Top Banner
Vol:.(1234567890) The Protein Journal (2018) 37:2–12 https://doi.org/10.1007/s10930-018-9755-0 1 3 Hydrocarbon Stapled Antimicrobial Peptides Dorian Migoń 1,2  · Damian Neubauer 1  · Wojciech Kamysz 1 Published online: 12 January 2018 © The Author(s) 2018. This article is an open access publication Abstract Antimicrobial peptides are promising candidates for anti-infective pharmaceuticals. Unfortunately, because of their low proteolytic and chemical stability, their usage is generally narrowed down to topical formulations. Until now, numerous approaches to increase peptide stability have been proposed. One of them, peptide hydrocarbon stapling, a modification based on stabilizing peptide secondary structure with a side-chain covalent hydrocarbon bridge, have been successfully applied to many peptides. Moreover, constraining secondary structure of peptides have also been proven to increase their biologi- cal activity. This review article describes studies on hydrocarbon stapled antimicrobial peptides with respect to improved drug-like properties. Keywords Antimicrobial peptides · Stapled peptides · Antimicrobial agents · Hydrocarbon stapled · Peptide drugs · Antibiotics 1 Introduction Increasing resistance to antibiotics among microorganisms is a serious threat for human health. According to the Review on Antimicrobial Resistance, by the year 2050 nearly ten million annual deaths will be caused by antibiotic-resistant bacterial infections [1]. Nevertheless, only seven new anti- biotics were approved by FDA within the past 10 years. In comparison, some 30 years ago about four new antibiotics were introduced each year. Current unsatisfactory situation is a result of complex processes. Undoubtedly, it is associ- ated with a worldwide overuse of antibiotics in humans and animals resulting in selection of drug-resistant strains [2]. Another crucial aspect is a shift of interest of pharmaceutical industry from antibiotic development to much more profit- able chronic disease medications [3]. In view of those facts it is essential to develop effective antimicrobials with novel modes of action to overcome microbial resistance. Antimicrobial peptides (AMPs) are compounds widely distributed in nature, e.g. bacteriocins, or as components of innate immunity. Generally, they are small up to medium- size (< 10 kDa), amphipathic molecules with a substantial portion (≥ 30%) of hydrophobic residues and an overall posi- tive charge [4, 5]. Hence, AMPs interact electrostatically with the negatively charged microbial surface, penetrate into its membrane lipids usually adopting a specific secondary structure and permeabilize it. This ultimately leads to mem- brane disruption and bacterial cell death. Depending on the mechanism of action three main models of AMPs antimi- crobial activity, barrel-stave, toroidal pore, and carpet-like, have been proposed. Under the barrel-stave model peptides form a pore in the bacterial membrane to which they are oriented perpendicularly. Hydrophobic face of helical pep- tide is directed towards the membrane and hydrophilic face towards the center of newly formed pore. According to toroi- dal model pore is formed as a result of peptide-induced lipid bilayer bending. In this case pore line is formed not only by peptides, but also lipid head groups. Lastly, carpet-like or detergent-like model is based on peptide accumulation par- allel to membrane surface. When critical concentration of surface accumulated peptide is exceeded, membrane struc- ture is altered, leading ultimately to membrane disruption. Furthermore, AMPs can exert antimicrobial effects via other mechanisms such as inhibition of cell wall synthesis, inhi- bition of nucleic acid and protein synthesis, or induction of apoptosis/necrosis [6]. Interestingly, for several AMPs an antimicrobial mechanism based purely on microbial * Dorian Migoń [email protected] 1 Department of Inorganic Chemistry, Faculty of Pharmacy, Medical University of Gdańsk, Al. Gen. J. Hallera 107, 80-416 Gdańsk, Poland 2 Polpharma Biologics, Gdańsk, Poland
11

Hydrocarbon Stapled Antimicrobial Peptides · Hydrocarbon Stapled Antimicrobial Peptides ... In view of those facts it is essential to develop effective antimicrobials with novel

Aug 19, 2020

Download

Documents

dariahiddleston
Welcome message from author
This document is posted to help you gain knowledge. Please leave a comment to let me know what you think about it! Share it to your friends and learn new things together.
Transcript
Page 1: Hydrocarbon Stapled Antimicrobial Peptides · Hydrocarbon Stapled Antimicrobial Peptides ... In view of those facts it is essential to develop effective antimicrobials with novel

Vol:.(1234567890)

The Protein Journal (2018) 37:2–12https://doi.org/10.1007/s10930-018-9755-0

1 3

Hydrocarbon Stapled Antimicrobial Peptides

Dorian Migoń1,2  · Damian Neubauer1 · Wojciech Kamysz1

Published online: 12 January 2018 © The Author(s) 2018. This article is an open access publication

AbstractAntimicrobial peptides are promising candidates for anti-infective pharmaceuticals. Unfortunately, because of their low proteolytic and chemical stability, their usage is generally narrowed down to topical formulations. Until now, numerous approaches to increase peptide stability have been proposed. One of them, peptide hydrocarbon stapling, a modification based on stabilizing peptide secondary structure with a side-chain covalent hydrocarbon bridge, have been successfully applied to many peptides. Moreover, constraining secondary structure of peptides have also been proven to increase their biologi-cal activity. This review article describes studies on hydrocarbon stapled antimicrobial peptides with respect to improved drug-like properties.

Keywords Antimicrobial peptides · Stapled peptides · Antimicrobial agents · Hydrocarbon stapled · Peptide drugs · Antibiotics

1 Introduction

Increasing resistance to antibiotics among microorganisms is a serious threat for human health. According to the Review on Antimicrobial Resistance, by the year 2050 nearly ten million annual deaths will be caused by antibiotic-resistant bacterial infections [1]. Nevertheless, only seven new anti-biotics were approved by FDA within the past 10 years. In comparison, some 30 years ago about four new antibiotics were introduced each year. Current unsatisfactory situation is a result of complex processes. Undoubtedly, it is associ-ated with a worldwide overuse of antibiotics in humans and animals resulting in selection of drug-resistant strains [2]. Another crucial aspect is a shift of interest of pharmaceutical industry from antibiotic development to much more profit-able chronic disease medications [3]. In view of those facts it is essential to develop effective antimicrobials with novel modes of action to overcome microbial resistance.

Antimicrobial peptides (AMPs) are compounds widely distributed in nature, e.g. bacteriocins, or as components of

innate immunity. Generally, they are small up to medium-size (< 10 kDa), amphipathic molecules with a substantial portion (≥ 30%) of hydrophobic residues and an overall posi-tive charge [4, 5]. Hence, AMPs interact electrostatically with the negatively charged microbial surface, penetrate into its membrane lipids usually adopting a specific secondary structure and permeabilize it. This ultimately leads to mem-brane disruption and bacterial cell death. Depending on the mechanism of action three main models of AMPs antimi-crobial activity, barrel-stave, toroidal pore, and carpet-like, have been proposed. Under the barrel-stave model peptides form a pore in the bacterial membrane to which they are oriented perpendicularly. Hydrophobic face of helical pep-tide is directed towards the membrane and hydrophilic face towards the center of newly formed pore. According to toroi-dal model pore is formed as a result of peptide-induced lipid bilayer bending. In this case pore line is formed not only by peptides, but also lipid head groups. Lastly, carpet-like or detergent-like model is based on peptide accumulation par-allel to membrane surface. When critical concentration of surface accumulated peptide is exceeded, membrane struc-ture is altered, leading ultimately to membrane disruption. Furthermore, AMPs can exert antimicrobial effects via other mechanisms such as inhibition of cell wall synthesis, inhi-bition of nucleic acid and protein synthesis, or induction of apoptosis/necrosis [6]. Interestingly, for several AMPs an antimicrobial mechanism based purely on microbial

* Dorian Migoń [email protected]

1 Department of Inorganic Chemistry, Faculty of Pharmacy, Medical University of Gdańsk, Al. Gen. J. Hallera 107, 80-416 Gdańsk, Poland

2 Polpharma Biologics, Gdańsk, Poland

Page 2: Hydrocarbon Stapled Antimicrobial Peptides · Hydrocarbon Stapled Antimicrobial Peptides ... In view of those facts it is essential to develop effective antimicrobials with novel

3Hydrocarbon Stapled Antimicrobial Peptides

1 3

process inhibition, with no membrane disruption have been observed. Hypothetically, those AMPs with cell penetrat-ing peptide (CPP) properties may provide a new delivery systems for known drugs [7, 8].

AMPs display activity against broad-spectrum of patho-gens such as Gram-positive and Gram-negative bacteria, fungi, parasites, and viruses [9]. As a result, they provide an interesting alternative for conventional antibiotics [10]. At the moment, several antimicrobial peptides are under clinical trials. One of those is pexiganan—a 22-amino acid residue analog of magainin in the form of 0.8% cream, which is in phase III clinical trials for patients with diabetic foot ulcers. Another example is an aqueous topical gel containing omiganan—a 12-amino acid residue analog of indolicidin. Omiganan is also in phase III clinical trials for rosacea [11].

Nevertheless, peptides have some limitations for practical use. First of all, AMPs are prone to enzymatic degradation. This drawback is particularly frequent in case of peptides characterized by flexible conformation in which vulnerable groups are exposed to protease action. Moreover, unsuitable temperature or pH may also negatively affect peptide stabil-ity. As a result, AMPs suffer from poor bioavailability and their clinical use is essentially limited to topical formula-tions. Additionally, environmental conditions (for example: high/low salt concentration or pH) may have a significant impact on peptide secondary structure, and consequently antimicrobial activity [12, 13]. Therefore, modification of AMPs to enhance their stability and antimicrobial activity is mandatory [14].

Nowadays, many approaches have been proposed to improve serum stability and to increase antimicrobial activ-ity [15–17], inter alia, d-amino acid substitution [18] or other non-ribosomal amino acid substitution [19], PEGyla-tion [20], lipidization [21], and dimerization [22]. Another AMP design approach is peptide stapling. This modification is generally based on formation of a covalent bridge between side-chains. In effect, the peptide is partially protected from enzymatic degradation and its active conformation is sta-bilized. Therefore, stapled peptide has potentially greater drug-like properties than the parent molecule. According to the bridge chemistry, we can distinguish, among others, hydrocarbon, triazole, azobenzene, thiol-based, lactam, hydrazine, and thioether stapling. Each stapling type may cause different effect on peptide stability and bioactivity [23]. Staples have to connect two side chains located on the same face of the helix to stabilize peptide secondary structure (Fig. 1). In practice these two residues need to be located at i and i + 3, i + 4 (one-loop staple), i + 7 (two-loop staple), or i + 11 (three-loop staple) positions since α-helix has 3.6 residues per turn. Moreover, introduction of two sta-ples (‘stitched peptides’) may enhance protease resistance, improve pharmacokinetic properties and biological activi-ties [24].

Stapled peptides have found application in numerous sci-entific areas. Many intracellular molecular targets, such as interacting proteins or transcription factors, formerly thought to be “undruggable”, have been effectively inhibited by sta-pled peptides. This state of affairs was due to the fact that binding interfaces of helical protein fragments are usually too large to be effectively disrupted by small molecules. On the other hand, the binding site is unreachable for biological drugs. Stapling techniques opened a window of opportu-nity for peptides to overcome those limitations. Moreover, stapled peptides were also applied as receptor agonists/antagonists, enzyme or efflux pump inhibitors, and as agents enhancing cholesterol efflux [25]. Undoubtedly, desirable activity and stability are crucial features of antimicrobial peptides. Therefore, several scientific teams undertook the subject of constraining AMPs α-helical structure.

This review focuses on the latest achievements in the development of hydrocarbon stapled antimicrobial peptides. The article presents some aspects of design and synthesis of the peptides as well as their effects on overall biological activity, stability, and structure.

2 Hydrocarbon Stapled Antimicrobial Peptides

2.1 Hydrocarbon Stapling Technique

Hydrocarbon stapled peptides were first introduced by Schafmeister et al. in 2000. Several unnatural Cα-methylated amino acids with either R or S absolute configuration at Cα position and olefinic side chain of different lengths were designed to be integrated into RNAse A in order to single out the most suitable ones for stapling. Their study has shown that Ri, i+7S with 11-carbon cross-link was the most efficient approach to stabilize α-helical structure and enhance stability towards trypsin enzymatic degradation. Moreover, α-methylation of particular amino acids provided additional, beside the hydrocarbon bridge, so-called helix-stabilization effect [26]. Since then, hydrocarbon stapling

Fig. 1 Exemplary locations of staples in helical peptide

Page 3: Hydrocarbon Stapled Antimicrobial Peptides · Hydrocarbon Stapled Antimicrobial Peptides ... In view of those facts it is essential to develop effective antimicrobials with novel

4 D. Migoń et al.

1 3

has become the most popular stapling technique with several compounds of therapeutic potential in areas of oncology, diabetes, cardiology, and HIV therapy [27, 28].

Generally, hydrocarbon stapling is performed through incorporation of two Cα-methyl, Cα-alkenyl amino acid resi-dues during standard solid-phase peptide synthesis with sub-sequent ruthenium-catalyzed metathesis macrocyclization reaction of the resin-bound peptide (Fig. 2). Up to date, sev-eral ring-closing metathesis catalysts have been developed and applied to peptide hydrocarbon stapling. However, the most commonly used catalyst, are still those introduced by Grubbs and coworkers (for example Grubbs’ first generation catalyst presented in Fig. 2). Additionally, due to the fact that conventional metathesis catalyst are water-insoluble, a grow-ing interest in water-soluble derivatives is observed [29–32]. As helix stabilization of a given stapling depends notably on absolute configuration at Cα position and staple length, these features have been exhaustively studied. A brief summary in Table 1 presents optimal parameters for a helix stabilization.

Furthermore, peptide may be stapled with more than one stapling. Two main approaches are applied to obtain double-stapled peptides. Longer peptides are stapled either with two independent staples (Fig. 3a) or with the use of 2,2-bis(4-pentenyl)glycine to form a spiro-bicyclic ring connection in i, i + 4, i + 4 + 7 manner (Fig. 3b) [23–25, 33, 34].

In fact, there is a variety of stapled peptide building blocks. These unusual amino acids can be divided into three

Fig. 2 Schematic presenta-tion of hydrocarbon stapling of PXEPTXIDE peptide using a ruthenium-catalyzed ring closing metathesis (X stands for Cα-methyl, Cα-alkenyl amino acid residue). Grubbs catalyst—benzylidenebis(tricyclohexyl-phosphine)-dichlororuthenium

Table 1 Optimal parameters for helix stabilization

Stapling type Chirality of AA at i

Chirality of AA at i + n

Staple length

i, i + 3 R S 6/8i, i + 4 S S 8i, i + 7 R S 11

Fig. 3 Exemplary locations of staples in double-stapled peptide a peptide stapled with two independent staples, b peptide stapled in a i, i + 4, i + 4 + 7 manner

Page 4: Hydrocarbon Stapled Antimicrobial Peptides · Hydrocarbon Stapled Antimicrobial Peptides ... In view of those facts it is essential to develop effective antimicrobials with novel

5Hydrocarbon Stapled Antimicrobial Peptides

1 3

groups: glycine derivatives, alanine derivatives, and deriva-tives with two alkenyl moieties. Examples of building blocks are presented in Table 2.

2.2 Hydrocarbon Stapled Antimicrobial Peptides—Academic Development

Hydrocarbon stapling approach has been described in several scientific articles as a mean to improve AMPs druggability.

Chapuis et al. designed single- and double-stapled ana-logs of two α-helical peptides of wild bee venom, lasiglossin III (LL-III) and melectin (MEP). To maintain lysine-based hydrophilic domain, several different staples were incorpo-rated along the hydrophobic face of α-helix for both peptides (Table 3). Three different hydrocarbon stapling approaches were chosen: single Si, i+4S with 8-carbon cross-link, single Ri, i+7S with 11-carbon cross-link or two Si, i+4S with 8-car-bon cross-links. Staple incorporation generally increased

helicity in water and proteolytic stability of peptides. Simul-taneously this modification resulted in a suppressed anti-microbial activity against pathogenic bacteria and Candida albicans. The Authors attributed this to the reduced peptide flexibility. Moreover, stapled analogs were more hemolytic than original molecules. As a result, hydrocarbon stapling of LL-III and MEP did not improve their pharmacological qualities [35].

Kim and coworkers published a series of 7 articles greatly contributing to the development of the hydrocarbon stapled antimicrobial peptides. In the first one, Pham et al. designed stapled analogs of esculentin-2EM (E2EM), a 37-residue antimicrobial peptide isolated from Korean frog (Glandirama emeljanovi). A single i, i + 4 hydrocarbon sta-ple was incorporated into E2EM15W, a 15-amino acid frag-ment of E2EM with aspartic acid residue substituted with tryptophan (Table 3). Additionally, to examine the influence of tryptophan residue on peptide-membrane interaction, two stapled analogs differing in tryptophan residue position were analyzed. All stapled peptides used in this study showed a significant increase in antimicrobial activity against Bacil-lus subtilis and Staphylococcus aureus as compared to the unstapled E2EM15W. Minimal inhibitory concentration for the stapled peptides was in the range of 3.13–6.25 µg/mL for both strains, whereas for unstapled peptide it was 200 µg/mL for B. subtilis and 100 µg/mL for S. aureus. On the other hand, both the stapled and unstapled peptides did not show any substantial activity against Staphylococcus epidermidis and Gram-negative strains. Oct-4-enyl stapling maintained peptide helicity despite shortening of its length and what is more, enhanced proteolytic stability as compared to that of E2EM [36].

Dinh et al. applied hydrocarbon stapling to short AMPs to increase their helicity and antimicrobial activity. Six de novo designed, stapled, N-capped heptapeptides and their unstapled counterparts (Table 3) were subjected to anti-microbial, hemolysis and circular dichroism (CD) assays. CD spectroscopy demonstrated an increased helicity of the stapled peptides. Furthermore, a close correlation between helicity and antimicrobial activity was observed: in most cases stapling enhanced antimicrobial potential. In fact, the designed peptides caused little or no hemolysis. Neverthe-less, in case of two stapled peptides, S3 and S4, the most potent antimicrobials in this study, hemolytic activity was slightly enhanced. This phenomenon was explained in terms of a staple-derived stabilization of the helix structure and increased molecule hydrophobicity [37]. The study was followed-up with another article in which Dinh et al. exam-ined the effect of N-acetylation of the previously described stapled heptapeptides on biological activity. The authors hypothesized that an increase in peptide positive net charge, as a result of removal of N-terminal capping, could con-tribute to their antimicrobial activity. Moreover, N-acetyl

Table 2 Alkenyl building blocks for stapled peptides

Description Structure

Glycine derivatives From allylglycine to 2-(7′-octenyl)glycine

Alanine derivatives From 2-(2′-propenyl)alanine to 2-(7′-octe-

nyl)alanine (R and S chirality)

Derivatives with two alkenyl groups From 2,2-bis(2-propenyl)glycine to

2,2-bis(4-pentenyl)glycine

 2-Amino-2-(pent-4-enyl)dec-9-enoic acid

Page 5: Hydrocarbon Stapled Antimicrobial Peptides · Hydrocarbon Stapled Antimicrobial Peptides ... In view of those facts it is essential to develop effective antimicrobials with novel

6 D. Migoń et al.

1 3

capping is also known for its helix stabilization properties, and thus removing it may destabilize peptide secondary structure and as a result reduce antimicrobial activity. The authors prepared 4 analogs with an N-terminal free amino moiety (Table 3) to learn if the hydrocarbon staple would be an effective standalone helix-stabilizing factor. Only in the case of S3, deacetylation proved to be an advantageous modification. The deacetylated analog maintained helicity, exhibited greater antimicrobial activity, and even lowered hemolysis [38].

A study on short stapled AMPs was reported by Luong et al. Peptide S3 was further modified to improve its phar-macological properties. On the basis of previous stud-ies on helix stabilization with two hydrocarbon bridges, the authors designed a series of dimeric S3 analogs with

various linkers (Table 4). Usually helix-breaking amino acid residues in the middle of the helical antimicro-bial peptide sequence contribute to their low hemolytic activity. Hence glycine and proline were used as linkers. Furthermore, the authors theorized that usage of longer linkers may lead to peptide folding through interaction of hydrophobic faces and thus increase peptide solubility and help to avoid aggregation. To verify this hypothesis, γ-aminobutyric acid (GABA) and β-alanine were applied as linkers. In general, dimerization did not cause any significant increase in helicity. Although peptide dimers exhibited increased antimicrobial and hemolytic activities, they were different for each linker. Peptide 3PR3-X showed the highest selectivity index. The results demonstrate that linker flexibility plays a key role in differentiation between

Table 3 List of hydrocarbon stapled antimicrobial peptides studied in articles cited in this review (part 1)

X stands for Cα-methyl, Cα-alkenyl amino acid residues (1, 2—stapled; 0—unstapled); a, b—two not identified isomers

Article title Peptide Peptide sequences Ref.

Effect of hydrocarbon stapling on the properties of α-helical antimicrobial peptides isolated from the venom of hymenoptera

Lasioglossin III analogs [35]LL-IIIs-1 VNWKKXLGKXIKVVK-NH2

LL-IIIs-2 VNWKKILGKXIKVXK-NH2

LL-IIIs-3 VXWKKXLGKIIKVVK-NH2

LL-IIIs-4 VNX1KKIX1GKX2IKVX2K-NH2

LL-IIIs-5 cis VNXKKILGKXIKVVK-NH2 cisLL-IIIs-5 trans VNXKKILGKXIKVVK-NH2 transLL-IIIs-6 a VNX1KKIX1PKX2IKVX2K-NH2 aLL-IIIs-6 b VNX1KKIX1PKX2IKVX2K-NH2 b

Melectin analogsMEP-Ns-1 GFLSILKKVLPKXNleAHXK-NH2

MEP-Ns-2 GFLSXLKKXLPKVNleAHNleK-NH2

MEP-Ns-3 GFLSX1LKKX1LPKX2NleAHX2K-NH2

MEP-Ns-4 cis GFXSILKKVXPKVNleAHNleK-NH2 cisMEP-Ns-4 trans GFXSILKKVXPKVNleAHNleK-NH2 transMEP-Ns-5 GFLSX1LKKX1LGKX2NleAHX2K-NH2

MEP-Ns-5x GFLSX0LKKX1LGKX1NleAHX0K-NH2

MEP-Ns-6 GFLSX1LKKX1LAKX2NleAHX2K-NH2

MEP-Ns-6x GFLSX0LKKX1LAKX1NleAHX0K-NH2

Truncated and constrained helical analogs of antimicrobial esculentin-2EM

E2EM15W-S1 Ac-TLKQFXKGVXKWLVK-NH2 [36]E2EM15W-S2 Ac-TLKQFXKGWXKDLVK-NH2

E2EM15W-S3 Ac-TLKQWXKGVXKDLVK-NH2

De novo design and their antimicrobial activity of stapled amphipathic helices of heptapeptides

S1 Ac-KXWKAXK-NH2 [37]S2 Ac-KXAKWXK-NH2

S3 Ac-KXWKLXK-NH2

S4 Ac-KXLKWXK-NH2

S5 Ac-KXWAKXA-NH2

S6 Ac-KXAWKXA-NH2

N-Capping effects of stapled heptapeptides on antimicrobial and hemo-lytic activities

H-S1 KXWKAXK-NH2 [38]H-S2 KXAKWXK-NH2

H-S3 KXWKLXK-NH2

H-S4 KXLKWXK-NH2

Page 6: Hydrocarbon Stapled Antimicrobial Peptides · Hydrocarbon Stapled Antimicrobial Peptides ... In view of those facts it is essential to develop effective antimicrobials with novel

7Hydrocarbon Stapled Antimicrobial Peptides

1 3

hemolytic and antimicrobial activity in doubly-stapled antimicrobial peptide dimers [39].

Additionally, Luong et al. conducted studies on the struc-ture–activity relationship of stapled antimicrobial hepta-peptides. That article reveals the impact of substitution of fifth amino acid residue (Table 4) on molecule conforma-tion, antimicrobial and hemolytic activity. All studied sta-pled peptides have been shown to adopt α-helical second-ary structure. Moreover, stapled peptides with fifth amino acid residue substituted by aliphatic amino acid (leucine, isoleucine, norleucine or valine) were more helical than those substituted by aromatic amino acid residues (pheny-lalanine or tryptophan). Generally, an increase in side chain hydrophobicity of the fifth amino acid residue resulted in an overall enhancement in antimicrobial and hemolytic activ-ity (in comparison to that of peptide ALA). Interestingly, although peptide LYS exhibited lower antimicrobial activity

than peptide ALA against most strains, it demonstrated the strongest antibacterial activity against Pseudomonas aer-uginosa. Consequently, peptide LYS seems to be a suitable starting point for further development of a selective antibi-otic drug. Additionally, the most potent analog, NLE, was subjected to trypsin digestion and it exhibited nearly 16-fold increased stability compared to its unstapled analog [40].

Another implementation of hydrocarbon staple into known antimicrobial peptide as a mean to increase its drug-like properties was described by Luong et al. A single i, i + 4 hydrocarbon staple was incorporated into Polybia-MP1, a 14-amino acid reside antimicrobial peptide originally iso-lated from the social wasp (Polybia paulista) venom. Mol-ecules were compared based on antimicrobial and hemo-lytic activities, secondary structure and proteolytic stability. Additionally, in order to increase peptide net charge, thus possibly increase antimicrobial activity, two stapled analogs

Table 4 List of hydrocarbon stapled antimicrobial peptides studied in articles cited in this review (part 2)

X – stands for Cα-methyl, Cα-alkenyl amino acid residues (1,2 – stapled; 0 – unstapled); a, b – two not identified isomers

Article title Peptide Peptide sequences Ref.

Antimicrobial and Hemolytic Activity of Stapled Heptapeptide Dimers 3GL3 Ac-KX1WKLX1K-G-KX2WKLX2K-NH2 [39]3BA3 Ac-KX1WKLX1K-βAla-KX2WKLX2K-NH2

3GA3 Ac-KX1WKLX1K-GABA-KX2WKLX2K-NH2

3PR3-X Ac-KX1WKLX1K-P-KX2WKLX2K-NH2 a3PR3-Y Ac-KX1WKLX1K-P-KX2WKLX2K-NH2 b

Mono-substitution effects on antimicrobial activity of stapled heptapep-tides

ALA (H-S1) KXWKAXK-NH2 [40]LEU (H-S3) KXWKLXK-NH2

VAL KXWKVXK-NH2

ILE KXWKIXK-NH2

NLE KXWK-Nle-XK-NH2

PHE KXWKFXK-NH2

TRP KXWKWXK-NH2

GLU KXWKEXK-NH2

LYS KXWKKXK-NH2

Antimicrobial activity and stability of stapled helices of polybia-MP1 MP1S IDWKKXLDAXKQIL-NH2 [41]MP1S-D8N IDWKKXLNAXKQIL-NH2

MP1S-Q12K IDWKKXLDAXKKIL-NH2

Antimicrobial activity of doubly-stapled alanine/lysine-based peptides Ac-SS-14W Ac-KXAKAXKKAAKAAWK-NH2 [42]Ac-DS-14W Ac-KX1AKAX1KKX2AKAX2WK-NH2

Ac-DS-12W Ac-KX1AKAX1KKX2AKWX2AK-NH2

Ac-DS-5W Ac-KX1AKWX1KKX2AKAX2AK-NH2

Ac-DS-2W Ac-KX1WKAX1KKX2AKAX2AK-NH2

Su-DS-5W Su-KX1AKWX1KKX2AKAX2AK-NH2

H-DS-5W H-KX1AKWX1KKX2AKAX2AK-NH2

Hydrocarbon-Stapled Lipopeptides Exhibit Selective Antimicrobial Activity

Val-HSLP Val-WWVXARA XRR [43]Cap-HSLP Cap-WWVXAFAXRRR

Influence of hydrocarbon-stapling on membrane interactions of synthetic antimicrobial peptides

S-6K-F17 KKKKKKAAFXAWA XFAA-NH2 [44]S-6K-F17-2G KKKKKKAGFXAWA XFGA-NH2

S-6K-F17-3G KKKKKKAGFXAWG XFGA-NH2

S-6K-F17-3GN KKKKKKNGFXAWG XFGA-NH2

Page 7: Hydrocarbon Stapled Antimicrobial Peptides · Hydrocarbon Stapled Antimicrobial Peptides ... In view of those facts it is essential to develop effective antimicrobials with novel

8 D. Migoń et al.

1 3

with appropriate amino acid substitutions (MP1S-D8N and MP1S-Q12K) were also synthesized (Table 4). Stapling in case of all compounds increased helicity, with MPS1 exhibiting the highest value (96%, 3.7-fold higher than that of MP1). Furthermore, peptide stapling affected peptide resilience against tryptic digestion. MP1S-Q12K was char-acterized by nearly 69-fold greater stability during proteo-lytic assay, as compared to MP1 (t1/2 was 1446 and 21 min, respectively). Interestingly, analogs were characterized by increased antimicrobial activity only against Gram-positive bacteria: B. subtilis, S. aureus (MP1S, MP1S-D8N and MP1S-Q12K), and S. epidermidis (MP1S-D8N and MP1S-Q12K). As predicted, increasing peptide net charge through substituting asparaginate residue with asparagine, or glu-tamine residue with lysine, led to increase in antimicrobial activity. However, those modifications and/or incorporation of hydrocarbon staple significantly increased hemolytic activity of studied peptides [41].

Dinh et al. examined application of double-stapling in antimicrobial peptides. Peptides containing lysine, alanine, tryptophan, and two i, i + 4 staples were designed (Table 4). In this case, staples provide a helical structure and a well-defined hydrophobic face. Additionally, to examine the influ-ence of various factors on peptide biological activity and secondary structure, several variants differing in N-terminal modification and position of tryptophan residue were also synthesized. Antimicrobial activity, hemolysis, helicity, and proteolytic stability of double-, single-, and unstapled peptides were compared in one study. All stapled peptides adopted helical conformation. However, a double-stapled peptide (Ac-DS-14W) had the highest helical content. Fur-thermore, the Ac-DS-14W exhibited greater antimicrobial activity than its unstapled counterpart. Among studied com-pounds, single-stapled peptides were more active against Gram-negative bacteria than the double-stapled. Contrarily, in case of Gram-positive bacteria, double-stapled peptides were more active. According to previous studies, hydrocar-bon stapled peptides exhibited increased hemolytic activity. However, different positioning of the tryptophan residue and N-terminal capping moiety resulted in H-DS-5W—a double-stapled peptide effective against both bacterial groups and with decreased hemolytic activity. On this basis, a hypothe-sis has been put forward that structure of hydrocarbon linker is related to peptide selectivity. Generally, single-stapled analogs were more resistant to trypsin digestion than their unstapled counterparts. Moreover, the double-stapled pep-tide, Ac-DS-14W, exhibited even higher stability to diges-tion. In fact, more than 85% of Ac-DS-14W remained intact after 60 min of trypsin digestion, whereas single-stapled and unstapled counterparts were completely digested. Overall, in contrast to Chapuis et al., this study demonstrates that double-stapling, as far as appropriate sequences are applied, may improve peptide pharmacological properties [35, 42].

Another intriguing aspect of hydrocarbon stapling is application of this method into lipopeptides. This approach was applied by Jenner et al. into de novo designed lipo-peptides (Table 4). Generally, the molecules were highly amphiphilic due to the hydrophobic N-terminus (with fatty acid and several tryptophan residues) and hydrophilic ami-dated C-terminus (with several arginine residues). A single i, i + 4 hydrocarbon staple was implemented. Antimicrobial and hemolytic activity, secondary structure, and membrane permeabilization properties of the stapled lipopeptides and their unstapled counterparts were analyzed. Moreover, rel-evance of arginine residue inside the macrocycle was evalu-ated. Although stapling did not stabilize secondary structure, it increased antibacterial activity and membrane permeabi-lization. The authors assumed that this outcome was due to the restriction of conformations available to the stapled peptide. Another proposed cause is an increased proteolytic stability and, in consequence, longer duration of action. As in the previously described studies, staple incorporation increased hemolytic potential of the analogs. Moreover, Val-HSLP exhibited lower hemolysis than Cap-HSLP. While the authors explained this lower activity with presence of arginine residue inside of the macrocycle, it could also be an outcome of a shorter fatty acid (Val) at N-terminus. Interestingly, stapled analogs exhibited lower antimicrobial activity against Candida strains in comparison to that of the original counterpart LP-1. No activity against Escherichia coli strain of either the stapled and unstapled peptides was detected [43].

Stone et al. studied influence of single i, i + 4 hydrocarbon staple on the 6K-F17 peptide, a 17-residue, de novo designed AMP (Table 4). Similarly to aforementioned lipopeptides, sequence of 6K-F17 was characterized by occurrence of two regions differing in their hydrophobicity. Conversely, in this case N-terminus was positively charged due to sev-eral lysine residues and C-terminus was hydrophobic as a result of alanine, phenylalanine, and tryptophan residue clustering. Stapled 6K-F17 (S-6K-F17) and its unstapled counterpart were compared regarding their secondary struc-ture, peptide–membrane interactions, mechanism of action, and antimicrobial and hemolytic activities. Although staple implementation slightly increased antimicrobial activity, a meaningful increase in hemolytic activity was observed. In order to diminish this undesirable feature, three addi-tional stapled analogs with hydrophobic amino acid resi-dues substituted with glycine and/or asparagine were also synthesized. Each subsequent substitution led to decrease in hemolytic activity of stapled peptides, with S-6K-F17-3GN being characterized by highest therapeutic index. In contrast to majority of described hydrocarbon stapled anti-microbial peptides, stapling of 6K-F17 did not result in mol-ecule with significantly increased helicity in aqueous buffer. Additionally, no increase in peptide helicity was observed

Page 8: Hydrocarbon Stapled Antimicrobial Peptides · Hydrocarbon Stapled Antimicrobial Peptides ... In view of those facts it is essential to develop effective antimicrobials with novel

9Hydrocarbon Stapled Antimicrobial Peptides

1 3

in SDS micelles. On the other hand, S-6K-F17 exhibited stronger helical character in bilayers composed of E. coli lipids than its unstapled counterpart. Authors explained this phenomenon as a result of more rigid and less negatively charged surface of E. coli lipid bilayer when compared to SDS micelles. Interestingly, a significant decrease of helical content in case of glycine/asparagine substituted analogs was observed. Adoption of helical structure in the presence of membrane, however, might not be a sine qua non condition for antimicrobial activity, as it remained at approximately the same level for both stapled and unstapled analogs. Fur-thermore, S-6K-F17 was characterized by greater depth of tryptophan residue penetration into both SDS micelles and E. coli lipid bilayers when compared to its unstapled parent molecule. On the other hand, substituting S-6K-F17 hydro-phobic residues with glycine and/or asparagine residues resulted in molecules with diminished tryptophan burial. Finally, NMR studies revealed that both unstapled and S-6K-F17-3GN peptides, despite exhibiting significant differences regarding secondary structure and tryptophan burial, selec-tively bind to bacterial membranes [44].

2.3 Hydrocarbon Stapled Antimicrobial Peptides—A Patent Review

In 2017 the Dana-Farber Cancer Institute, Inc. patented 16 staple-modified antimicrobial peptides and their deriva-tives (Table 5). The patent contains a list of stapled pep-tides and their chemical structures. Furthermore, the authors described pharmaceutically acceptable salts, pharmaceuti-cal compositions, treatment of bacterial infection (bacteria and bacterial biofilm-related), and methods of killing or

inhibiting bacterial growth. As an example of their inven-tion, the authors presented multiple stapled-peptide develop-ment approaches. Firstly, they synthesized several pexiganan and magainin II stapled analogs. In general, hydrocarbon stapling increase peptides helicity, enhance antimicrobial and hemolytic activity. Basing on the fact that hemolytic activity is usually related to peptide hydrophobicity, the authors modified a staple of pexiganan analog through Sharpless dihydroxylation reaction. Antimicrobial activity of the hydroxylated analogs was preserved, however, lytic activity against red blood cells (RBC) was slightly reduced. Although diol derivatization was not completely satisfac-tory, it endorsed hypothesis that hemolysis was related to the peptide hydrophobicity. To enhance hydrophilicity the authors modified the staple by additional positive point charge through Sharpless aminohydroxylation (oxyamina-tion). Unfortunately, no data about biological activity was presented. In the next example of the invention, the authors described principles for designing stapled AMPs with selectivity for bacterial membrane. Peptide library based on magainin II i, i + 4 and i, i + 7 staple screening was syn-thesized. Generally, implementing staple in both manners increased antimicrobial activity; however, the i, i + 7 ana-logs were more active against bacteria and RBC. Neverthe-less, i, i + 4 analogs exhibited different pattern of hemolysis dependent on the insertion site of the staple. Generally, the i, i + 4 analogs in which hydrophobic patch discontinuity was preserved provided better membrane selectivity. Then, a sta-pled analog with the highest selectivity index, Mag(i + 4)15, was further modified by moving positive and negative charged residues along the peptide backbone. In principle, substitution of amino acid residue with lysine resulted in

Table 5 Original AMPs and exemplary sequences of their patented stapled analogs (bolded, underlined letters indicate staple location in exemplary analog)

Peptide Sequences

Magainin II GIGKFLHSAKKFGKAFVGEIMNSPexiganan GIGKFLKKAKKFGKAFVKILKK-NH2

Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYLPardaxin GFFALIPKIISSPLFKTLLSAVGSALSSSGEQEHFIAP GFFKKAWRKVKHAGRRVLKKGVGRHYVNNWLKPGQ GVLSNVIGYLKKLGTGALNAVLKQBuforin II TRSSRAGLQFPVGRVHRLLRKDermaseptin ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ-NH2

Caerin 1.8 GLFKVLGSVAKHLLPHVVPVIAEKL-NH2

Melittin GIGAVLKVLTTG LPALISWIKRKRQQ-NH2

Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2

Lycotoxin I KIKWFKTMKSIAKFIAKEQMKKHLGGEStyelin B GFGPAFHSVSNFAKKHKTA-NH2

Clavanin B VFQFLGRIIHHVGNFVHGFSHVF-NH2

Cathelicidin A (CP-11) ILKKWPWWPWRRK-NH2

Dermicidin SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVH-DVKDVLDSVL

Page 9: Hydrocarbon Stapled Antimicrobial Peptides · Hydrocarbon Stapled Antimicrobial Peptides ... In view of those facts it is essential to develop effective antimicrobials with novel

10 D. Migoń et al.

1 3

an analog with a decreased hemolytic activity. Importantly, antimicrobial activity of the analogs was dependent on sub-stituted position. Moreover, activity against Gram-positive bacteria was decreased more frequently than against Gram-negative bacteria. Similarly to lysine scanning, glutamic acid scanning also provided analogs with a lower hemolytic activity. However, antimicrobial activity was also reduced in nearly all cases. Additionally, to evaluate the influence of positive charge intensity on antimicrobial and hemolytic activity, several histidine substituted analogs were also syn-thesized. Generally, substitution with histidine resulted in compounds with an increased antimicrobial activity and lower lytic activity against RBC in comparison to those of the lysine substituted counterparts. Thereafter, impact of helix promoting (alanine and 2-aminoisobutyric acid) and disrupting residues (proline, 4-hydroxyproline, d-alanine and d-lysine) on stapled peptide Mag(i + 4)15 activity was examined. Both helix promoting residues increased antimi-crobial and hemolytic activity. In contrast, substitution by proline, 4-hydroxyproline and d-lysine resulted in a decrease in both of these activities. d-Alanine proved to be the most suitable residue to modify the peptide due to the increased antimicrobial activity and decreased hemolysis. Based on the results, the authors designed double-stapled analogs. One of the compounds, Mag(i + 4)2,15(I2K, A9H), exhibited similar antimicrobial activity to that of the Mag(i + 4)15, however, with nearly eliminated hemolytic activity. Finally, the authors applied stapled peptide approach to pleurocidin. As a result, a stapled peptide, Pleu(i + 4) 1,15(A9K), with an increased antimicrobial activity and relatively low hemolytic activity was obtained [45].

Another patent by Dana-Farber Cancer Institute, Inc., also published in 2017, describes staple application in intracellu-lar-targeting antimicrobial peptides (I-TAMPs). Generally, I-TAMPs are subclass of AMPs which exhibit their antimi-crobial activity through membrane translocation with subse-quent microbial process inhibition, in opposition to regular microbial cell membrane disruption. As a part of document, 13 further stapled-derived antimicrobial peptides, their for-mulations, modifications and applications as antimicrobial drugs were described. Additionally, due to I-TAMPs ability to penetrate microbial membranes, a concept of connecting them with conventional antibiotics in order to: (I) overcome treatment resistance, (II) provide new delivery system for previously ineffective antibiotics or (III) improve selectiv-ity of toxic molecules towards bacteria, was described. As an example of their invention authors applied peptide sta-pling to buforin II, a 21-amino acid residue histone-derived AMPs, first isolated from stomach of Asian toad (Bufo bufo gargarizans). In order to identify the most pharmacologi-cally efficient staple position, an i, i + 4 and i, i + 7 staple scanning was conducted for buforin II. Obtained analogs were characterized by their antimicrobial activity against

E. coli, hemolytic activity and helicity. Overall, peptide sta-pling increased buforin II helicity, with i, i + 7 analogs being characterized by greater α-helical content than their i, i + 4 counterparts. Similar tendency was observed for hemolysis, where i, i + 7 analogs exhibited higher hemolytic activity when compared to i, i + 4 derivatives. Two of synthesized analogs, i.e. BFStap (i + 4)7 and BFStap (i + 4)11, showed a significant increase in antimicrobial activity (nearly 200-fold in comparison to buforin II), while maintaining their hemolytic activity at level comparable to unstapled coun-terpart [46].

3 Conclusions

Antibiotic-resistant bacterial infections are becoming a seri-ous threat for mankind. Hence, there is an urgent need to develop new, efficient drugs being an alternative to conven-tional antibiotics [47].

Peptide stapling emerged as a promising modification for future peptide drug candidates. Until now, two stapled therapeutics, ALRN-6924, a dual inhibitor of MDM2/MDMX-p53 interaction, and ALRN-5281, a growth hor-mone-releasing hormone inhibitor, both developed by Aileron Therapeutics, Inc., have been under clinical trials [48]. Over the past years, many different stapled peptides have been developed to be potentially useful in cancer treat-ment and other pathological diseases [27]. Hydrocarbon sta-pled AMPs appear to be a promising class of anti-infective agents, mainly because of their possible selective activity against bacteria and low incidence of developing resist-ance. Importantly, it may also increase antimicrobial activ-ity and peptide helicity. Unfortunately, stapling frequently leads to enhanced hemolysis. This phenomenon is presum-ably a result of an increased hydrophobicity derived from incorporated staple. Because of that, hydrocarbon stapling alone might be insufficient to provide drug-like properties. However, further peptide modifications such as addition of point charges into stapled peptide sequence (for example through substitution of hydrophobic amino acid residue by lysine residue) or insertion of helix-disrupting residues may result in a satisfactory antimicrobial activity and low activity against RBC.

Additionally, antimicrobial peptide stapling, due to increased resistance to enzymatic and chemical degrada-tion, sheds the green light to novel routes of administration. Intravenous injection of stapled AMPs with selectivity for bacterial cells, could greatly facilitate coping with systemic infections caused by antibiotic-resistant microorganisms [49–51]. Furthermore, peptide stapling enables delivering a selective antimicrobial peptide drug via patient-friendly oral route. For instance, Bird et al. examined a double-stapled peptide SAH-gp41(626–662). After oral administration this

Page 10: Hydrocarbon Stapled Antimicrobial Peptides · Hydrocarbon Stapled Antimicrobial Peptides ... In view of those facts it is essential to develop effective antimicrobials with novel

11Hydrocarbon Stapled Antimicrobial Peptides

1 3

peptide achieved a measurable and dose-dependent plasma concentrations in contrast to its unstapled counterpart which was undetected (mouse model) [24].

This article reviews the current state of knowledge of hydrocarbon stapled antimicrobial peptides. Undoubtedly, these compounds appear as a promising class of antimi-crobial agents. The facts and possibilities presented in this paper encourage for further studies.

Acknowledgements We wish to thank Professor Ryszard Piękoś for his invaluable help in preparing the manuscript.

Compliance with Ethical Standards

Conflict of interest The authors declare that they have no conflict of interest.

Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecom-mons.org/licenses/by/4.0/), which permits unrestricted use, distribu-tion, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made.

References

1. O’Neill J (2014) Antimicrobial resistance: tackling a crisis for the health and wealth of nations. Rev Antimicrob Resist 1:1–16

2. Shallcross LJ, Davies DS (2014) Antibiotic overuse: a key driver of antimicrobial resistance. Br J Gen Pract 64:604–605

3. O’Neill J (2015) Securing new drugs for future generations: the pipeline of antibiotics. Rev Antimicrob Resist 3:4–23

4. Fan L, Sun J, Zhou M, Zhou J, Lao X, Zheng H, Xu H (2016) DRAMP: a comprehensive data repository of antimicrobial pep-tides. Sci Rep 6:24482

5. Giuliani A, Pirri G, Nicoletto SF (2007) Antimicrobial peptides: an overview of a promising class of therapeutics. Cent Eur J Biol 1:1–33

6. Brogden KA (2005) Antimicrobial peptides: pore formers or meta-bolic inhibitors in bacteria? Nat Rev Microbiol 3:238–250

7. Henriques ST, Melo MN, Castanho MARB. (2006) Cell-penetrat-ing peptides and antimicrobial peptides: how different are they? Biochem J 399:1–7

8. Splith K, Neundorf I (2011) Antimicrobial peptides with cell-penetrating peptide properties and vice versa. Eur Biophys J 40:387–397

9. Guilhelmelli F, Vilela N, Albuquerque P, Derengowski LS, Silva-Pereira I, Kyaw CM (2013) Antibiotic development challenges: the various mechanisms of action of antimicrobial peptides and of bacterial resistance. Front Microbiol 4:1–12

10. Kosikowska P, Lesner A (2016) Antimicrobial peptides (AMPs) as drug candidates: a patent review (2003–2015). Expert Opin Ther Pat 26:689–702

11. Greber KE, Dawgul M (2017) Antimicrobial Peptides under clini-cal trials. Curr Top Med Chem 17:620–628

12. Park IY, Cho JH, Kim KS, Kim YB, Kim MS, Kim SC (2004) Helix stability confers salt resistance upon helical antimicrobial peptides. J Biol Chem 279:13896–13901

13. Kacprzyk L, Rydengård V, Mörgelin M, Davoudi M, Pasupuleti M, Malmsten M, Schmidtchen A (2007) Antimicrobial activity of

histidine-rich peptides is dependent on acidic conditions. Biochim Biophys Acta 11:2667–2680

14. Midura-Nowaczek K, Markowska A (2014) Antimicrobial pep-tides and their analogs: searching for new potential therapeutics. Perspect Med Chem 6:73–80

15. Brogden NK, Brogden KA (2011) Will new generations of modi-fied antimicrobial peptides improve their potential as pharmaceu-ticals? Int J Antimicrob Agents 38:217–225

16. Bahar AA, Ren D (2013) Antimicrobial peptides. Pharmaceu-ticals 6:1543–1575

17. Drider D, Rebuffat S (2011) Prokaryotic Antimicrobial Peptides. Springer, New York

18. Hamamoto K, Kida Y, Zhang Y, Shimizu T, Kuwano K (2002) Antimicrobial activity and stability to proteolysis of small linear cationic peptides with d-amino acid substitutions. Microbiol Immunol 46:741–749

19. Li W, Sun Z, O’Brien-Simpson NM, Otvos L, Reynolds EC, Hossain MA, Separovic F, Wade JD (2017) The effect of selec-tive D- or Nα-methyl arginine substitution on the activity of the proline-rich antimicrobial peptide, Chex1-Arg20. Front Chem 5:1

20. Falciani C, Lozzi L, Scali S, Brunetti J, Bracci L, Pini A (2014) Site-specific pegylation of an antimicrobial peptide increases resistance to Pseudomonas aeruginosa elastase. Amino Acids 46:1403–1407

21. Albada HB, Prochnow P, Bobersky S, Langklotz S, Schriek P, Bandow JE, Metzler-Nolte N (2012) Tuning the activity of a short Arg-Trp antimicrobial peptide by lipidation of a C- or N-terminal lysine side-chain. ACS Med Chem Lett 3:980–984

22. Kamysz E, Sikorska E, Dawgul M, Tyszkowski R, Kamysz W (2015) Influence of dimerization of lipopeptide Laur-Orn-Orn-Cys-NH2 and an N-terminal peptide of human lactoferricin on biological activity. Int J Pept Res Ther 21:39–46

23. Lau YH, de Andrade P, Wu Y, Spring DR (2015) Peptide sta-pling techniques based on different macrocyclisation chemis-tries. Chem Soc Rev 44:91–102

24. Bird GH, Madani N, Perry AF, Princiotto AM, Supko JG, He X, Gavathiotis E, Sodroski JG, Walensky LD (2010) Hydrocarbon double-stapling remedies the proteolytic instability of a lengthy peptide therapeutic. Proc Natl Acad Sci USA 107:14093–14098

25. Cromm PM, Spiegel J, Grossmann TN (2015) Hydrocarbon sta-pled peptides as modulators of biological function. ACS Chem Biol 10:1362–1375

26. Schafmeister CE, Po J, Verdine GL (2000) An all-hydrocarbon cross-linking system for enhancing the helicity and metabolic stability of peptides. J Am Chem Soc 122:5891–5892

27. Xie X, Gao L, Shull AY, Teng Y (2016) Stapled peptides: pro-viding the best of both worlds in drug development. Future Med Chem 16:1969–1980

28. Iyer VV (2016) A review of stapled peptides and small mol-ecules to inhibit protein–protein interactions in cancer. Curr Med Chem 23:3025–3043

29. Blackwell HE, Grubbs RH (1998) Highly efficient synthesis of covalently cross-linked peptide helices by ring-closing metath-esis. Angew Chem Int Ed 37:3281–3284

30. Lin YA, Chalker JM, Davis BG (2009) Olefin metathesis for site-selective protein modification. ChemBioChem 10:959–969

31. Burtscher D, Grela K (2009) Aqueous olefin metathesis. Angew Chemie Int Ed 48:442–454

32. Jacobsen Ø, Klaveness J, Rongved P (2010) Structural and pharmacological effects of ring-closing metathesis in peptides. Molecules 15:6638–6677

33. Tan YS, Lane DP, Verma CS (2016) Stapled peptide design: principles and roles of computation. Drug Discov Today 21:1642–1653

Page 11: Hydrocarbon Stapled Antimicrobial Peptides · Hydrocarbon Stapled Antimicrobial Peptides ... In view of those facts it is essential to develop effective antimicrobials with novel

12 D. Migoń et al.

1 3

34. Hilinski GJ, Kim YW, Hong J, Kutchukian PS, Crenshaw CM, Berkovitch SS, Chang A, Ham S, Verdine GL (2014) Stitched α-helical peptides via bis ring-closing metathesis. J Am Chem Soc 136:12314–12322

35. Chapuis H, Slaninová J, Bednárová L, Monincová L, Buděšínský M, Čeřovský V (2012) Effect of hydrocarbon Stapling on the properties of α-helical antimicrobial peptides isolated from the venom of hymenoptera. Amino Acids 43:2047–2058

36. Pham TK, Kim DH, Lee BJ, Kim YW (2013) Truncated and con-strained helical analogs of antimicrobial esculentin-2EM. Bioor-ganic Med Chem Lett 23:6717–6720

37. Dinh TTT, Kim DH, Lee BJ, Kim YW (2014) De novo design and their antimicrobial activity of stapled amphipathic helices of heptapeptides. Bull Korean Chem Soc 35:3632–3636

38. Dinh TTT, Kim DH, Nguyen TQ, Lee BJ, Kim YW (2015) N-capping effects of stapled heptapeptides on antimicrobial and hemolytic activities. Bull Korean Chem Soc 36:2511–2515

39. Luong HX, Kim DH, Lee BJ, Kim YW (2016) Antimicrobial and hemolytic activity of stapled heptapeptide dimers. Bull Korean Chem Soc 37:1199–1203

40. Luong HX, Ngoan DK, Lee TMB (2017) Mono-substitution effects on antimicrobial activity of stapled heptapeptides. Arch Pharm Res 40:713–719

41. Luong HX, Kim DH, Lee TMB, Kim YW (2017) Antimicrobial activity and stability of stapled helices of polybia-MP1. Arch Pharm Res. https://doi.org/10.1007/s12272-017-0963-5

42. Dinh TTT, Kim DH, Luong HX, Lee BJ, Kim YW (2015) Antimi-crobial activity of doubly-stapled alanine/lysine-based peptides. Bioorganic Med Chem Lett 25:4016–4019

43. Jenner ZB, Crittender CM, Gonzalez M, Brodbelt JS, Bruns KA (2017) Hydrocarbon-stapled lipopeptides exhibit selective anti-microbial activity. Biopolymers 3:23006

44. Stone TA, Cole GB, Nguyen HQ, Sharpe S, Deber CM (2017) Influence of hydrocarbon-stapling on membrane interactions of synthetic antimicrobial peptides. Bioorg Med Chem. https://doi.org/10.1016/j.bmc.2017.10.020

45. Walensky LD, Mourtada R, Bird GH (2017) Stabilized anti-micro-bial peptides. U.S. Patent US20170015716 A1

46. Walensky LD, Mourtada R (2017) Stapled intracellular-tar-geting antimicrobial peptides to treat infection. U.S. Patent US20170247423 A1

47. Ventola CL (2015) The antibiotic resistance crisis: part 2: manage-ment strategies and new agents. P T 40:344–352

48. ClinicalTrials.gov (2017) A service of U.S. National Institutes of Health. https://clinicaltrials.gov. Accessed 9 Jul 2017

49. Braunstein A, Papo N, Shai Y (2004) In vitro activity and potency of an intravenously injected antimicrobial peptide and its dl amino acid analog in mice infected with bacteria. Antimicrob Agents Chemother 48:3127–3129

50. Mahlapuu M, Håkansson J, Ringstad L, Björn C (2016) Anti-microbial peptides: an emerging category of therapeutic agents. Front Cell Infect Microbiol 6:194

51. Noto PB, Abbadessa G, Cassone M, Mateo GD, Agelan A, Wade JD, Szabo D, Kocsis B, Nagy K, Rozgonyi F, Otvos L (2008) Alternative stabilities of a proline-rich antibacterial peptide in vitro and in vivo. Protein Sci 17:1249–1255