Structural Bioinformatics R. Sowdhamini National Centre for Biological Sciences Tata Institute of Fundamental Research Bangalore, INDIA.

Structural Bioinformatics

R. Sowdhamini

National Centre for Biological Sciences Tata Institute of Fundamental Research

Bangalore, INDIA

Prediction with inputs from Structural Bioinformatics

Genome-wide analysis of protein families

Evolutionary relationships amongst proteins

Design of new function to an existing scaffold

Design of novel protein folds

Recent technical advances

Sensitive sequence searches: profiles and HMMs

Large scale computing in cluster environment

Successful design of novel folds and new functions

Example of recent advances: 1Genome-wide survey

• Mechanisms of thermal adaptation revealed from the genome of the antarctic Archaea Methanogenium frigidum and Methanococcoides burtonii. Saunders et al., Genome Res 2003 (7):1580-8

Examples of recent advances: 2Function prediction

• Using multiple sequence correlation analysis to characterize functionally important protein regions.

• Saraf et al., Protein Eng 2003 • 16:397-406.

Examples of recent advances: 3Protein-protein interactions

• Interrogating protein interaction networks through structural biology. Aloy and Russell, Proc Natl Acad Sci U S A. 2002, 99:5896-901.

Examples of recent advances: 4targets for structural genomics

• Automatic target selection for structural genomics on eukaryotes.

• Liu et al., Proteins, 2004, 56:188-200.

Examples of recent advances: 5large scale modelling

• Protein structure prediction for the male-specific region of the human Y chromosome. Ginalski et al., Proc Natl Acad Sci U S A. 2004, 101:2305-10.

• Comparative protein structure modeling by iterative alignment, model building and model assessment. John & Sali Nucleic Acids Res. 2003, 31:3982-92.

Examples of recent advances: 6Docking and inhibitor design

• Discovery of a potent and selective protein kinase CK2 inhibitor by high-throughput docking. Vangrevelinghe et al., J Med Chem. 2003, 46:2656-62.

• Structural modes of stabilization of permissive phosphorylation sites in protein kinases: distinct strategies in Ser/Thr and Tyr kinases. Krupa et al., J Mol Biol. 2004, 339:1025-39.

Examples of recent advances: 7Design of new function

• Computational design of a biologically active enzyme. Dwyer et al., Science 2004, 304:1967-71.

Examples of recent advances: 8Design of novel fold

• Design of a novel globular protein fold with atomic-level accuracy. Kuhlman et al., Science 2003, 302:1364-8.

Protein folding |||

Sequence alignment |||

Protein structure prediction |||||||

Secondary structure prediction ||||||||||

Side chain prediction ||

Protein structure comparisons ||||||||||

Protein-protein interactions ||||||||||||

Protein-RNA interactions ||

Protein structure analysis |||||

Function prediction |||||

Homology modelling |||

Visualisation server |||

Miscellaneous |||||

Prediction and Structural Bioinformatics

How does a protein fold?

Papers in this session

YNRLCIKPRDWIDECDSNEGGERAYFRNG

KGGCDSFWICPEDHTGADYYSSYRDCFNACI

Prediction and Structural Bioinformatics

Can functionally important residues be recognised?

Can structure prediction lead to function prediction?

Prediction and Structural Bioinformatics

What happens subsequent to ligand binding?

Paper in this session

How does a protein recognise its ligand?

Prediction and Structural Bioinformatics

How do protein-protein interactions happen?

Paper in this session