Combine QuestionsJOURNAL :Enhancing Creative thinking through
Designing electronic slides
1. Apakah yang dimaksudkan mereka slaid elektronik dalam kajian
ini?A. Mereka perisian komputer yang meningkatkan kemahiran
berfikirB. Mereka video dengan menggunakan gambar yang dibekalkanC.
Mereka dengan penggunaan Microsoft Paint untuk menghasilkan gambar
yang bercantumD. Mereka dengan penggunaan Microsoft Powerpoint
dengan gambar, video, teks dan sebagainya
2. Adakah keputusan kajian ini menunjukkan peningkatan kemahiran
berfikir kreatif melalui mereka slaid elektronik ?A. Tiada sebarang
peningkatan dengan mereka slaid elektronikB. Ya, terdapat
peningkatan yang positif yang ketaraC. Keputusan menunjukkan kesan
peningkatan adalah kurang
3. Mengapakah Torrance Test for creative Thinking (TTCT)
digunakan dalam kajian ini?A. Instrument ini dapat mengukur tahap
kemahiran berfikir B. Instrument ini dapat mengukur cara kemahiran
berfikir C. Instrument ini dapat mengukur tahap kreativiti
seseorang D. Instrument ini dapat mengukur cara pemikiran
kreativiti seseorang
4. Pada pendapat anda, apakah sebab utama pengkaji-pengkaji
tersebut menjalankan kajian tersebut?A. Untuk mengetahui kesan
peningkatan pemikiran kreatif sedangkan kajian yang melibatkan
penggunaan teknologi sebelum ini lebih menekankan peningkatan
pengetahuan B. Untuk mengukur kemahiran berfikir secara kreatif di
kalangan pelajar sedangkan kajian yang melibatkan penggunaan
teknologi sebelum ini lebih menekankan peningkatan pengetahuanC.
Untuk membuktikan proses yang dijalankan adalah sesuai di kalangan
pelajar undergraduate sedangkan kajian sebelum ini menyatakan
proses tersebut Cuma sesuai untuk pelajar sekolah menengah
sahaja
5. Pada pendapat anda, mengapakah peningkatan kemahiran berfikir
kreatif melalui mereka slaid elektronik dapat dilihatkan dalam
kajian tersebut?Dalam proses mereka slaid, suasana mereka yang
interaktif, mereka akan menjanakan idea dalam penghasilan slaid
elekronik mereka selain mengadaptasikan semua kemahiran yang sedia
ada untuk menghasilkan slaid elektronk.1) How many students were
involved in this research?A 25 studentsC 60 studentsB 50 studentsD
100 students2) When the students took the post test?A 6 weeks after
pre-testB 5 weeks after pre-testC 6 months after pre-test3) Why
analysis of covariance, ANCOVA was carried out?A to calculate the
meanB to calculate the standard deviation C to know how many
electronic slides was producedD to investigate the differences of
two groups4) Arrange the sequence of procedures.IExperimental
undergo computer programmed while control group not
IIExperimental group designed slides
IIIBoth group take the TTCT Figural Form A again
IVControl and experimental were given TTCT Figural Form A
A I, II, III and IVB II, IV, III, and IC IV, I, II, and III5)
Would you think that creating electronic slides or powerpoint show
the creative thinking of students? Explain. Yes, students use their
mentality to create a creative slide by adding animation, sound,
graphic, colors and so on. During the process of designing,
students edit, redo the slide, this trigger their creative
thinking.
CONCEPT MAPPING IN CHEMISTRY LESSONS :TOOLS FOR INCULCATING
THINKING SKILLS IN CHEMISTRY LEARNING
1. Where is this study has been conducted? A. IndonesiaB.
MalaysiaC. SingaporeD. Thailand2. What type of research design has
been used in this study? A. True-experimentB. Quasi ExperimentC.
Causal Comparative
3. How can making hypothesis in science process skill integrated
with the thinking skill?A. By drawing a statement based on the
outcome.B. By analysing the data and graph.C. By making connections
between variables.
4. The less suitable subject that can be taught using the
concept mapping isA. HistoryB. MathematicsC. English
5. In the study, the authors have mentioned that there is a
strong association between integrated science process skills and
thinking skills. Explain it.
In science process skills, making hypothesis is one of the
crucial procedures. Before that, students are needed to identify
the variables in an event by characterizing and analysing the
information of an event. Then, students should make connection
between those variables and making the hypothesis. These science
process skills, which are identify variables and making hypothesis
show that the students are able to improve and develop their
thinking skills when they were guided by teachers in the right
way.
CONCEPT MAPPING IN CHEMISTRY LESSONS :TOOLS FOR INCULCATING
THINKING SKILLS IN CHEMISTRY LEARNING
1. What is the instrument has been used in this study?A. Test of
Integrated Process Skills (TIPS)B. Strait-Trait-Cheerfulness
InventoryC. Creative Output Cast
2. What are the three teaching strategies have been used to
conduct this study?I Concept MappingII ConventionalIII Electronic
SlideIV Vee Diagram
A. I , II and IIIB. I, II and IVC. I, III and IVD. II, III and
IV
3. Which of the thinking skills can describe the science process
skill in interpret data and graph?
I. SynthesisII. Make relationshipIII. AnalyzeIV. Make
connection
A. I , II and IIIB. I, II and IVC. I, III and IV
4. Based on the table below, we can make a conclusion that..
A. As overall students thinking skills have been decreased.B.
Thinking skill of the students used teaching strategy (E2) has been
improved drastically according to standard deviation.C. Only
students in group E1 have changes in their thinking skills.D.
Students in high level category show the highest improvement in
their thinking skills followed by students in moderate and low
level.
SOALAN TERBUKA
5. This study shows the significant positive increments of
students thinking skills in high ability students are due to ..
Answer : the level of students readiness, willingness and
motivation to the learning process.
THE EFFECT OF CONCEPT MAPPING ON PRESERVICE TEACHERS REFLECTIVE
PRACTICES WHEN MAKING PEDAGOGICAL DECISIONS
1. Reliability testing is referring to the degrees of freedom of
the test scores from the error. How a test is said to have high
reliability?
a) The range of scores on the tests produced different in
different times and places. b) Produced the same range of scores in
the test, at different times and places. c) The range of scores
produced the same at the same time and place. d) The range of
scores produced different at the same time and place.
2.The researcher were interested in determining if there was a
correlation between the use of concept mapping to help preservice
teacher to improve their scores on the Teacher Work Sample (TWS)
and Student Teacher Assessment Instrument (STAI).Based on the
statement, what is the Independent Variable for the study?a) The
score on TWSb) Concept mappingc) Preservice teacher
3.Finding from the ANCOVA on hypothesis 1, the result were
unexpected since the researchers had anticipated that higher scores
on the concept maps would result in higher scores in lesson plan,
what is the possible explanation for the result?a) Different
learning styles and multiple intelligences among students.b) Some
students indicated difficulty in constructing the concept maps.c)
Experimenter bias result in the researcher unintentionally that
affecting the behavior.d) The concept mapping must be build up
piece by piece with small units of interacting concept.
4. The statements below explain the theoretical basis for
reflective practices that it is important for preservice teachers
to be aware of the process of learning, EXCEPT
1. Pedagogical reasoning defines the process of identification
and selection of strategies for representing key ideas in the
lesson.1. Reflection requires preservice students to think about
what theyknow as well as how students learn and to understand that
this impacts their effectiveness as teachers.1. social learning
states behavior is learned from the environment through the process
of observational learning.
5. What are the possible reasons of the concept mapping can
improve the reflective practice among junior level preservice
teachers?Concept mapping is a way of providing a more comprehensive
understanding of what teachers preparing to teach, eliminating
sequencing errors and enabling them to develop lessons that are
truly interdisciplinary. It is also a tool to help learners
understand the concept of similarities and differences, cause and
effect, part as opposed to whole analogical sets.THE EFFECT OF
CONCEPT MAPPING ON PRESERVICE TEACHERS REFLECTIVE PRACTICES WHEN
MAKING PEDAGOGICAL DECISIONS
1. Since the research participants were not randomly assigned to
the experimental and comparison group. What is the design should be
used to conduct the study?a) Surveyb) Ratioc) True experimentd)
Quasi experiment
2. What is the deductive strategy?a) Also called discovery
teaching or inquiring teaching.b) The teacher gives the students a
new concept, explaining it then has the students practice it.c) The
teacher presents students with many examples showing how the
concept is used.
3. Choose three theoretical foundations that are used for a
holistic scoring rubric for assessing students conceptual growth of
idea using concept maps:a) Clarifying, expanding and assimilatingb)
Expanding, assimilating and reflectingc) Expanding, assimilating
and analyzedd) Clarifying, expanding and analyzed
4. The statements below explain the pedagogical strategies,
exclude:a) Planning and evaluationb) Teaching method and feedbackc)
Reinforcement and high achievement d) Questioning and individual
instruction
5. In your opinion, how the use of mind maps can help a student
in understanding lesson?Help student understand the concept of
similarities and differences, cause and effect, part as opposed to
whole and analogical sets.
Facilitating Students Geogmetric Thinking Through Van Hieles
Phase-Based Learning Using Tangram
1. Alatyang digunakandalampembelajarangeometri Van Hiele di
kalanganmuridadalah A. Jangkasudut C. Tangraf B. Tangram D.
Tangolok
2. Berikutadalahkesanpembelajarangeometri Van Hiele di
kalanganmuridkecuali A. meningkat B. MencabarC. tiadaperubahan
3. Van Hielemenggunakan 2
tahapuntukmelaksanakanpengajarangeometriini.Nyatakanlangkahtersebut:-A.
Kaedahsoalselidikdan main perananB. Kaedahpengelihatandan
mainperananC. Kaedahpengelihatandan brainstormingD.
KaedahPenglihatandanAnalisis
4. Bagaimanakahpembelajaran Tangram
dapatmenstimulasikanpembelajaranmanipulasidanbahanpengajaran?A.
membolehkanpelajarberpemikirangeometridan proses mencarisebab.B.
membolehkanpelajardapatmaklumatbalasdanmencarimakna.C.
membolehkanpelajardapatrangsangandanmemahamitindakantersebut.
5.
Dalamhasildapatan,kajianinimemberikanperbezaansignifikantdalam
Pre-test dan Post-test? Berikanpendapatkamu. A.
Kajianiniamatberkesanpadamuridsekolahkeranaiameningkatkemahiranberfikirpadaperingkatawaldanmemberipendedahanawalmengenaipenguasaangeometri.
B. Kajian ini meletakkan menjuruskan kepada latihan tubi. C. Kajian
ini merupakan langkah pertama bagi kemahiran menulis, membaca dan
megira. D. Kajian ini menghalatujukan perkembangan pembelajaran
fizikalogi .
Facilitating students, geometric thinking through van Hieles
phase based learning using tangram
Q1) Which of the following teaching strategy was applied in this
research?(A) Contructivism (B) Vygotsky (C) van Hieles phases of
learning(D) Cooperate learning
Q2) What was the subject this research was based upon?(A)
Biology(B) Chemistry (C) Mathematics
Q3)A Tangram is the oldest Chinese puzzle that consists of seven
geometric pieces of shapes, called tans. Why the Tangram is
considered suitable to teach geometry?(A) Helps to develop students
manipulative and reasoning skills (B) Helps students to develop
lateral thinking (C) Learning will be fun and students can absorb
the lesson easier
Q4) The van Hieles model is divided into 5 phases of learning.
The first phase is the Visualisation phase. How does visualisation
increases students understanding in geometry thinking?(A) Learners
visually recognize shapes and figures by their global appearance.
(B) Learners are able explicitly identify the properties of the
figures. (C) Helps learners to develop their skills of geometry
vocabulary (D) Discover relationships between and among the
2-dimensional geometric shapes
Q5) A single group pre test-post test experimental research
design was employed in this study. This is considered a weak
experimental design. What are the limitations or weakness in using
this type of research design?Weakness: No Control group No way of
knowing whether traditional method of teaching could produce better
result Uncontrolled-for threats to internal validity that might
explain the results of the post test Example: maturation and data
collector characteristics
Tajuk jurnal: Critical Thinking Disposition: A Neglected Loop of
Humanities Curriculum in Higher Education ( Kecenderungan Pemikiran
Kritis: Pengabaian Kurikulum Kemanusiaan dalam Pendidikan
Tinggi)
1. Apakah bentuk kajian yang digunakan dalam kajian ini,
Critical thinking disposition: A neglected loop of humanities
curriculum in higher education.
AKajian kesBTinjauan CEksperimentalDKajian reka bentuk
kuasi-eksperimen (Quasi-experiment)
2. Bagaimanakah kaedah yang lebih bersistematik digunakan untuk
menganalisis data yang diperolehi dalam sesuatu kajian.
ASPSS statisticsBSoal selidikCUjian T
3. Menurut Hurt (1999) dalam Maghsood Amin Khandaghi dan Hamideh
Pakmehr (2012), sistem akademik telah mewajibkan semua pelajar
mesti lulus beberapa kursus dalam pemikiran kritikal sebelum tamat
pengajian mereka.
Merujuk penyataan ini, mengapakah kemahiran berfikir secara
kritikal penting dan perlu ditekankan dikalangan pelajar pengajian
tinggi.
iMenggalakkan pelajar lebih fokus dan dapat meyelesaikan masalah
dengan membuat keputusan yang bijak.iiSebagai persediaan kepada
pelajar menghadapi pelbagai situasi.iiiSebagai imej pelajar
berpendidikan tinggi berbanding dengan golongan biasa.ivBagi
memenuhi syarat lulus pengajian mereka di universiti.Ai dan iiBi,
ii dan iiiCi,ii dan iv
4. Kurikulum merupakan suatu rangkaian pendidikan menyeluruh
dalam sesuatu sistem pendidikan, merangkumi matlamat, kandungan,
kaedah pembelajaran dan penilaian. Mengapakah sekiranya tiada
kecenderungan kemahiran berfikir dikalangan pelajar, kurikulum yang
digunakan perlu disemak semula?
AKandungan dalam kurikulum yang digunakan tidak begitu
menggalakkan pelajar menggunakan kemahiran berfikir secara kritis
dan perlu semak semula.BKurikulum yang digunakan tidak menepati
standard pendidikan tinggi. CKurikulum yang digunakan tidak relevan
dengan perubahan masa kini.DPelajar bosan dan malas berfikir kerana
kurikulum yang sama digunakan dari semasa ke semasa.
5. Mengikut pandangan anda, bagaimanakah cara untuk mengalakkan
kemahiran berfikir dikalangan pelajar pengajian tinggi.
JAWAPAN
1. B2. A3. C4. A5. Pendidik perlu mempelbagaikan kaedah
pengajaran yang lebih efektif dan menggalakkan pelajar
menyelesaikan masalah dalam pengajaran dan pembelajaran. Menyemak
semula kurikulum dan mengemaskininya dengan lebih menekankan kepada
kemahiran berfikir dalam kandungan kurikulum. Journal :
Incorporating critical thinking in the pedagogical content of a
teacher education programme: does it make a difference?
1. Siapakah yang dikaji dalam kajian ini?A. Murid B. Guru
Pelatih C. Pensyarah
2. Kajian ini dijalankan di mana? A. Turki B. Malaysia C.
Australia
3. Terdapat 35 strategi dalam kandungan kursus pedagogi. 35
strategi dikategorikan di bawah:. Affective Strategy. Cognitive
Strategy Micro Ability. Psychomotor Strategyv. Cognitive Strategy
Macro Ability A. onlyB. & C. , & D. , & v
4. Cara mengajar kemahiran berfikir kepada murid dalam
Pengajaran dan Pembelajaran adalah dengan:. Menyoal soalan yang
memprovokasi pemikiran . Memfokuskan perbincangan . Pastikan murid
mengadili setiap pandangan v. Latihan menulis A. onlyB. & C. ,
& D. , & v
5. Mengapa kumpulan treatment menunjukkan perubahan yang
signifikan dalam ujian Post Test berbanding kumpulan
control?Kumpulan Treatment telah diasingkan dan diajar kandungan
kursus yang menyelitkan 35 strategi ctitical thinking. Oleh itu,
mereka menunjukkan perubahan signifikan berbanding kumpulan control
yang diajar kandungan kursus biasa
MISKONSEPSI DALAM KALANGAN PELAJAR PADA TOPIK CAHAYA DAN UPAYA
MENGATASINYA
1. Apakah kaedah pengajaran yang digunakan oleh guru dalam
kajian ini bagi mengatasi masalah miskonsepsi murid terhadap topik
cahaya ?A. Kaedah pembelajaran masteri B. Kaedah pembelajaran
kontekstual C. Kaedah pembelajaran inkuiri D. Kaedah pembelajaran
koperafit
2. Yang berikut, yang manakah bukan proses dalam pembelajaran
secara Kaedah Inkuiri?A. Penyoalan B. Membina penerangan (tugasan)
C. Berfikir secara pantas
3. Guru yang mengamalkan Kaedah Inkuiri mempunyai ciri-ciri
seperti yang berikut: I. Memahami isi kandungan II. Memahami
ciri-ciri setiap pelajar III. Sentiasa berfikiran terbuka terhadap
respon pelajarIV. Sentiasa berusaha memberi input yang maksimum
kepada pelajar A. I, II dan IIIB. I, II dan IVC. I, III dan IVD.
II, III dan IV
4. Antara berikut, penyataan yang manakah tepat tentang kaedah
pembelajaran secara inkuri?A. Kaedah inkuiri dapat meningkatkan
minat pelajar terhadap sesuatu pembelajaranB. Kaedah inkuiri lebih
sesuai diaplikasikan oleh pelajar sekolah menengah berbanding
dengan pelajar sekolah rendahC. Kaedah inkuiri hanya dapat
dikatakan telah diaplikasi sekiranya eksperimen telah dijalankan
semasa proses pengajaran dan pembelajaran
5. Kaedah inkuiri adalah berdasarkan falsafah John Dewey yang
menyatakan bahawa proses pengajaran dan pembelajaran hendaklah
merangkumi tiga aspek utama iaitu I. penyiasatanII. pemikiran
reflektif III. pemikiran inovatif IV. jumpaanA. I, II dan IIIB. I,
II dan IVC. I, III dan IVD. II, III dan IV