April 12, 2018 Payload 3 Daily Flight Report Date: 2018-04-12 Flight Campaign ID: 2018_P3C1 Airport, FBO ID, City: Boulder Municipal Airport (KBDU) - Boulder, CO Domain: 00 Sites Flown: V10C (Boulder City South), TRAIN (Training) Days left in Domain:3 Report Author: Ivana Vu Flight Crew: Ivana Vu, Abe Morrison, Matt Devoe Flight Hours: 00:46 Ground/GPS: Robb Walker Hours until maintenance: 85.23 Pilots: Mike Francis, Paul Muth Additional Personnel: None GPS Instruments: 01 - FBO_KBDU Summary Cloudy conditions prevented calibration flights so a training flight was conducted this morning before the winds picked up. The aircraft will be grounded tomorrow due to a damaged propeller. Concerns During a routine inspection, pilots noticed that the right propeller is damaged and will need to be replaced. P3 flights will likely be delayed until Saturday. Comments - We plan to conduct flights this weekend in attempt to complete the Radiometric Calibration before the aircraft transits to D11 on Monday - Ivana completed a 3 rd Riegl training flight and is now certified to operate Payload 3 - John Adler’s Remote Sensing students from CU visited the hangar for an AOP tour this afternoon
Welcome message from author
This document is posted to help you gain knowledge. Please leave a comment to let me know what you think about it! Share it to your friends and learn new things together.
Transcript
April12,2018Payload3DailyFlightReport
Date:2018-04-12FlightCampaignID:2018_P3C1Airport,FBOID,City:BoulderMunicipalAirport(KBDU)-Boulder,CODomain:00SitesFlown:V10C(BoulderCitySouth),TRAIN(Training)DaysleftinDomain:3ReportAuthor:IvanaVu FlightCrew:IvanaVu,AbeMorrison,MattDevoe FlightHours:00:46Ground/GPS:RobbWalker Hoursuntilmaintenance:85.23Pilots:MikeFrancis,PaulMuth AdditionalPersonnel:None GPSInstruments:01-FBO_KBDUSummaryCloudyconditionspreventedcalibrationflightssoatrainingflightwasconductedthismorningbeforethewindspickedup.Theaircraftwillbegroundedtomorrowduetoadamagedpropeller.ConcernsDuringaroutineinspection,pilotsnoticedthattherightpropellerisdamagedandwillneedtobereplaced.P3flightswilllikelybedelayeduntilSaturday.Comments-WeplantoconductflightsthisweekendinattempttocompletetheRadiometricCalibrationbeforetheaircrafttransitstoD11onMonday-Ivanacompleteda3rdRiegltrainingflightandisnowcertifiedtooperatePayload3-JohnAdler’sRemoteSensingstudentsfromCUvisitedthehangarforanAOPtourthisafternoon
FlightScreenshots
PicturesJohnAdler’sRemoteSensingstudentsfromCU(PhotoCredit:HeatherRogers)
ViewofLongsPeakduringthetransitbackfromatrainingflight(taken4/10/18)
DailyCoverageD00|V10C Line SpecG SpecY SpecR NIS Lidar Camera Cumulative 1 ✓ ✓ ✓ NLC 2 ✓ ✓ ✓ NLC 3 ✓ ✓ ✓ NLC 4 ✓ ✓ ✓ NLCFlown: 4
CumulativeDomainCoverageN/A(Calibration&Trainingflights)
WeatherForecast
FlightCollectionPlanfor13April2018NoflightsscheduledduetoaircraftmaintenanceFlightCollectionPlanfor14April2018Flyority1CollectionArea:TableMountainRadiometricCalibrationFlightPlanName:D10_R10C_Rad_Cal_TMBT_v1_Q780.rppFlyority2CollectionArea:NISOffsetFlightFlightPlanName:D10_O10B_NIS_Offset_v2_Q780.rppCrewJohnAdler,NickMarusich,IvanaVuFlightCollectionPlanfor15April2018Flyority:SameaspreviousdayCrew:JohnAdler,MitchHaynes,RobbWalkerFlightCollectionPlanfor16April2018TransittoD11(WichitaFalls,TX)Crew:MitchHaynesNewIssuesNoneOn-GoingIssuesDiskSet,HotelKit–HotelKitdoesnotrecognizeMIDAS2disk(Set2)ResolvedIssues(Today)None
Related Documents
