, Q., Yang, Z., Zhang, C., Zhu, X., Yu, M.,
11 Zhang, Y., Zhao, X., Huang, P. (2009). Interaction of influenza virus NS1
11.protein with growth arrest-specific protein 8. Virology Journal: 6:218.
79
APPENDIX A
NS1B gene sequence (870 bp) of Influenza B virus (B/Taiwan/45/2007)
aagcttctgcag atg gcg aac aat atg acc aca aca caa att gag gtg ggt ccg gga gca acc aat
gcc acc ata aac ttt gaa gca gga att ctg gag tgc tat gaa agg ctt tca tgg caa aga gcc ctt
gac tac cct ggt caa gac cgc cta aac aga cta aag aga aaa tta gag tca aga ata aag act
cac aac aaa agt gag cct gaa agt aaa agg atg tcc ctt gaa gag aga aaa gca att gga gta
aaa atg atg aaa gta ctc cta ttt atg aat ccg tct gct gga att gaa ggg ttt gag cca tac tgt
atg aaa agt tcc tca aat agc aac tgt acg aaa tac aat tgg acc gat tac cct tca aca cca ggg
agg tac ctt gat gac ata gaa gaa gaa cca gag gat gtt gat ggc cca act gaa ata gta tta
agg gac atg aac aac aaa gat gca agg caa aag ata aag gag gaa gta aac act cag aaa gaa
ggg aag ttc cgt ttg aca ata aaa agg gat atg cgt aat gta ttg tcc ttg aga gtg ttg gta aac
gga aca ttc ctc aaa cac ccc aat gga tac aag tcc tta tca act ctg cat aga ttg aat gca tat
gac cag agt gga agg ctt gtt gct aaa ctt gtt gcc act gat gat att aca gtg gag gat gaa gaa
gat ggc cat cgg atc ctc aac tca ctc ttc gag cgt ctt aat gaa gga cat tca aag cca att cga
gca gct gaa act gcg gtg gga gtc tta tcc caa ttt ggt caa gag cac cga tta tca cca gaa
gag gga gac aat tag aagcttctgcag
a : Adenine
c : Cytosine
g : Guanine
t : Thymine
HindIII PstI
HindIII PstI
80
APPENDIX B
NS1B protein sequence (281 amino acids)
MANNMTTTQIEVGPGATNATINFEAGILECYERLSWQRALDYPGQDRLN
RLKRKLESRIKTHNKSEPESKRMSLEERKAIGVKMMKVLLFMNPSAGIEG
FEPYCMKSSSNSNCTKYNWTDYPSTPGRYLDDIEEEPEDVDGPTEIVLRD
MNNKDARQKIKEEVNTQKEGKFRLTIKRDMRNVLSLRVLVNGTFLKHPN
GYKSLSTLHRLNAYDQSGRLVAKLVATDDITVEDEEDGHRILNSLFERLN
EGHSKPIRAAETAVGVLSQFGQEHRLSPEEGDN
A : Alanine M : Methionine
C : Cysteine N : Asparagine
D : Aspartic acid P : Proline
E : Glutamic acid Q : Glutamine
F : Phenylalanine R : Arginine
G : Glycine S : Serine
H : Histidine T : Threonine
I : Isoleucine V : Valine
K : Lysine W : Tryptophan
L : Leucine Y : Tyrosine