Tertiary Structure Prediction Methods Any given protein sequence Structure selection Compare sequence with proteins have solved structure Homology Modeling > 35% Fold Recognition ab initio Folding < 35% < 35% Structure refinement Final Structure Structure selection
29
Embed
Tertiary Structure Prediction Methods Any given protein sequence Structure selection Compare sequence with proteins have solved structure Homology Modeling.
This document is posted to help you gain knowledge. Please leave a comment to let me know what you think about it! Share it to your friends and learn new things together.
Transcript
Tertiary Structure Prediction MethodsAny given protein sequence
Structure selection
Compare sequence with proteins have solved structure
HomologyModeling
> 35%
Fold Recognition
ab initioFolding
< 35%< 35%
Structure refinement
Final Structure
Structure selection
Why Homology modelling ?
X-ray Diffraction – Only a small number of proteins can be made to form crystals.– A crystal is not the protein’s native environment.– Very time consuming.
NMR Distance Measurement –– Not all proteins are found in solution.– This method generally looks at isolated proteins rather than protein complexes.– Very time consuming
Homology Modeling:Principles, tools and
techniques• Development of molecular biology: rapid
identification, isolation and sequencing of genes.• Problem : time-consuming task to obtain the 3D-
structure of proteins.• Alternative strategy in structural biology is to
develop models of protein when the constraints from X-ray diffraction or NMR are not yet available.
• Homology modeling is the method that can be applied to generate reasonable models of protein structure.
Database approach to homology modelling
As of June 2000, 12,500 protein structures have been deposited into the Protein Data Bank (PDB) and 86,500 protein sequence entries were contained in SwissProt protein sequence database.• This is a 1:7 ratio – relatively few structures are known.• The number of sequence will increase much faster than the number of structures due to advances in sequencing.
Sequence similarity methods
• These methods can be very accurate if there is > 50%sequence similarity.
• They are rarely accurate if the sequence similarity < 30%.
• They use similar methods as used for sequence alignmentsuch as the dynamic programming algorithm, hiddenmarkov models, and clustering algorithms.
What is Homology Modeling?
• Predicts the three-dimensional structure of a given protein sequence (TARGET) based on an alignment to one or more known protein structures (TEMPLATES)
• If similarity between the TARGET sequence and the TEMPLATE sequence is detected, structural similarity can be assumed.
• In general, 30% sequence identity is required for generating useful models.
• Once a suitable template is found, it is a good idea to do a literature search (PubMed) on the relevant fold to determine what biological role(s) it plays.
• Does this match the biological/biochemical function that you expect?
Other factors to consider in selecting templates
• Template environment
– pH
– Ligands present?
• Resolution of the templates
• Family of proteins
– Phylogenetic tree construction can help find the subfamily closest to the target sequence
• Multiple templates?
Target-Template Alignment
• No current comparative modeling method can recover from an incorrect alignment
• Use multiple sequence alignments as initial guide.
• Consider slightly alternative alignments in areas of uncertainty, build multiple models
• Sequence-Structure alignment programs
– Tries to put gaps in variable regions/loops
• Note: sequence from database versus sequence from the actual PDB are not always identical
Target-Multiple Template Alignment
• Alignment is prepared by superimposing all template structures
• Add target sequence to this alignment• Compare with multiple sequence alignment and
adjust
Adjusting the alignment
• Using tools such as Joy (www-cryst.bioc.cam.ac.uk/~joy/) to view secondary structure along the alignment and use this information as criteria for adjustments
• Avoid gaps in secondary structure elements
0 * 240 * 260 * 280 * 1ad3 : LKPSEVSGHMADLLATLIPQY-M---DQNLYLVVKGGVPETTELLK--ERFDHIMYTGSTAVGKIVMAAAAK- : 2001cw3 : MKVAEQTPLTALYVANLIKEAGF---PPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSS : 2541ad3_4 : LKPSEVSGHMADLLATLIPQY-M---DQNLYLVVKGGVPETTELL--KERFDHIMYTGSTAVGKIV-MAAAAK : 2001cw3_4 : MKVAEQTPLTALYVANLIKEAGF---PPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSS : 2541ad3_5 : LKPSEVSGHMADLLATLIPQY-M---DQNLYLVVKGGVPETTELLKER--FDHIMYTGSTAVGKIV-MAAAAK : 2001cw3_5 : MKVAEQTPLTALYVANLIKEAGF---PPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSS : 2541ad3_6 : LKPSEVSGHMADLLATLIPQY-M---DQNLYLVVKGGVPETTELLKER--FDHIMYTGSTAVGKIV-MAAAAK : 2001cw3_6 : MKVAEQTPLTALYVANLIKEAGF---PPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSS : 2541ad3_ce : LKPSEVSGHMADLLATLIPQYM----DQNLYLVVKGGV-PETTELLKE-RFDHIMYTGSTAVGKIVMAAAA-K : 2001cw3_ce : MKVAEQT---PLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSS : 254 6K E 3 a a 6i 6 6V G p 6 D 6 5TGST 6G466 AA
Secondary Structure Prediction
The Predict Protein server http://www.embl-heidelberg.de/predictprotein/ Adding secondary structure prediction algorithms can
help make decisions on whether helices should be shortened/extended in areas of poor sequence identity.
• Building a multi-domain protein using templates corresponding to the individual domains
• proteinAaaaaaaaaaaaaa---------------------
• proteinB -----------------bbbbbbbbbbbbbbb
• Targetaaaaaaaaaaaaabbbbbbbbbbbbbbb
Multiple model approach
Reminder: Consider the effects of different substitution matrices, different gap penalties, and different algorithms. (Vogt et al. J. Mol. Biol. 1995, 249:816-831.)
Construct multiple models Use structural analysis programs to determine best
model
Jaroszewski, Pawlowski and Godsik, J. Molecular Modeling, 1998, 4:294-309Venclovas, Ginalski and Fidelis. PROTEINS, 1999, 3:73-80 (Suppl)
Model Building
• Rigid-Body Assembly
– Assembles a model from a small number of rigid bodies obtained from aligned protein structure
– Implemented in COMPOSER
• Segment Matching
• Satisfaction of Spatial Restraints
– MODELLER
– guitar.rockefeller.edu/modeller/modeller.html
Modeller
• Main input are restraints on the spatial structure of AA and ligands to be modeled.
• Output is a 3D structure that satisfies these restraints
• Restraints are obtained from related protein structures (homology modeling) - obtained automatically, NMR structures, secondary struture packing and other experimental data
What are the Restraints ?
distances, angles, dihedral angles, pairs of dihedral angles and some other spatial features defined by atoms or pseudo atoms.
Sidechain Conformation
• Protein sidechains play a key role in molecular recognition and packing of hydrophobic cores of globular proteins
• Protein sidechain conformations tend to exist in a limited number of canonical shapes, usually called rotamers
• Rotamer libraries can be constructed where only 3-50 conformations are taken into account for each side chain
Sidechains on surface of protein
• Exposed sidechains on surface can be highly flexible without a single dominant conformation
• So ultimately if these solvent exposed sidechains do not form binding interactions with other molecules or involved in say, a catalytic reaction, then accuracy may not be crucial—also look at the B-factors
• Can refine the sidechains with molecular mechanics minimization
– Sampling?
– Scoring?
Errors in Homology Modeling
a) Side chain packing b) Distortions and shifts c) no template
Errors in Homology Modeling
d) Misalignments e) incorrect template
Marti-Renom et al., Ann. Rev. Biophys. Biomol. Struct., 2000, 29:291-325.
Detection of Errors
• First check should include a stereochemical check on the modeled structure—PROCHECK, WHATCHECK, DISTAN– which will show deviations from normal bond lengths, dihedrals, etc.
• Visualization– follow the backbone trace and then subsequently move out to Cα-Cβ orientation.