Telit Communications PLC I telit2market international I Issue 06
I May 2011 I www.telit.com
ISSUE
06 11
telitTelit World Customer Applications >> 57
2marketThe Telit m2m MagazineDeutsche Telekom International m2m
Partner Portal >> 126
Beecham Research Towards Internet Everywhere >> 110
Telits Motorola M2M Acquisition A Further Success Gene > 12
>
Innovation and Passion: The Basis for Successby Oozi Cats
>> 04
Interviews with: Reports by:Korean Communications Commission
>> 38 KT, Korea >> 42 Magneti Marelli, Italy >>
104 China Telecom >> 106 Connected Development, USA >>
112 Robert Madelin, European Commission >> 92 Antonio Calmon,
Kaitech Consulting and Flavio Sakai, Continental Brazil >> 95
Prof. Dr. Axel Sikora, DHBW Lrrach, Germany >> 99 Dr. Roman
Friedrich, Booz & Company, Europe >> 102
2
06I11 CONTENT03 TELITInTro Chicco Testa, Chairman of the Board
Telit Communications PLC Oozi Cats, CEO Telit Communications PLC
Alexander Sator, Board of Directors >> Most companies would
confidently claim Telit Communications PLC portfolio to have their
product control, regardless of whether underYossi Moscovitz, COO
Telit Communications PLC they provide products or services. We
believe, however, that most companies Dominikus Hierl, dont
knowTelit Communicationsall, which CMO their portfolio at PLC
probably sounds rather odd, but its true. Gideon Rogovsky, CEO
Telit Wireless Solutions Israel First of all, lets think about what
a product actually is. People would usually consider a14
TELITcompETEncE product to be something a company manufactures,
processes, or refines and then goes R&D Challenge and Chance on
to sell for a profit, thereby contributing to Automotive R&D
Team increase the corporate value. And in this 2011 Telit Quality
indeed respect, companies do Challengeknow their The Telit well.
After all, they products quite Technical Forum have sales teams,
product and service management, key account organizations, and they
under20 TELITproducTs take market research, supply chain analysis,
costing and much more. direct Leading Change through The
departments New Product Development portfolio involved in the
product research and development, purchasing, pro Re-evolution in
Remote Control duction, sales make up a companys core via GSM
functions. These departments also have the Cellular Product Range
Cellular Product Range MOT by Telit The New Telit ISM-Band Product
Family The Telit Combined Wireless Offer for the Internet of Things
GPRS to Wireless M-Bus and Universal ISM Gateway Short Range
Products
TELITLIvIng
TELIT2MArKET 06|11
44 TELITgLobaL Telit EMEA: Telit Communications Year in a
Nutshell Telit North America Update Telit Latin America: Blossom
the Seeds of Success Telit APAC Update most members sitting on the
board. So, yes, companies do take their product portfolio
seriously; in fact, theres nothing a company 48 TELITgrEEn takes
more seriously than its product port Tracking Imperial Eagles in
the Balkans folio. That is, if youre looking at a product from this
traditional point of view.
116 TELITsaLEs Telits Sales Force Two is Better than One when
Talking about Customer Focus
118 TELITcompETEncEcEnTEremissions Competence Centers Telit or
when we reward them for contributing to apprenticeship programs.
Technology Evolution and the And, of course, when communication
crises Challenges of LTE Module Integration develop into company
crises and pose real threat to corporate value.
50 TELITworLdBut you can also take another perspective m2m
Connectivity for Elevators and consider all that a company
generates as Going Wireless The Future of GSM output to be its
product. From this perspecTechnology in the Metering Market tive, a
mechanical engineering companys Customer include machines, the
waste portfolio would Applications water generated during the
production process and even the apprentices under training. 92
TELITExpErTTaLk And, of course, communication. Particularly
Interview Its Robert Madelin, communication.withan output that no
comInformation Society and Media pany can avoid. (European
Commission) Interview with Antonio Calmon, Fromproducttooutput
Kaitech Consulting sociopolitical perFrom an economic and and
Flavio Sakai, Continental Brazil spective, this does indeed make
sense and is reflected in processes and structures for Interview
with Prof. Dr. Axel Sikora, instance, when we talkBaden-WrttemDuale
Hochschule about companies financial responsibilities for their CO
2 berg, Germany Interview with Dr. Roman Friedrich, Booz & Co.
GmbH
122 TELITprEssNowadays, it is essential that companies Global
Communication for a focus on their output. Long gone are the days
Global Brand when customers, employees, partners, NGOs, Successful
Communication governments, the financial community and through all
Channels the media were only interested in a companys products in
the traditional sense. When it comes to evaluating a company, even
in 126 TELITparTnErshIps economic terms, greater importance is now
Deutsche Telekom launches being attached to its entire output,
especially International m2m Partner Portal to its communication.
m2m Solution Factory Successful Networking with Deutsche companies
It is therefore high time that Telekom Sprint is the One Trusted
Partner move from product management to output for m2m management.
Essentially, this means that they need to manage all elements of
their output portfolio proactively and profession130 TELITLIvIng
ally and view them as core functions that Treat Communication as a
Core drive corporate value. Product
104TELITmarkET Holistic Vision for Sustainable Mobility
Facilitating Low-carbon Economy through The Internet of Things
Towards Internet Everywhere Whats driving Growth in m2m for 2011
and beyond?
IMPrINT telit2market: The global magazine for clients and
partners of Telit Wireless Solutions Published by: Oozi Cats, CEO
Telit Communications PLC Chief Editor: Alexander Bufalino, VP
Global Marketing Concept and Design: Pantos Werbeagentur GmbH,
www.pantos.de Copyright: by Telit Communications S.p.A.
Circulation: 67,000 annual reader Service:
[email protected]
38 TELITsTory Gearing Up Towards a Smart Environment Service
Enablement Services: Catalyst for Change in m2m An Outline of the
m2m Business and Strategy at KT
115 TELITdIsTrIbuTIon Telit Around The World
EMEA Telit Communications S.p.A. Via Stazione di Prosecco, 5/B,
34010 Sgonico (Trieste), Italy Ph: + 39 040 4192 200, Fax: +39 040
4192 289 [email protected], www.telit.com
North America Telit Wireless Solutions Inc. 3131 RDU Center
Drive, Suite 135, Morrisville, NC 27560, USA Ph: +1 888 846 9773,
Fax: +1 888 846 9774 [email protected], www.telit.com
Latin America Telit Wireless Solutions Inc. Rua Cunha Gago, 700
cj 81, Pinheiros, So Paulo SP, 05421001, Brazil Ph: +55 11 2679
4654, Fax: +55 11 2679 4654 [email protected],
www.telit.com
APAC Telit Wireless Solutions Co. Ltd., APAC 12th floor,
Shinyoung Securities Building, 34-12, Yeouido-dong, Yeongdeungpo-gu
Seoul, 150-884, Korea Ph: +82 2 368 4600, Fax: +82 2 368 4606
[email protected], www.telit.com
TELIT2MARKET 06|11
TELITINTRO
3
+++News+++Telit introduces worldwide smallest 3.75G penta-band
module for industrial and consumer applications +++
RedtailTelematicstapsTelitforautomotiveassettracking+++PomdevicesmHealthsolutionSonambaconnects
seniorstocaregiversusingTelitmodule+++JanusRemoteCommunicationsannouncesPTCRBcertificationfor
theirnewGSM/GPRSPlug-InTerminus +++
TelitcompletesacquisitionofMotorolaSolutionsm2mmodules businessunit
+++ Telitsfuture-proofHEmoduleseriesoffersextensivefunctionality
+++ Telitdevelopstesting platformforeCALLapplications +++
WorldssmallestGSM/GPRSmoduleTelitsGE865-QUADinNAVIGON's70
PremiumLiveembedded +++
TelitlaunchesworldsfirstOnlineTechnicalSupportForumform2m +++
Telitm2m modulepowersnewCDMAterminalfromJanusremotecommunications
+++ CoyoteSystemexpandsitsuseofthe worldssmallestGSM/GPRSmodule +++
Telitsupportssmartmeteringinitiativeswithenergy-efficient,wireless
M-Busmodule +++
TelitexpandsitsportfoliowithmodulesfirsttimeusingLCCcastellationpackaging
+++ New Walsh Wireless usage-based car insurance device fueled by
Telit cellular module +++ Telit starts to distribute
directlyinGauteng,SouthAfrica +++
Telitsgloballycompatible3GCellularModuleearnscertificationonAT&Ts
NationwideWirelessNetwork +++
TelittechnologycertifiedtoconnectsmartdevicesovertheVerizonwireless
network +++
TelitandTobehavestruckadealontheproductionofthesmallesttrackingdeviceintheworld
+++
Dear Reader, 2010 has been a year of recovery for the global
economy, and the m2m market was no exception. Within this context,
we have maintained focus on continued organic revenue growth which
we have increased by 48.2% over the 2009 mark with significant
improvement in operating and net profitability levels, resulting in
net profit of $7.6 million. The transfer of manufacturing to China
was substantially concluded by the beginning of 2010 and provided
us with the competitiveness and flexibility needed to support
continued revenue growth and increase in market share. The m2m
market is growing fast and continuously. New segments are regularly
emerging and existing ones expanding; new application areas surface
requiring innovative technologies, and new technical possibilities
are bringing additional applications in their wake. Telit can and
will continue to rise to the demands from this permanent cycle. Our
investments in research and development, production and quality
assurance will continue in the future to secure the innovative
power and strong performance that are distinguishing features of a
successful global player. We expect to maintain organic growth in
addition to growth expected from the acquisition of Motorolas m2m
business unit, completed in Q1 2011 and which should enable us to
improve our operating and net profit margins beyond the 2010
levels. These factors are all underpinned by a further fundamental
aspect of our company: a highly motivated, extremely committed team
characterized by outstanding loyalty and reliability. Telit has
from the outset been built on the pillar that its human capital
represents one of its most decisive competitive factors. We look to
2011 and beyond with great excitement as we continue to gain market
share in our bid to achieve our strategic goal becoming the number
1 supplier to the m2m market.
Enrico Testa Chairman of the Board Telit Communications PLC
flexibility
e ormancerforcom tronovaterf owstrong p mance s inng p ive p e r
ower innovative pgrowthss competitiveneted team
ted team highly motiva
venes i y
growth
4
TELITINTRO
TELIT2MARKET 06|11
INNOVATIONANDPASSION:THEBASISFORSUCCESS.
Oozi Cats, CEO Telit Communications PLC
>> Welcometothe6thissueoftelit2market. I am happy to
report about an important strategic milestone that depicts the
impressive development of Telit during
thepastfewyearsandatthesametime
representstheimportantbasisforTelit's
successfulfuture:thetake-overofm2m modules from Motorola Solutions
and theircompleteintegrationintotheTelit
productandperformancerange.
Marketshare2009
Marketshare2010
Sagem 2,9% Enfora 5,0% SIM 4,2%
Others 16,4 Motorola m2m 4,8% Telit 12,4%
Rest of market 78%
Telit 22%
17,2%Sierra Wireless 26,3 Cinterion 28%
Source: Beecham Research, August 2010
Source: Own Research, August 2010
With the acquisition of the m2m division of Motorola, Telit now
owns a market share of approximately 22% according to the latest
market studies conducted by Beecham Research, determined based on
values as of December 31, 2010. Consequently, Telit is part of the
three global leaders on the m2m market, jointly accounting for an
estimated market share of 70%. This impressively increased market
significance is an important prerequisite for the successful
implementation of our plans to boost growth on the m2m market in
the future. We not only achieve noticeable synergy effects with
respect to our cost structure, but also possess extensive research
and development capacities, allowing us to offer our customers a
broader product portfolio and more comprehensive support for the
long-term. In other words, the role of Telit on the m2m market is
expected to gain further significance during the next few years.
First, however, I would like to address a number of other important
developments and events that took place at Telit during the past
few months.
TELIT2MARKET 06|11
TELITINTRO
5
Revenues($mil)199.5(*) 200 180 160 140 120 100 80 60 40 22.8 20
0 2005 2006 2007 2008 2009 2010 2011 37.8 88.8 86.9 71.5 131.7
(*) Market expectation based on analysts' forecast (April
2011)
ModulesRevenue
li Te
4 t+
8%
Strong past. Even stronger future. Contrary to the global
decline in the m2m industry, we ended 2008-9 on a positive note
with 24% growth, creating a solid base for 2010 with sales of $132
million representing organic growth of 48%. And a continuing
organic growth is what we strive for the next years, additional to
growth that will come from acquisitions. Offering services is
another important strategic step for Telit. The continuous
corporate growth throughout the past years helped Telit achieve the
critical size that allows us to assume a significant role also in
this segment. The quantity of sold modules and as a result the
number of cellular devices respectively of subscribers is now large
enough to make the cooperation very lucrative for mobile network
operators. Telit will become a very interesting player in this
sector, being able to offer connectivity as well as backend
services and value added services such as remote network management
and FOTA in the future.
Setting standards with successful products.January 2010
M ellular m2mC
Mar ke odules
% t+20,2
Our products are the main pillar of our sustainable success.
Virtually no other than Source: Beecham Research, August 2010 the
m2m market is growing at an equal pace, developing new fields of
With respect to the year 2011, we are already application and
demanding new product so- able to demonstrate our innovative power
lutions. Telit has been effective in facing these with two new
modules. The HE863 family new challenges making use of the
resulting provides 3.75G wireless data connectivity, opportunities
with equal success, driven combining access to HSPA networks, GSM,
amongst other things by American and GPRS and EDGE services with a
standalone European laws within the scope of climate A-GPS receiver
in a compact ball-grid-array protection treaties. With the new ME50
module form factor. One of the great advantages the smallest and
most powerful product on is the feature scalability: Many product
the wireless M-bus market Telit is setting variants are available,
all featuring the same clear standards. Together with the GE865
form factor, available with or without voice module launched in the
spring of 2009 still and/or without GPS and in addition with the
smallest GSM/GPRS quadband module in different pairs of HSPA band
support. With the world Telit is the only company offering the
HE910 module, Telit is launching the a perfect product combination
for automatic smallest m2m module in the world with meter reading
applications, effectively de- 5-band HSPA+ on the market. Full
global fending its position as one of the technological coverage is
provided in a single package, leaders on the m2m market.
eliminating the need to swap the device for
December 2010
6
TELITINTROchannels in 2010. Almost nothing is more valuable for
a company than feedback both positive and negative from customers
and decision makers to recognize trends and needs, optimize product
developments and obtain an adequate feel for changes on the market.
Therefore, Telit will continue the intensive use of Twitter,
Facebook, LinkedIn etc. extensively, continuously and globally.
Successfully global. Globally successful.HE910
TELIT2MARKET 06|11
mandatory in all new cars were already felt in the previous
year. This boom continued in 2010 and is expected to persist this
year too. Please read page 95 onward for an interesting extensive
interview with a specialist about this topic. An additional thrust
for the m2m market is expected to emerge in connection with the
"fiscal printer law". According to this law, any cash registers
issuing receipts to customers must be connected to the government's
tax collections agencies. The first devices equipped with Telit
modules will be officially commissioned this year. The operating
profit of Telit for 2010 was also extremely positive in our fourth
region, APAC. In Korea, Telit has been the market leader since
2006. In 2010, it achieved an additional upswing thanks to an
initiative from the Korean government. The Korean Communications
Commission established the program "m2m Roadmap" aimed at making
Korea a leading information and communications technology location.
This allowed Telit to intensify its collaboration with the
government. Amongst other things, Telit secured the supply of the
Korean Meteorological Administration. They are working to provide
accurate weather forecasts by means of widely used measuring
stations, equipped with the BCM-865 module. The business
development in China was extremely positive again in the past year.
The sales have doubled compared to 2009. The launch of our
GE865-DUAL module on the market, presented to more than 100
engineers within the scope of an event in Shenzhen at the end of
the year generated a buzz. With this product, the smallest GSM/GPRS
surfacemounted module on the market, Telit offers
GE864-GPS ME50-868
different frequencies and countries, and the LGA package
provides an ultra-low profile for your integrated solution and
reduces costs, especially for high-volume applications. Added value
performances. It is one thing to develop innovative and powerful
products. We believe that providing customers with additional
support and comprehensive service is also part of a company that
strives to be successful in the future and to maintain its leading
role on the market. Therefore, Telit has established the Telit
Technical Forum last year. It connects system integrators,
developers and partner companies around the world on an online
platform where everybody can ask questions, discuss them and obtain
assistance from Telit global technical support teams. Already more
than 700 members in more than 55 countries benefit from this Telit
support channel. For us, this demonstrates that the demand for
powerful offers exceeding the actual module is very high and
constantly rising. Success factor customer focus. The dialog with
our customers continues to be and has always been a key aspect of
our actions. We are convinced that the dialog with customers,
users, prospective clients and any other target groups is one of
the essential competitive factors for sustainable success of a
company. For this reason, special attention was paid to the
expansion of the communication across all important social
media
The year promised to be successful for EMEA as early as in the
spring of 2010. The commitment of our sales team along with the
constant support from our technical and engineering teams helped us
make big strides forward. For example, in April we announced the
delivery of the two millionth GE864 module. Shortly afterward, the
decision was made to equip the new Audi A8 with the Telit module
UC864-E-AUTO. These outstanding achievements motivated the entire
organization to forge ahead with the development and realization of
new, innovative and successful products during the remainder of the
year, together with expanding the R&D units in Trieste,
Cagliari, Sophia Antipolis, Tel-Aviv and Seoul. This has created an
ideal basis for future growth. Furthermore, 2010 was an extremely
successful year for our organization in North America. Major growth
was achieved mainly in the commercial vehicle telematics, buy-here,
paythere and pay-as-you-drive auto insurance markets. Please read
the chapter "Telit World" for detailed information about
applications our customers Consumer Safety Technology, Danlaw,
iMetrik and Redtail developed and successfully launched on the
market in this segment. The successful business development of the
past years continued in Latin America in 2010. On the one hand, the
m2m market continues to grow across all segments and on the other
hand, this development was strongly supported especially in Brazil
with legal regulations. Positive effects of the automotive law that
makes theft prevention
www.telit.com/twitter www.telit.com/facebook
www.telit.com/linkedin www.telit.com/xing
www.telit.com/techforum
TELIT2MARKET 06|11
TELITINTROful enhancement of our product portfolio. The
continuation of the Motorola products will therefore be guaranteed
for as long as their manufacture is feasible from a technical point
of view. On the other hand, Telit now boasts a significantly
improved R&D qualification. With the integration of the newly
added, highly skilled R&D team in Tel Aviv, Telit now has a
total of five R&D locations worldwide. This once again
emphasizes our focus on the further development of trendsetting
cellular and short-range modules. Aiming at the future. We are very
well aware of the significance of the acquisition of the Motorola
m2m division for Telit as well as the entire m2m market. Our
responsibility for the new colleagues is our priority in this
context and the rapid integration of the entire team into the Telit
family is very important to us. Within this context, the further
optimization of our organizational structure therefore plays an
essential role. Yossi Moscovitz takes over as the President of
Telit Wireless Solutions. In strategic issues he will primarily be
supported by Golan Haver, VP m2m Strategy. The responsibility for
the areas of Global Quality, Global IT and SAP Integration lies
with COO Mathi Gurusamy, who is an experienced and skilled
specialist in these fields. The key field of Research and
Development will be led by Sandro Spanghero, Global VP R&D.
This includes, among other things, the new R&D Center, the
company's fifth, located in Tel Aviv and the contribution of Danny
Israeli as well as the newly established organizational area
"Automotive R&D, headed by Massimiliano Lonzar. As CMO,
Dominikus Hierl heads the areas of Sales, Marketing, Global Product
Management as well with Telit RF the Short Range division, and as
Global VP Mike Ueland in addition to North America is also
responsible for the area of Value Added Services. The previous VP
Telit APAC, Gideon Rogovsky, now takes over as CEO Telit Wireless
Solutions Israel and thus has overall responsibility for the
integration of the Motorola m2m division in the Telit organization.
All other management positions remain unchanged. So we can
guarantee the perfect combination of new spirit and solid
continuance. The positive effects on the company's performance are
just one aspect. Also in light of our new customers, the smooth
transition is our ultimate goal. We want to guarantee the
continuing availability of Motorola products, but also convince and
inspire them about Telit's innovative capability and
efficiency.
7
the perfect module for mobile applications and high-volume
manufacturing across all industries in the low unit price segment.
To be able to meet the large demand in China in the future and to
ensure optimal customer focus, Telit has now established offices in
Shenzhen and Shanghai with a total of ten employees. The
solidification of our relationship with our manufacturer BYD in
China is certainly one of the most strategically relevant aspects.
By awarding BYD the "Telit Strategic Supplier 2010 award, the
outstanding achievements associated with the development of the
production were honored as much as the reliable and mutually
successful cooperation. This appreciation was reasonably expressed
with a visit from a Telit delegation at the BYD headquarters in
early December and the festive conferral of the award during a
celebration. Focusing on strengths. The past year has especially
shown how much a dynamic market such as the m2m market can change
and with which new developments whether technical or of a
structural nature it can suddenly generate new situations. This may
tempt some enterprises to advance into new sectors and to develop
completely new business fields. In contrast, Telit has always been
pursuing the clear strategy of focusing on the development and
production of modules and offering services that represent a
meaningful and especially value adding supplement to these modules.
As a result, Telit is the only global player on the m2m market
fully focusing on its core competencies, continuing to expand its
strengths and as a result standing on a strategically and
technically efficient foundation. Our achievements prove that we
are on the right track and we will continue to pursue this track
consistently and confidently in the future. The recent acquisition
of the Motorola m2m division has therefore been a logical step for
Telit. On the one hand, it results in a meaning-
Additional noticeable changes are expected on the m2m market in
the near future. They are due to technical and demand-related
reasons as well as economic, political or even environmental
circumstances. We may sense or at least realize early what the
future holds, but we cannot predict it accurately. Telit has been
very well prepared for new situations in the past. With our new
size, our innovative spirit, our passion for new things and not
lastly our extensive know-how, we will have the required power to
remain one of the most successful m2m enterprises in the future.
AtTelitweareveryproudoftheachieteam of seasoned m2m experts, adding
their expertise and resources an all operational levels to Telit.
Staying true to our product strategy of consistency and long-term
product availability, the newly acquired Motorola m2m product
portfolio will be continued; product support will be even improved.
Telit will invest the necessary resources to make customers using
Motorola products in their solution successful in the market for
existing and new designs. Telits leverage from the substantially
larger business size assists us with regard to managing suppliers
and EMS partners, while product certifications are all to be
finalized as planned. As the market continues to grow, Telits
market share continues to rise. According to market research, in
2010 the total m2m market was about 900 million dollars in size.
The combined market share from Telit and Motorola m2m represented
approximately 20% of that total. This marks a huge jump from the
12% the year before and gets us very close to our two main
competitors presenting strong evidence that we are indeed heading
for global leadership in the market. Telit is currently offering
the broadest product portfolio in the m2m space, supporting
different cellular and short-range wireless technologies for the
global markets. In order to create additional growth opportunities
for the company, we identified the enhanced value of bundling our
first-tier products with relevant services around m2m, enabling
customers to implement m2m systems in a much quicker and more
efficient way. We are confident that this strategy will give us the
push to become the absolute market leader in the global m2m space
within a very short time. This new stature in strength translates
into additional benefits for all our customers, as we continue to
pledge our ever-growing expertise and support capabilities to make
them successful in the global market. > I am pleased to announce
that Motorolas m2m Solutions division and Telit have united and are
now officially operating as one entity. This new structure unites
two market leaders in the m2m Wireless Industry serving various
vertical markets such as automotive, AMR, security, and others.
Together, we are uniquely positioned to provide the m2m market with
a full portfolio of modules supporting all cellular wireless
technologies: GSM/GPRS, EDGE, CDMA and HSPA. The combined company
will operate as Telit Israel with offices in Tel Aviv. Acquiring
the Motorola m2m division has brought about a unique opportunity
for Telit to open an R&D center in Israel. The Motorola m2m
team brings extensive knowledge, experience and professionalism
needed to elevate this journey into a success story. As always, our
goal is to continue delivering innovative, high-quality products to
our current combined markets. To accomplish this, we will adhere to
the established product roadmaps for our existing vertical market
solutions while simultaneously exploring opportunities to provide
customers with additional value for existing and new market
segments. We are confident we have done the utmost to ensure our
business relations with our partners continue as before. In the
event that there are any unforeseen issues after the conclusion of
the transition, contingency plans have been put in place which
provide for quick matter resolution. We would like to thank you
very much for your trust as we look forward to continuing
cooperation. About Motorola Motorola, Inc. has been at the
forefront of communication inventions for over 80 years and is
leading a wave of innovations that enables people, government
and enterprises to be more connected. Motorolas wide-ranging
portfolio of technologies and solutions span a range from consumer
wireless handsets and in-home digital entertainment devices to
government and public safety mission-critical systems and
enterprise mobility products worldwide. In 2009, Motorola (NYSE:
MOT) generated revenues of US $22 billion. About Motorola m2m
Solutions Motorola m2m Solutions, part of the greater Motorola,
specializes in the design, development, integration, evaluation,
and deployment of m2m applications worldwide, serving largescale
customers such as: Continental, BMW, Harman-Becker Automotive, Tyco
Safety Products, Essence Security and SmartSync Smart Grid
Intelligence. Motorolas m2m division has been considered industry
leader with over 12 years experience in m2m product development and
a reputation of long standing partnerships with carriers worldwide,
enabling quicker expedition of approvals by AT&T, Verizon,
T-Mobile, Telefonica, Vodafone, Orange, and many others. In
addition, the organization brings over 9 years of experience in the
automotive arena working with 12 automotive manufacturers including
Continental, BMW, and Volvo. Telit will continue working hard to
earn its customers business, and I want to personally thank you for
your loyalty and support. I would like also to use this opportunity
to welcome all the new employees that joined Telit Israel and to
wish them a long, rewarding, and fruitful career at Telit. >
Talking about technology is always
Sandro Spanghero, global VP R&D Telit Communications PlC
challenging and sometimes dangerous but for an IT company it is
a mandatory and obvious requirement. At Telit we are accustomed to
analyzing mature and new technologies using a particular magnifying
glass: the requirements of m2m.Looking at communication
technologies from this point of view it is possible to perceive
some differentiation factors that are not present in consumer
products. An example of this peculiarity pertains to the GSM/GPRS
technology. It is very well known that this communication standard
specified in the 1980s is so fully mature that it begs the
question: why continue investing in it? This rationale whereas
quite legitimate for consumer products with the exception of some
emerging countries is not applicable to our market segment. Even
now in 2011, more than 20 years after the market introduction of
GSM technology, the m2m world finds itself focusing substantial
effort in 2/2.5G devices and applications, with carriers pledging
to continue maintaining their existing infrastructure for this
generation of cellular technology for years and years to come. And
this
is the reason why Telit started the development of the so called
V2 platform in 2008, launching the first product in that platform
in 2009, later completing the migration of the roadmap and also
adding new products based on the GL865 form factor. This platform
will now extend the life of GPRS products in the Telit portfolio to
GE864-QUAD 2016 and beyond. Automotive V2 But the implementation of
a new platform is not only motivated by new component introduction,
it is much more than that. As per our strategy, V2 products have
maintained all features present in our previous platforms while
several new features and optimizations that were not possible to be
offered in the previous Lite platform have been added in V2. One
such new feature that immediately comes to mind is idle current
consumption, which is a very relevant parameter for several m2m
applications: this value has been reduced by about 40%. Another is
the implementation of Release 4 of the 3GPP protocol
layer which imposes much more severe control over the emitted
power from the mobile station. Relevant developments, specific for
the automotive grade products based on the V2 platform include the
implementation of an in-band modem feature subject of a specific
white paper available in the Telit web site, and VDA certification,
level 2A. The pie diagram in Figure 1 shows the results of the
different audio parameters measured in a controlled test
environment using standard components for the audio path and using
only the echo cancellation parameters embedded into the GE864 Quad
Automotive V2. These two features will allow customers to develop
low cost e-call applications without using sophisticated external
components providing the required flexibility for tuning the
application to successfully pass stringent automotive industry
requirements. However, these very important activities in GPRS
technology are not in any way compromising development work related
to 3G platforms. It is clear that whereas GPRS is still the main
technology used by the m2m market, the trend is that in the next
five years this will
Figure 1: VDA -2A Audio test results
Figure 2: Module shipment by technology
(Source: ABI Research)
TELIT2MARKET 06|11
TELITCOMPETENCE
15
HE863
HE910 world's smallest 5-band HSPA+ module.
market introduction of the new HE863 variants, a new HSPA
Automotive platform that will be introduced in 2013 an updated EVDO
product mainly for US market and a new low-cost CDMA platform for
global markets. In parallel the R&D team in Trieste, Italy has
from the beginning of 2010 been involved in the alignment of the
Telit AT interface and features across the different cellular
platforms 2G and 3G, and in the development of the new HE910, that
will once again, become the markets smallest module in its
category. In 2011 Telit will definitely confirm its leadership not
only in 2.5G product offerings but also in 3G and 3G+ as a result
of its long term investments and commitment. A different R&D
approach is required for short range communications devices. Telit
has two groups working with this technology area. The first is
located in Sophia Antipolis, France. This team because of its
platform expertise has responsibility over short range products
using ZigBee, M-Bus, IEEE802.15.2, and our proprietary protocol.
The other team, located in Cagliari, Italy, is in charge of the
work to integrate short range and cellular technologies into
applications and gateways which bridge local short range to
cellular. These two teams will be integrated into sharing
responsibility for offering complete solutions from sensor to
internet. change. As can be gleaned from the ABI Research graph on
shipments by technology in Figure 2, GPRS volumes remain almost
flat in the next five years, while market growth comes from
different technologies, mainly WCDMA but also EVDO and then LTE. It
is clear that 3Gs real market introduction will be propelled by
specific segments such as automotive where Telit is already
supplying the UC864 E Auto and the UC864 AWS Auto for European and
North America markets respectively but many others will follow. For
this reason Telit R&D investments into 3G platforms are
growing, already representing more than 50% of the total
departmental budget. The R&D team located in Seoul, Korea, that
focused from the beginning on WCDMA and CDMA products is in charge
of maintaining the UC864 and CC864 platforms, but also the Because
there are many aspects in the deployment and implementation of
communication systems which make them much more complex than the
simple cellular, requiring deep understanding of different
technologies from the device as well as the network point of view
and also in this case the investments that Telit continues its
commitment, reaffirming its willingness to continue playing as the
leader in m2m. > A new team focused on the automotive market has
been created in the Telit organization with the purpose of
enhancing support and services targeted at this strategic segment.
This new team will report to the global R&D organization and
will be focused on the various aspects of compliance with the
stringent automotive market requirements.
Different groups inside this new department will provide their
support to the different phases of development. One group will be
focused on field testing and software validation with particular
attention to those features demanded by automotive integrators in
addition to a much deeper analysis of interoperability of the
modules with the different network operators. Another group will be
focused on the so called Reliability Validation which include PPAP
testing and verification, HALT testing and so on. A third group
will offer first and second level of technical support and will
respond directly to our automotive customers developers to support
integrators
in the design phase. Finally, a fourth group will be focused on
all issues related to the interactions among different functions
inside the company including R&D, purchasing, quality, test
engineering, and others. The aim of this group will be to schedule
and harmonize activities of these different departments managing
toward total satisfaction in response to the demands coming from
these customers. This is just the beginning. Most probably, in the
2012 issue of the magazine, we will be reporting back to you the
results and experiences in a much more detailed article. >
Telits quality challenge for 2011 is to prepare and implement an
adequate approach to support the companys business growth scenario.
By the middle of 2010 it was clear that Telit was looking at a
growth trend to result in a definite increase in the complexity of
operations. To support this, the quality department is implementing
new procedures and rules based on simplicity and clarity with the
objective of establishing relationships among the various company
processes and to proactively align each resource involved in
business processes. This means that in the near future, changes
will take place on how functions approach their activities so as to
establish new workflows characterized by open-mindedness and
creative attitudes.The Telit quality department currently
implements an interdisciplinary self-improving program to make all
corporate processes more adaptive, optimizing all efforts, and
keeping them synchronized towards the global mission of our m2m
business. A definition that encapsulates this concept well states
that quality is the on-going process of building and sustaining
relationships by assessing, anticipating, and fulfilling stated and
implied needs, where such needs belong to five different players.
The most important one is the market and customer who expects
products and services delivered with all needed requirements, on
time and well supported. For such mission, the following Telit
functional areas are involved: Top management creating a vision for
the company, providing guidance to the busi-
ness, addressing the mission statements with sustainability and
profitability requirements; Research and Development continuously
evolving the companys technology portfolio, designing products and
services to be more competitive; Operations manufacturing m2m
devices free of defects, in compliance with requirements from
different market segments particularly smart-metering and
automotive; Sales providing Telit customers with high quality
technology offerings and solutions customized to fit specific and
different requirements.
Intellectual Property, and standardization, which are very close
to top managements vision statement definition, and have the
ability to inject innovation in all company processes; Long-term
project planning, also used for allowing participation in public
bid calls. Long term projects are developed according to the
companys business vision and are designed to support Research and
Development strengthen its know-how assets; Quality audit modeling,
as applied with customers and markets, is also used in support of
the execution started after the above mentioned public bid calls
applications. Project planning in the framework of public bid calls
is quite a relevant asset of to the quality mission, which goes a
long way to ensure competitiveness for the companys business. Over
the past five years, there have been many success stories with
different projects developed also with the European Community.
These include the Emily and Euridice projects, with MiSE the
Italian Ministero dello Sviluppo Economico that was fundamental in
the establishment of the Telit R&D Center in Cagliari; the
effort with the local Friuli Venezia Giulia Region administration
which strengthened the knowledge assets of Telits most important
R&D Center in Trieste. In order to address our expected growth,
an important new R&D project is ready to be implemented, with
activities set for the next
Figure 1: Telit macro-areas
An efficient relationship among these functions requires a
dynamic approach both fluid and forthright. In such a
multi-articulated scenario, quality has to balance the different
roles with assignments of procedures and rules to allow them to
cope with the increased complexity. In this scope quality manages
through different methods:
18
TELITCOMPETENCE
TELIT2MARKET 06|11
Top management Business Vision and Company mission Creativity
Intellectual Assets
Design FMEA, 8D; International Material Data System (IMDS);
Reliability and Failure analysis; and lot traceability. Telit
quality is not just about inspection, process control, material
selection. It covers the all elements involved in delivering
products and services and in order to achieve the 2011 challenge,
quality intends to strengthen the implementation of design for
manufacturing (DFM) to simplify the manufacturing process,
minimizing risk.
growth Know-howProcedure and Proces Control Sales and Customers
marketFigure 2: Quality growth driven a challenge for Telit
Standard and Qualification Compliance R&D and operation
four years. So from qualitys responsibility and perspective the
function will continue to observe and provide measurements and
feedback to better steer the fantastic growing business of m2m
implementing procedures for employees, customers, and external
resources, with the main objective of changing the work culture
accordingly. Telits quality philosophy is to facilitate the
adoption of a responsible and active approach, based on the premise
that whoever is directly involved with an issue holds the most
in-depth knowledge of said issue and is in the best position to
produce the best resolution to it. In support to its mission, Telit
quality has consolidated quality assets that have been in effect
for a long time, and that are continuously improved: ISO 9001
certification extended to the corporate level. In particular with
respect to R&D laboratories ensuring that R&D labs, located
in different areas and devoted to different technology segments,
apply the same rules and methods in their activities; ISO 14001
certification in effect at the Trieste facility covering compliance
with environmental and Green practices for eco-friendly design and
manufacturing; Quality uniformity which aims to maintain production
from all contract manufacturers at equivalent quality levels. This
is assured by continuous and constant control on production
processes, with resident quality teams,
and by quality procedures and methods that ensure that
components, manufacturing processes, testing and programming phases
are the same in all manufacturing plants located in the different
geographical areas. Most of Telits contract manufacturers are
compliant with automotive grade manufacturing requirements as
established by the ISO TS 16949 certification process. That
dovetails with Telit R&Ds design processes for automotive
segment, with implementation of the Production Part Approval
Process (PPAP); Process and
Telit has also recently added another achievement to its
competitiveness arsenal: accreditation according to the Annex V
R&TTE Directive of R&D testing laboratories with respect to
measurement instruments and methods. Such accreditation allows
Telit quality to autonomously issue CE declaration of conformity
resulting from our own R&D lab measurement reports. This
achievement is absolutely important to qualify the company, and its
ability to deploy to market innovative and competitive m2m
technologies to be used by the Telit customers in their successful
business. > Services >> Technical Forum and register.
Attend to the discussions and contribute your valuable experience
to the growth of the m2m community. > The idea to create a
Technical Forum
and to publish it on the Telit web site had been in our minds
for a long time. The outcome we were looking for was to put in
contact individuals who live daily in the m2m world to share
experiences, to discuss open or already closed issues to enrich the
development process, to gather ideas and needs for integration of
new applications based on the technologies that Telit provides, to
drive new integrators and developers toward simpler integration
processes, and why not to celebrate the successes of our
customers.This dream finally became a reality in 2010. Telit
launched the Technical Support Forum in October and it has been a
great success from the very start. The open forum format offers an
invaluable technical knowledge database on everything concerning
m2m. The most viewed articles range from general discussions like
Transmission of DTMF tones to specific challenges such as Sending
SMS while keeping an active socket connection.
www.telit.com/techforum
20
TELITPrOduCTs
TELIT2MARKET 06|11
ThRough neW PRoDuCT DeVeloPmenT
leADIng ChAnge
marco Contento, manager, Product management emeA
>> Always on the forefront of technology,
Telit expands its portfolio with the introduction of new 3.5g
modules in BgA packages, and 2.5g modules in lCC castellation.The
development of new modules, with different mounting technologies
and featuring a new cellular technology, is a dynamic response to
market demand and to the availability of new chipsets. Applications
not feasible only a few years ago have become common place thanks
in part to advances in size reduction and package design. From car
telematics and fleet management to intelligent metering and
consumer applications, each segment imposes its own set of
individual demands on the modules electronic package. However,
despite the fact that the silicon vendors continue increasing the
level of integration of silicon chip technologies, it will be some
time before the latest 3.5G and LTE wireless technologies can be
integrated in size and packaging comparable to those of the current
2.5G products. In this context, Telit has developed three new
products the HE863, the HE910 and the GL865-DUAL. The HE863 The
HE863 module enables highvolume m2m applications with advanced
capabilities leveraging the 3G HSPA technology while minimizing
development time. With dimensions of only 31.4 x 41.4 x 2.9
millimeters, the HE863 is the first Telit 3G module to be offered
in the BGA form factor, suitable for medium to high volume
applications. The HE863 features a 3GPP Release 6 stack, with HSPA
connectivity in two bands, and with throughput of 7.2Mbps in
downlink and 5.7Mbps in uplink. It also supports quad-band GSM /
GPRS and EDGE class 33, in 850, 900, 1800, and 1900MHz. The HE863
will be offered in three regional variants, with different
combinations of 3G bands and regulatory approvals depending on the
region. The product, which features a 6Mbps high-speed serial port,
as well as a high speed USB 2.0 port, will be available in
data-only and /or data, voice, standalone and assisted GPS. The
HE910 The HE910, the world's smallest LGA m2m module featuring
5-band HSPA+, is the perfect 28,2mm solution for consumer
applications requiring wireless connectivity on the move. Thanks to
support for all five 3G network bands (i.e. 850, 900, 1700, 1900,
and 2100 MHz) the HE910 provides mobility virtually without
borders. Furthermore, the HE910 includes features such as HSDPA
14.4 Mbps (Cat 10), HSUPA 5.7 Mbps (Cat 6) and Quad-band EGPRS
Class 33 (i.e. 850, 900, 1800, and 1900 MHz). Due to its low
profile LGA package and advanced connectivity features, the HE910
is ideally suited for mobile computing devices such as PDAs,
smart-phones, tablet PCs, and consumer electronics in general, both
for business and personal use. The HE910 can also optionally be
provided with integrated high-sensitivity AGPS for indoor fixes and
simultaneous GPS with voice and data. The GL865 The GL865-DUAL,
which is the first Telit 2.5 module in LCC (Leadless Chip Carrier)
castellation packaging,
has been introduced to expand the offering of 2.5G products in
surface-mount technology but in different packaging. Its
ultra-small form factor makes this module perfect for mobile
applications scaling from low to high volumes across all
industries. Key application areas include battery powered devices
for medical monitoring equipment, for tracking of people, animals
and assets. The GL865-DUAL module (LCC castellation package
technology) is a surface-mount component, having metalized pads on
all sides of the package. This kind of packaging is ideally suited
for simple and low-cost applications based on four-Layer PCBs.
Moreover, with the option for manual soldering and removal, it can
also serve niche applications with low production volumes. For
customers with highly integrated and complex applications, Telit
offers this new product as part of its broad family of Ball Grid
Array (BGA) m2m modules. The pins of the BGA package are arranged
in a grid pattern on the entire lower surface of the module, thus
providing a greater number of pins making the BGA package highly
efficient in terms of size to number of inputs and outputs. The
introduction of this product is an important step for Telits
portfolio development which now includes LCC castellation packaging
alongside our successful and well-known BGA packaging. LCC and BGA
packaging complement each other as they serve different market
segments. > In the last few years one of the most successful
applications in the m2m market has been the remote control of
devices over gSm and this kind of application will likely continue
its strong growth in the years ahead. Remote control is usually
accomplished by sending commands to a remote module through DTmF
tones or SmS. These commands allow remote driving of actuators and
the reading of sensors status.
The newly released DTMF decoder in Telit modules allows
developers to change their traditional approach when working with
GSM remote control systems. Although a TCP connection mode is also
available this article will focus on the DTMF solution. Traditional
approach The traditional way to implement remote control via GSM
using DTMF tones typically involves the use of a microcontroller
(MCU), a GSM module and a hardware DTMF decoder. (Figure 1) When
DTMF tones are employed to send remote commands, the audio
output
from the GSM module is connected to the DTMF receiver which
provides decoded tones to the MCU. The MCU in receipt of this
information recognizes the command and takes the appropriate action
or sequence of actions. The Achilles heel of this approach is the
need for several components to execute even the simplest command.
Telits approach The aim of the Telit approach is to simplify the
system by more fully utilizing the powerful embedded features of
the GSM module while at the same time giving new degrees of freedom
to the developer. (Figure 2) With this smart use of the Telit
module the DTMF receiver and the external microprocessor can be
removed leading to a smaller and cheaper implementation. In fact
DTMF tones are recognized by the internal decoder embedded in the
module without the need of any external device. (Figure 3) Embedded
DTMF decoder To access this feature, developers can select between
python script or event monitor for the software
gSm/gPRS module Power Supply
SIm
AT#eVmonI="DTmFo",0,1,0 AT#eVmonI="DTmFo",0,0,"AT#gPIo=3,1,1"
AT#eVmonI="DTmFo",1 AT#enAeVmonI=1Figure 4
DTmF Receiver
I/o
mCuFigure 1
AT#eVmonI="gPIo1",0,1,1 AT#eVmonI="gPIo1",0,2,1
AT#eVmonI="gPIo1",0,3,5 AT#eVmonI="gPIo1",0,0,"AT+CmgF=1;#C
Power Supply
Telit gSm/gPRS module
SIm
mgS=+393468686XyZ,\22gPIo1 on\22" AT#eVmonI="gPIo1",1
AT#enAeVmonI=1Figure 5
I/o
Figure 2
TELIT2MARKET 06|11
TELITPrOduCTs
23
DTmF, S mS
or TCP
implementation. Access to the embedded Python Easy Script gives
the developer the ability to program complex control sequences.
Using the virtual internal AT serial port, a Python script can be
written to receive the asynchronous messages generated by the
embedded DTMF decoder, interpret them, make decisions or execute
commands. If avoiding software programming is preferred, the user
can take advantage of the event monitor. This feature allows a DTMF
tone detection to be automatically associated with a specific
action at the module by simply sending it an AT configuration
command. SMS at run Telit modules also makes available, with no
change in hardware configuration, one additional solution: the use
of the Embedded SMS AT Run. This feature allows users to run AT
commands remotely just by sending an SMS to the module. Responses
and errors are sent back by the module via SMS. Two types of
messages are available: simple and protected. Protected messages
are encrypted with an MD5 hash algorithm. It is important to note
that the SMS AT Run feature is also available via TCP where AT
commands are sent to the module via TCP/IP. Responses and IP
protocol related traffic are redirected via TCP/IP to the device
acting as the TCP terminal. Event monitor example Based on a Telit
GL865 module a simple 2 IN/2 OUT remote control can be implemented
using event monitor for action control. In this sample application
the objective is to read the status of the 2 opto-isolated inputs
or set the status of the 2 relays. If the user wants to link
the activation of Relay 1 (connected to GPIO3) to the receiving
of a DTMF tone equal to 0, the following custom command must be
sent to configure the module: AT#EVMONI. Upon detection of a DTMF
tone 0, an event will be generated and AT#GPIO command will be
executed automatically activating Relay 1. (Figure 4) Contextually
the module can be triggered by a HIGH level on GPIO1 and send an
SMS to alert the remote application. (Figure 5) > new m2m
markets are advancing into intelligent automation systems,
innovative solutions, and above all energy efficiency.
Interoperability will be a key requirement for certain segments
like metering while another target will be to continue increasing
network flexibility. In order to build an advanced wireless system
it is mandatory that a comprehensive review of priorities be
completed to determine the most suitable combination of performance
and cost.
With advantages such as longer range, reduced power consumption,
lower deployment and operating costs, sub-GHz ISM wireless systems
can step in to address important need areas of m2m like metering
(water, gas, electricity), lightning control, building automation,
irrigation, and tracking or access control. The Telit portfolio in
sub-GHz ISM band includes 3 different product families: the LE, ME,
and NE. They are based on the same form factor of 26 x 15 x 3 mm
with weight of only 1.7 grams, LGA mounting technology (suitable
for manual soldering in small volume applications), and full
pin-to-pin cross-compatibility guaranteeing flexibility and making
possible the re-use of the wireless design in different market
segments. All modules include serial RS232 interface, digital and
analog
I/O ports allowing easy integration into any application
reducing development time and costs. Long battery life is ensured
with a standby mode that consumes 1A for wake up on external
interrupt (hardware over DTR or software via AT command). When used
for remote control applications the best design choice is cyclic
wake-up where the module is set to listen periodically to the radio
link (with the use of its internal timer) using current of only 3A.
Some key characteristics include budget link of up to 123dB (LE50),
configurable output power of up to 14dBm, sensitivity in the order
of -109dBm (LE50), and extended operating temperature range. Telit
started by launching products in the 868MHz frequency and this will
be followed by 433MHz and 915MHz variants.
TELIT2MARKET 06|11
TELITPrOduCTsNE50-868
33
For all Telit short-range (SR) module families there is a
complementary gateway solution, the GG863-SR which provides the
short range wireless network the ability to extend on the IP
network. Dedicated demo cases and kits are also available for each
family which include all the necessary resources to enable
outof-the-box testing of RF performances and others so that the
designer can quickly start taking steps towards building a network.
Moreover these three product families (ME, LE, and NE) were
designed to be pin-to-pin compatible with the Telit ZigBee
products, the ZE51-2.4, and the ZE61-2.4 (compliant with ZigBee PRO
stack). The LE Module Family is the ideal solution for
ultra-low-power and low-latency-time applications requiring
point-to-point or multipoint (broadcast) network communication and
a simple plug-and-play protocol for RF communications, being a
great fit for applications replacing communication over cable.
Because of the very low latency time, incoming characters are
transmitted to the radio link as they are received on the serial
port and collision is avoided with the application of the LBT
(listen before talk) feature, while for more advanced network
planning, RSSI level measurements can be used as a simple indicator
of signal strength. The Star network protocol stack running on the
LE module family is a Telit proprietary protocol that can be
applied in transparent mode (plug-and-play, minimum latency), in
address secured mode (nodes have ID numbers, data can be addressed
to a specific node), in telemetry mode, or in download over-the-air
mode (remote re-flashing of the modules). This family also
LE50-868
Demo Kit & Development Tools ME50-868
includes a 2.4GHz variant which can be a valuable alternative to
ZigBee in applications where a simple communication protocol can be
used. The NE module family is based on the Telit proprietary low
power mesh protocol, implemented on a cluster-tree network
structure. Power management can be achieved on both routers and end
nodes with extreme flexibility by setting different synchronous
network times, data rates, or message formats. These same
parameters also influence network latency providing a high degree
of freedom for OEMs to program them according to system
requirements. Lowest overall power consumption can be achieved in
networks running a regimen of small data volumes transmitted
periodically while high data throughput demanding high network data
exchange rates cause an increase in power consumption. Auto-repair,
auto-association, up to 10-hop routing, and 10,000 device capacity
make it easy to integrate complex and stable network solutions. The
ME module family is based on the wireless M-bus European standard
EN 13757-4 covering data exchange for remote meters (modes S, T,
and R) and the EN 13757-5:2008
extension of part 4 which specifies additional routing providing
the possibility to extend the range in 868MHz band (modes R2 and
Q). At the application level Telit supports AES encryption and is
compliant with the Dutch profile NTA8130 and OMS. This module
family can integrate any network of devices compliant to the
Wireless M-bus standard (parts 4 or 5) including the Telit TinyOne
Lite 868MHz module. SR Tools Manager The SR Tools Manager is a
unique powerful development environment covering all Telit Short
range module families (ME, LE, NE and ZE). It is Windows based and
easy to use internally handling most of the complexities of Short
Range technology and therefore dramatically reducing time-to-market
and TCO. Its purpose is to allow performance of preliminary
testing, help during the design phase, assist in deploying the
network, and to guarantee network operation and maintenance.
Starting with basic features like firmware upgrading, sniffer and
packet analyzer, commissioning and configuration of the short range
module; and moving up to the more advanced features which include
graphic network topology view together with its most important
parameters this single tool adds substantial value to the Telit
Short Range module offering. The starting version of the tool
allows selection of the SR technology and which part of the tool to
access, e.g. flashing, management, or analyzer. While using the
analyzer it is possible to select the ZigBee channel or Wireless
M-bus operating mode and all the captured data packets from the
selected source can be saved to a file. The management section is
used for sending the modules hexadecimal or ASCII commands and its
extremely easy-to-use, while configuration wizard provides quick
access to configuration or reading of the SR module registers. >
Predicting now the impact that the internet of things (IoT) will
have in our lives is not a trivial exercise (who could have
predicted the impact of Internet in the early 90s?), but it is safe
to state that Smart City will be among the most important
applications of the IoT. Following its long term vision and
strategy, Telit has been preparing for this new challenge and has
put in place a valuable offering to provide its partners with
unique competitive advantages.New m2m Wireless Communication
Technologies In addition to well established m2m cellular
communications where Telit is already playing a leadership role
worldwide, short range (SRD) communication technologies much better
suited for LAN/HAN application are required to enable the IoT.
Among the forerunner technologies, different flavors of the
IEEE802.15.4 (e.g. ZigBee, 6LowPAN, etc.) and Wireless M-BUS are
establishing themselves with WiFi becoming more adept to providing
connectivity to the consumer market through Smart Tabs and
dedicated applications (Apps). A common question some in the IoT
space are posing pertains to the strength of the make vs.ZigBee
Wireless MBus
buy approach for the Short Range communication component of
their application. Considering the required level of investments in
the design of wireless connectivity for the application the module
approach always provides solid advantages whenever the silicon used
in the design has a lifecycle time in the range of 3 to 4 years.
That is usually the case because of the increased ROI and reduced
and predictable total cost of ownership (TCO) due to the full
liability of the wireless solution (hardware and software) resting
on the module. Moreover, in the case of Telit and the pin2pin
multi-technology family approach, a remarkable additional
investment reduction can be achieved. Consider as an example, a
smart gas meter designed with the Telit ME50-868 (Wireless MBus)
and how it can also easily use the pin2pin compatible ZE51 ZigBee
variant or the ZE61 ZigBee PRO solution, or yet the new LE50 or
NE50 for star or low power mesh architectures available in 433, 868
and 915 MHz. New Tools to deploy and manage complex
multi-technology networks
ME50-868 DIP Version
considering the cost of a minimal subscription plus the cellular
hardware with required battery provides the immediate answer that
an SRD technology LAN/HAN is the cheaper option; however dedicated
new software tools able to minimize cost and risk in large scale
and efficient SRD network deployment for the full lifecycle of the
project (usually 15 to 20 years) are definitive requirements. To
this end, Telit has designed a dedicated SRD network tool, adding
dramatic value to its offering. The Telit Advantage The Telit
competitive advantage is based on the focused strategy to reduce
the m2m application TCO by dramatically reducing the required
investment and time-to-market. In fact Telit is unique in the
wireless solution and module supplier space for providing: 1 Fully
owned IPR m2m solutions from cellular to Short Range technologies,
all based on the Pin2Pin compatible family approach; 2
Fully-customizable, highly-integrated, cellular and SRD Gateways
and Concentrators; 3 A unique SRD network tool for the deployment,
operation, and maintenance of large mixed cellular and SRD networks
devoted to m2m applications. > The Aarlogic m09/5 is ideal for
industrial applications requiring environmental robustness to
withstand cold, heat, vibrations, etc. As a gateway, on the WAn
side it communicates via gSm and on the short range side it
utilizes license-free ISm standards including wireless m-Bus,
Zigbee, and RF868/915 mhz covering distances of up to 4000
meters.Round Solutions, a specialist manufacturer in m2m
communications, has developed a new industrial printed
circuit-board (PCB) especially designed for use under extreme
environmental conditions. The AarLogic M09/5 is equipped with this
technology and boasts an operational temperature range from -40 to
+85 degrees Celsius and because it is populated with SMT
components, it is highly vibration resistant. Measuring only 5.64 x
8.45 cm, the board can be used directly in smart metering and smart
grid applications with Telit's ME50-868 Wireless M-Bus module.
Since the Telit ME50 series is pin-compatible with the ZE family,
also ZigBee and Meshbased RF technologies can be addressed with the
same hardware design. Alternatively, with the use of the Telit
TinyOne family the M09/5 can be made to operate in the license-free
radio bands of 868 MHz and 915 MHz (US market). The board's voltage
converters were designed for the higher energy consumption of the
TinyOne-Pro series. Thus when this product family is used, the
board can cover ranges of up to 4km without any hard-ware changes.
STK-S4 The AarLogic's GE865 GSM module from Telit works almost
regardless of range. An Atmel microcontroller is applied to control
the board, supporting the option of Python scripting. The Atmel
AtMEGA162 controller, programmable in C and BASIC, allows the
development of special applications which is a desirable feature in
the fields of remote monitoring and smart metering (e.g. to create
a central hub for bulk data transfer). The modules for Wireless
M-Bus metering also comply with EN13757 standard and the Open
Metering System (OMS). As required for OEM board-level products,
this new radio board is equipped with all important inputs and
outputs, including serial CMOS interface, power inputs (6 to 32V),
and antenna connections. According to Olaf Schfer, Technical
Director at Round Solutions, the AarLogic M09/5 allows specific
hardware and working prototypes to be developed in a very short
time. A complete Round Solutions STK-S4 development environment
guarantees a quick and easy development effort.
>German-basedFalcomWirelessCommunications,theleadingsupplierofwirelessm2m
solutionshasjustintroducedtheROCK,aninnovative, adaptable and
standalone tracking device that can be used for both mobile and
fixed asset management. The device concept combines the latest
quad-band GSM/GPRS technology (Telit GE865) for communication,
ahigh-sensitivityGPSreceiverforpositioning,
awaterproofcompactcase,anddurableinternalbatterypackforlong-lifeoperationeliminatingtheneedforanexternalpowersource.
This is an ideal solution for managing and tracking containers,
trailers and high-value assetswherenopowersourceispresent.Many
features of the device and the new firmware can be downloaded
over-the-air helping you manageyourmobileandfixedassets,provide
better customer service, reduce costs and
increaseprofits.Anenergyharvestingversion
iscurrentlyunderdevelopmentanditwillbe
available4Q2011.>Falcomiscurrentlyprovidingseveralkinds of GPS
and telematics products responding tomarket demands. The company
recently
launchedanewvehicletrackingsystem;aspecialversionoftheFalcomAVLdeviceportfolio
combining GPS and GLONASS positioning systems with a higher level
of reliability for complete telematics functionality. Using
quad-bandGSM/GPRStechnology(TelitGE864) for two-way communication,
high-capacity Li-Polymerbackup-battery,andhousedina weatherproof
plastic case, the device is
suitableforawiderangeofmixedindoor/outdoor applications in the AVL,
fleet management, asset tracking, vehicle security and recovery,
andtransitsegments.ThedevicehasanIP69K
protectionclass,whichallowsittobepermanentlymountedontheroofofavehicle,truck,
train,vessel,orotherassets.> Falcom introduces the new MAMBO, an
advancedpersonaltrackerconceptcombining a quad-band GSM/GPRS phone,
a high-sensitivityGPSreceiver,GSMandGPSantennas,a three-axis motion
sensor, full-color OLED display (128 x 128 px), a five-way
navigation button and a 1300mAh Li-Polymer battery intoacompact(97
x 48 x 23 mm)enclosure.At firstglance,MAMBOlookslikeaconventional
mobile phone. It incorporates a number of functions designed
specifically for use by logistics providers, cab companies,
security andfireservices,police,technicalemergency
serviceproviders,andmanyothers.MAMBO
canbeusedasacellphonewiththefullcomplementofstandardfeaturesincludingvoice
callsandSMS,allthroughsimplemenu-guided
operation.Thissmallrobustdevicecanbecarriedalonginapocketoraffixedtoavehicles
interior.Itisatruemobileall-rounderbothfor commercial and private
users. MAMBO also
supportsaseriesoffunctionsforGPSnavigationandtrackingviaSMS,CSDandGPRS/TCP.
MAMBO
This all-rounders true strength lies in
themultitudeofitsconfiguration options: rolling GPS display,
geo-fencingcapabilitywith alarm, and an ultra-precise mo-vement
detector are just some of the MAMBOscorefunctions.
MAMBOcanintegrateup to five communication options including GSM and
TCP, system-wide IEEE 802.15.4forcommunication
withakeyfob,Bluetoothfor hands free communication, ANT for
heart-rate monitoring and ISM for short range
applications.Thisfirst-of-its-kind
solutionwithsophisticatedsoftware offers system integrators and
developers the abilitytodeveloptheirowncostefficientand
flexiblesolutions.>Grundfos Communication Interface
Modules(CIM)andCommunicationInterfaceUnits (CIU) enable data
communication via open and interoperable networks for complete
control of water supply, waste water pumps, andpumpsystems.TheCIM
250isastandard interface module for remote wireless data
transmission via GSM/GPRS networks. The
GSM/GPRSmodulecanfunctionasaSCADAinterface enabling a SCADA system
or other PLC controller to establish a remote
connectioneitherviaGSMcall-upusingtheModbus RTU protocol or via a
GPRS connection using thesystemsModbusTCPprotocolsupport. The
simple SMS interface enables users to
controlandmonitorGrundfospumpsfroma mobile phone. The system makes
it possible foraprogrammednumbertoreceivemessages whenever a
warning or an alarm condition
occurswhilealsoallowingtheusertorequest
statusorexecutesimplecontrolfunctions such as start, stop, and
setpointadjusting.
FAcTSGrundfos a/ssystemCIM/CIU250GSM/GPRSCommunication
Interface
www.grundfos.com
which telit module do you use and why?TheCIM/CIO
250GSM/GPRSCommunication modulecomplementstheextensiverangeof
industrial (wired) communications modules which interface the
millions of Grundfos pumps installed each year. Thanks to strong
R&D team efforts by Grundfos and Telit, the CIM 250 carries all
major mobile GSM/GPRS network approvals, thus aggregating
uncomplicated wireless data transmission and remote control
capabilities for Grundfos pump systems across theglobalmarketplace.
Last year several thousand Grundfos pumps
worldwidewereconnectedallowing monitoring of data points to
optimize performance, yield, and maintenance service intervals. And
since demand for reliable water supply and efficient disposal of
wastewaterwillonlyincreaseinthefuturetheoutlookforwirelessly
connected pump systems is verybright. All Grundfos CIM/CIU
communication interfaces offer
easeofinstallationandprovisioningareuser-friendlyanda great value
for money in the
longterm.>Telicsfocusisthedevelopment,production and sales of
flexible telemetry and telematics
productswiththeMadeinGermanyquality standard. The first generation
Picotrack was alreadythesmallesttrackingdeviceofitskind. The new
generation Picotrack is even smaller enabling use in a greater
number of business models.AlthoughthenewPicotrackisassmall
asamatchbox,itispackedwithhighendfunctionality such as a complete
set of telematics
softwarefunctionswhichcanbeeasilyconfiguredovertheairorviatheTelicconfiguration
tool.Becauseofanewlow-powerarchitecture, Telic customers can apply
it to asset tracking projectssuchastrackingofvaluablegoods.The
PicotrackPowervariantincorporatesastacked LiPo (Lithium-Polymer)
battery with double
thecapacitytofulfilleventhelongestbatteryliferequirementsinthissegment.
The Picotrack hardware platform is ideal for container and trailer
installations. In combinationwithsolarpanels,thePicotrackcanbe used
for years of maintenance free tracking tasks.
The configurable motion sensor and alarm
buttoncombinedwithitssmallsizeallowfor
useinnearlyallsecurityapplications.Thelarge GPS-patch antenna
ensures high accuracy of location information, even under bad
reception conditions as for example, inside a home. Unlike other
leading tracking service providers in Europe, Tracker.com offers
the Picotracktogetherwithitstelematicsservices which, through a
unique and free-of-charge iPhoneApp,canprovideendcustomerswith
constantaccesstopositioninformation,availablealsotofamilymembersandfriendsatthe
discretionofthecustomer. Tracker.com offers the Picotrack together
withtrackingservicesforlocatingathletesin outdoor activities,
children, the elderly, and impaired individuals requiring care.
Picotrack helps increase personal safety for these
individualsbykeepingthecareproviderconstantly informed of their
whereabouts. Athletes can use Picotrack to chart their training and
competitionroutesonline,keepingthemselves constantly updated on
distance covered and average speed. Personal trainers and coaches
can easily view the training modules completed by their athletes
online. Pets can also betrackedwiththePicotrack.>Fideltus
Advanced Technology Venture's disciplined investment strategy
focuses on emerging growth businesses across four
primaryareasofinterest:communications, infrastructure, software and
services, consumer technology, biopharmaceuticals,
medicaldevicesandemergingtechnologies. The vast majority of our
portfolio companiesarebasedinTurkey.Ourtargetmarkets
arecommunications,infrastructure,software & services, emerging
technology, consumer technology, biopharmaceuticals, medical
devices,andinformationtechnologies.
and efficiently store, protect, and manage
yourinformationsothatitcanbemadeaccessible, searchable, shareable,
and, ultimately, actionable. You can also use FIDELTUS information
infrastructure as the foundation for
implementingyourinformationlifecyclemanagementstrategies,securingyourcriticalinformation
assets, leveraging your content for competitive advantage,
automating your data center operations, reducing power and
coolingcosts,andmore. We help a range of customers FIDELTUS works
with organizationsaroundtheEMEA,inevery
industry,inthepublicandprivate sectors, and of every size. Our
customers include banks and other financial services firms,
manufacturers, healthcare and life sciences organizations, internet
service and
telecommunicationsproviders,airlinesandtransportationcompanies,educational
institutions, and public-sector agencies. Strong leadership record
Our differentiated value comes from our sustained and
substantialinvestmentinR&D,ourtechnicalR&Demployeesaroundthe
globe, the industry's broadest portfolio of systems,
software,andservices, our ability to create total integrated
solutions all designed in-house from top to bottom and our
commitment to delivering the best total
customerexperienceinthisorany
industry.>Integratingsophisticatedtechnology,OrbiSatmakesavailabletothemarketareliable,
easytoinstallandlowcostGPS+GPRSvehicle
trackingsystem.Itisaperfectchoiceforinsurers,carriersandcardealers.Fleetmanagement,
vehiclerecovery,andmonitoringofcarroutes
aresomeofitsmainpossibleapplications. The OrbiSats Vehicle Tracking
System combinesallthetechnicalknowledgeofOrbiSats engineering teams
from the development of telecommunication equipment, to radar
systems, to expertise in development and production of high volume
consumer electronicsdevices. The main challenge in the development
of this system was finding the perfect balance
betweenqualityandpricetoaddresstheBrazilianafter-marketautomotiverequirements.
Investinginareliablehardwaredesign,findingstrongsupplierssuchasTelitwerethefirst
stepsandwiththesechoicesmade,securinga
soundcombinationofmoduleswastofollow.
Redundantinternalsystems,realtimekernel, a strong watch-dog
function, ESD and EMI protection,allSMTboardassembly,intensive
testingcycles,andcompliancetogovernment
regulationsandcertificationswereallpartof thisproject.
Consideringthattherearealreadyanumber
ofcompaniesinthemarketsupplyingvehicle tracking services, and many
with their own trackingsoftware,OrbiSatmovedtooffer,at
nocharge,asoftwarelayercalledCollector,
whichcanbeeasilyintegratedintoproducts already available in the
market, allowing securitycompaniestoworkwiththeOrbiSats tracking
device in a seamless way. The
communicationprotocoldevelopedbyOrbiSatis compactandlight.
Anotherfeature
weintroducedistheconfzero,allowingtheOrbiSatstrackingdevice to be
configured at activation time, once it is installed in the car.
Using configuration parameters pre defined in the control software
of the service provider, this
informationistransmittedoverGPRStothedevice, preventing issues such
as misconfiguration and other errors or mistakes that can cause
thesystemtomisbehaveorperformpoorly. The GA-2010 Vehicle Tracking
System is the new security product offered by OrbiSat to
themarketinanapproach allowing either small or large vehicles
location and tracking companies to have their needs
addressedbyareliable,accurate, economic, and
professional-gradedevice.>REDTAIL Telematics is a global
hardware manufactureranddistributorofGPStracking
solutionsforfleetmanagement.Ourproducts are designed and developed
by an experiencedengineeringteam,globallyrecognized
aspremierleadersinwirelesstechnology.The
sameengineeringdesignteamhasdelivered
morethan5milliontrackingdevicestomarketsworldwide.
TheVAM(VehicleAssetManagement)features
abinaryprotocolavailableinTCP/IPandUDP
overGPRSandSMS.Itissupportedbyacomprehensive software development
kit (SDK), haslowoverheadforefficientdatacommunication, and is
future-proof with a full overthe-air(OTA)firmwareupgradecapability.
TheproductisbasedontheGE865-QUADmodule,whichcontinuestoshowoutstandingreliability.Portingthefirmwarefromaprevious
Telitmodulewasextremelyeasy,savingREDTAIL Telematics valuable
development time. The Telit support team also prepared us to
Ourcompanyoffershigh quality,lowcosthardwareproductsdirectlyto GPS
vehicle tracking providers. The evolution of the REDTAIL Telematics
roadmap happens
inlockstepwithcustomerdemandandacceleratedjointdevelopmenteffortswithourcustomersarealwaysconsiderediftoachieveoptimalwin-winsolutions.
REDTAILTelematicsbringsfull-featuredfleet management solutions to
market based on themostdesiredfeaturesfromfleetmanagers. Our
feature suite focuses on driver
behavior,dashboards,enhancedmapping,vehiclemonitoringandmore.Weexpect2011to
be a very exciting year with more and more companies developing
their own solution or looking to partner with a company having
proventrackrecordinthemarketplace.
Visitoursiteatwww.redtailtelematics.com/VAM to learn
moreaboutourproducts andservicesortorequest freedemounits.
TechnoKom is a company focused on
research,design,development,andproduction
ofelectronicdevicesforvariousapplications.
Withover17yearsofexperience,itiscurrently one of the leading
vehicle tracking device and software manufacturers in Russia. The
TechnoKom dealer network covers over 95%
oftheregionsinRussiawithanumberofrepresentativesabroad.
TheAutoGRAPH-GSM+(GPS/GLONASS)was
designedtoprovideaprofessional-grade,safe
andflexiblevehicletrackingsolutionforawide range of customers with
different needs and applicationopportunities.
TheproductisequippedwiththeTelitGE864QUADmodulewhichisaperfectplatformfor
medium-to-high-volume m2m devices and applications. Automatic
vehicle location is a powerful conceptwhenmanagingfleetsofvehicles
such as service, emergency, public (buses and trains) and personal
transport, water and rail transport,
agriculturalandbuildingmachinery, aviation, etc. The AutoGRAPH-GSM+
can also be used to track mobile
assets,suchasnon-wheeledconstructionequipment,non-motorizedtrailers,
and mobile power generators.
GPS/GLONASS/GPRS eal-timevehicletrackingand R monitoring
lerting,collectionandreporting A oflocalexternalevents
Internaldataloggerwith270,000records
EasyconfigurationviaSMS/GPRS/USB ull2-wayvoiceandtext-messaging F
communicationinterface AN(SAEJ1939/FMS)/RS-485/1-Wire C interfaces
rogrammableanaloganddigitalinputs P uelconsumptionandfueltanklevel
F monitoring onitoringandcontrolofauxiliary M
vehicleequipmentandsensors ERA-GLONASSready
features
90
tracking
TELITworLd
TELIT2MARKET 06|11
we appreciated telits technical support which significantly
reduced our product development time.Mark Hu, Vice President
FAcTSwonde Proud technologywww.wondeproud.com
systemDevicename:M7(GPSPortableMagnetic
Tracker).TheM7isaportableGPSTracking
devicecompactinsize,easilymounted(or
hidden)throughmagneticinstallationto
anymetalpartofavehicle.Withsuperior GPSandGSM/GPRSmodulesonboard,
ultra-lowstandbypowerconsumption,
andIP67-ratedwaterproofenclosurefor
outdoorenvironmenttheM7represents thebestchoiceforyourGPSvehicle
trackingapplicationforitsreliability,
convenience,andflexibility.
>>Wonde Proud Technology specializes in designing the most
advanced, integrated, and user-friendly GPS devices. Our products
have been widely used in commercial
andmilitarymarkets,wherereliabilityand stability are top concerns.
Over the past years, we have registered a number of patents and
intellectual property disclosures
givingusacompetitiveedgeinthisvigorous market.
ratedwaterproofcompact-sizeenclosure.This
portabletrackingdevicecanbeeasilyattached
underanyvehiclethankstoextra-strongmagnets while a tamper-detection
switch equippingitactivatessendinganalarmreportshould
thedeviceberemovedfromthevehicle.
ThankstoTelitshighsensitivityGSM/GPRS modem, the GE864, this
portable tracking deviceisabletooperateinanyenvironment especially
under poor GSM receptionconditions.Wereceivednotonlyoutstanding
hardware but also strong andseamlesstechnicalsupport from Telit
during the product development period which significantly
reducedourtime-to-market, maintaining our competitiveadvantage.
Westronglybelievethatthis portable tracking device will
soonbecomeanindustryleaderascustomers
begintoreapthebenefitsfromitshighperformance, reliability, and
cost-effectiveness as a GPSsolution. When its your job to turn
peoples wireless ideas into reality, you get to see a lot.
innovation in the wireless device space is picking up as a much
broader community becomes increasingly aware that connectivity can
enable better business and better living. So what trends is driving
growth? i like to look at it from two perspectives: technology and
business trends. On the technology side, one thing with which we
have been challenged several times as designers is the
miniaturization of finished products. Thankfully, this has been
supported by the continued miniaturization of key components
including modules and even SIMs. Nevertheless, it presents unique
design problems particularly when it comes to integrating antennas
for mission-critical performance and reliability. For those seeking
to bring small connected products to market,
we highly recommend looking for expert support for antenna
design, particularly in light of the fact that antenna performance
is a key component of required device certifications. The next
trend creating an impact is the continued downward slope of
component pricing across major component categories including
modules, processors and memory. For years, analysts blamed
slower-than-expected growth in the m2m industry on this very issue.
Today, with costs coming down, we are starting to hit the sweet
spot on bill of materials enabling attractive pricing on finished
products in both traditional and emerging m2m verticals including
the connected consumer space. Another trend on the technology side
that we expect to continue through 2011 is an increased interest in
standardization. Though ABI Research recently stated m2m markets
will NOT achieve significant standardization in 2011 (1), they do
note that a host of international standards organizations are
working on setting standards with many projects expected to
conclude this year. While we agree there will continue to be some
road blocks, we are seeing increased concern for standardsbased
development from the innovators bringing new m2m products to market
and believe customer-driven demand will press the industry to
overcome objections and begin adopting these standards. On the
business side, we are seeing a maturing in m2m value propositions
and business models which is leading to improved return on
investment and, as a result, the emergence of new vertical market
participation.
TELIT2MARKET 06|11
TELITMarkET
113
their products and establishing the grounds for ongoing customer
relationships and for recurring revenues. Healthcare companies are
enhancing patient quality of life. Car makers and auto insurers are
making the highways safer. And, of course, major technology players
are looking to complement existing portfolios and leverage customer
relationships to expand into this hot new space. Berg Insight
projects the total number of m2m connections to grow at a rate of
32 percent to reach nearly 300 million by 2015 (3). iSuppli
predicts even faster growth of 52 percent between 2009 and 2014
(4). Beecham Research expects sales of embedded devices to exceed
$250 billion by next year (5). By any measure, its clear that m2m
is poised not only to grow tremendously, but indeed to change
forever, for the better, the way we live and work. Australia >
Austria > Belarus > Belgium > Bolivia > Bosnia
Herzegovina > Brazil > Bulgaria > Canada > Chile >
China > Columbia > Croatia > Cyprus > Czech Republic
> Denmark > Ecuador > Estonia > Finland > France
> Germany > Greece > Hungary > India > Indonesia
> Iran > Iraq > Ireland > Israel > Italy > Jordan
> Korea > Latvia > Lebanon > Lithuania > Luxemburg
> Macedonia > Malaysia > Malta > Mexico > Montenegro
> Netherlands > New Zealand > Norway > Paraguay >
Peru > Philippines > Poland > Portugal > Romania >
Russia > Saudi Arabia > Serbia > Singapore > Slovakia
> Slovenia > South Africa > Spain > Sweden >
Switzerland > Syria > Taiwan > Thailand > Turkey >
Ukraine > United Arab Emirates > United Kingdom > United
States > Uruguay > Vietnam
telit ARoUND tHe woRlD
For detailed information about our distributors, please >
where to buy. visit
www.telit.com
116
TELITSaLES
telit2mARKet 06|11
S. Croft
s
Y. Ferhusoglu
TELIT'S SALES
A. Fan