Spectra correspond to entries in “protein identification file.xls”

Spectra correspond to entries in “protein identification file.xls”

MS/MS Fragmentation of YYDDNYIDGLFEIMRKFound in Q5UR95, YL577_MIMIV Uncharacterized protein L577 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L577 PE=4 SV=1

Match to Query 5087: 2299.094248 from(1150.554400,2+)Title: C:\Andrew Weston\TEMP\2_4067.pkl (query 461)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of YTGTQDNGGVHTNSGIINKFound in P23384, NPRE_BACCL Bacillolysin OS=Bacillus caldolyticus GN=npr PE=1 SV=1

Match to Query 5069: 2288.177448 from(1145.096000,2+)Title: C:\Andrew Weston\TEMP\2_4062.pkl (query 317)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of YTGSQDNGGVHTNSGINNKFound in P43263, NPRE_BREBE Bacillolysin OS=Brevibacillus brevis GN=npr PE=1 SV=1

Match to Query 3726: 2273.106072 from(758.709300,3+)Title: C:\Andrew Weston\TEMP\2_4028.pkl (query 159)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of YQTLLAEQGAAPVETQHRGKFound in Q7NNH7, RS6_GLOVI 30S ribosomal protein S6 OS=Gloeobacter violaceus GN=rpsF PE=3 SV=1

Match to Query 4349: 2549.352448 from(1275.683500,2+)Title: C:\Andrew Weston\TEMP\2_4042.pkl (query 61)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of WDNEEYWQQAEGKFound in P42852, CUPP_BOMMO Pupal cuticle protein OS=Bombyx mori GN=PCP PE=2 SV=1

Match to Query 3195: 2033.934972 from(678.985600,3+)Title: C:\Andrew Weston\TEMP\2_4037.pkl (query 249)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of VSTLDMQNLPLTDKFound in Q3IGU4, SYN_PSEHT Asparaginyl-tRNA synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=asnS PE=3 SV=1

Match to Query 4425: 2005.129248 from(1003.571900,2+)Title: C:\Andrew Weston\TEMP\2_4069.pkl (query 359)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of VSQKSLGAVIEDIQKFound in Q73IC3, ENGB_WOLPM Probable GTP-binding protein engB OS=Wolbachia pipientis wMel GN=engB PE=3 SV=1

Match to Query 3843: 2273.037072 from(758.686300,3+)Title: C:\Andrew Weston\TEMP\2_4050.pkl (query 259)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of VQSISLGQGQGPIAEKMVKFound in Q9C0G6, DYH6_HUMAN Dynein heavy chain 6, axonemal OS=Homo sapiens GN=DNAH6 PE=1 SV=3

Match to Query 4406: 2606.289372 from(869.770400,3+)Title: C:\Andrew Weston\TEMP\2_4041.pkl (query 89)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of VAFQAVTKAGQYAYRFound in B6EN31, RL20_ALISL 50S ribosomal protein L20 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplT PE=3 SV=1

Match to Query 4196: 1901.056872 from(634.692900,3+)Title: C:\Andrew Weston\TEMP\2_4062.pkl (query 302)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of VAFQAVTKAGQYAYRFound in B6EN31, RL20_ALISL 50S ribosomal protein L20 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplT PE=3 SV=1

Match to Query 4198: 1901.089272 from(634.703700,3+)Title: C:\Andrew Weston\TEMP\2_4061.pkl (query 125)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of TSALLTCAKDSQFSASYFEAAFFPRFound in Q08844, YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae GN=YOR365C PE=1 SV=1

Match to Query 4811: 3267.614896 from(817.911000,4+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 166)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of TQLYNFKKFound in P40086, COX15_YEAST Cytochrome c oxidase assembly protein COX15 OS=Saccharomyces cerevisiae GN=COX15 PE=1 SV=1

Match to Query 2289: 1542.744672 from(515.255500,3+)Title: C:\Andrew Weston\TEMP\2_4048.pkl (query 237)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of TPLIISGGSSSRINLYKFound in Q6F260, SECA_MESFL Protein translocase subunit secA OS=Mesoplasma florum GN=secA PE=3 SV=1

Match to Query 3741: 2273.277448 from(1137.646000,2+)Title: C:\Andrew Weston\TEMP\2_4031.pkl (query 351)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of TNISHNGTYHCSGMGKHRFound in P12314, FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens GN=FCGR1A PE=1 SV=2

Match to Query 4399: 2606.171048 from(1304.092800,2+)Title: C:\Andrew Weston\TEMP\2_4055.pkl (query 346)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of TLSFGSDLNYSTKFound in Q6PCR7, EIF3A_DANRE Eukaryotic translation initiation factor 3 subunit A OS=Danio rerio GN=eif3a PE=2 SV=1

Match to Query 3127: 1943.017296 from(486.761600,4+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 133)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of TKASIPNVAPVNINGGGGSRFound in P97528, CNTN6_RAT Contactin-6 OS=Rattus norvegicus GN=Cntn6 PE=1 SV=1

Match to Query 3661: 2219.011448 from(1110.513000,2+)Title: C:\Andrew Weston\TEMP\2_4047.pkl (query 196)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of TIPECQELLPKFound in P51044, CISY_ASPNG Citrate synthase, mitochondrial OS=Aspergillus niger GN=cit-1 PE=2 SV=1

Match to Query 2282: 1540.912572 from(514.644800,3+)Title: C:\Andrew Weston\TEMP\2_4046.pkl (query 155)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of TGTSVSLGKFound in Q9FDN7, FPRA_MOOTA Nitric oxide reductase OS=Moorella thermoacetica (strain ATCC 39073) GN=fprA PE=1 SV=1

Match to Query 950: 1076.634048 from(539.324300,2+)Title: C:\Andrew Weston\TEMP\2_4060.pkl (query 73)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SYTINSNSLLLNSTLQKFound in P35194, UTP20_YEAST U3 small nucleolar RNA-associated protein 20 OS=Saccharomyces cerevisiae GN=UTP20 PE=1 SV=3

Match to Query 3621: 2249.793248 from(1125.903900,2+)Title: C:\Andrew Weston\TEMP\2_4030.pkl (query 86)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SVNLNNNKFound in Q55BF4, UCPA_DICDI Mitochondrial substrate carrier family protein ucpA OS=Dictyostelium discoideum GN=ucpA PE=3 SV=1

Match to Query 919: 1173.590848 from(587.802700,2+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 65)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SVKINLPHFTLIGATTRFound in A8EZ44, RUVB_RICCK Holliday junction ATP-dependent DNA helicase ruvB OS=Rickettsia canadensis (strain McKiel) GN=ruvB PE=3 SV=1

Match to Query 3662: 2219.021848 from(1110.518200,2+)Title: C:\Andrew Weston\TEMP\2_4054.pkl (query 315)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SVKINLPHFTLIGATTRFound in A8EZ44, RUVB_RICCK Holliday junction ATP-dependent DNA helicase ruvB OS=Rickettsia canadensis (strain McKiel) GN=ruvB PE=3 SV=1

Match to Query 4850: 2219.028848 from(1110.521700,2+)Title: C:\Andrew Weston\TEMP\2_4069.pkl (query 571)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of STQGTTKFound in P32330, YKM1_YEAST WD repeat-containing protein YKL121W OS=Saccharomyces cerevisiae GN=YKL121W PE=1 SV=1

Match to Query 609: 991.519448 from(496.767000,2+)Title: C:\Andrew Weston\TEMP\2_4070.pkl (query 28)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SSCPLANSQYATIKFound in Q1RML7, MAK16_BOVIN Protein MAK16 homolog OS=Bos taurus GN=MAK16 PE=2 SV=1

Match to Query 2671: 1710.754448 from(856.384500,2+)Title: C:\Andrew Weston\TEMP\2_4050.pkl (query 211)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SRQGKGNLGSLQLEVRLRFound in Q6PFQ7, RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=2 SV=1

Match to Query 3910: 2284.198096 from(572.056800,4+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 167)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SLLSNRTKFound in P27754, RT03_OENBE Ribosomal protein S3, mitochondrial OS=Oenothera bertiana GN=RPS3 PE=3 SV=2

Match to Query 1196: 1228.504048 from(615.259300,2+)Title: C:\Andrew Weston\TEMP\2_4045.pkl (query 9)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SLDLLAQARRMAPGLNTKFound in B5EAX0, LIPA_GEOBB Lipoyl synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lipA PE=3 SV=1

Match to Query 3981: 2307.289272 from(770.103700,3+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 146)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SLDLLAQARRMAPGLNTKFound in B5EAX0, LIPA_GEOBB Lipoyl synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lipA PE=3 SV=1

Match to Query 3986: 2307.480672 from(770.167500,3+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 397)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SLAIDPSGTWLATGGDDGTVRVWELLTGKFound in A6RRD4, ERB1_BOTFB Ribosome biogenesis protein erb1 OS=Botryotinia fuckeliana (strain B05.10) GN=erb1 PE=3 SV=1

Match to Query 4815: 3324.552096 from(832.145300,4+)Title: C:\Andrew Weston\TEMP\2_4041.pkl (query 70)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SKLVPSSSEINVASRFound in P42842, YN53_YEAST Uncharacterized protein YNL313C OS=Saccharomyces cerevisiae GN=YNL313C PE=1 SV=1

Match to Query 3242: 2084.258248 from(1043.136400,2+)Title: C:\Andrew Weston\TEMP\2_4033.pkl (query 167)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SILSGMKFound in Q8PS92, DTDA_METMA D-tyrosyl-tRNA(Tyr) deacylase OS=Methanosarcina mazei GN=dtdA PE=3 SV=1

Match to Query 822: 1044.551848 from(523.283200,2+)Title: C:\Andrew Weston\TEMP\2_4060.pkl (query 29)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SGNIEDIEVENLINYIKFound in A8GN90, SYP_RICAH Prolyl-tRNA synthetase OS=Rickettsia akari (strain Hartford) GN=proS PE=3 SV=1

Match to Query 4972: 2272.089672 from(758.370500,3+)Title: C:\Andrew Weston\TEMP\2_4072.pkl (query 201)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SCQPNVELVTIKFound in P36124, SET3_YEAST SET domain-containing protein 3 OS=Saccharomyces cerevisiae GN=SET3 PE=1 SV=1

Match to Query 2583: 1682.900848 from(842.457700,2+)Title: C:\Andrew Weston\TEMP\2_4050.pkl (query 330)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of SANNLIEALKFound in Q3AUH7, DNLJ_SYNS9 DNA ligase OS=Synechococcus sp. (strain CC9902) GN=ligA PE=3 SV=1

Match to Query 1669: 1342.657248 from(672.335900,2+)Title: C:\Andrew Weston\TEMP\2_4055.pkl (query 314)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of RYPGQTEQEMILEVCGSGFLKQMVRFound in C6BW69, TRUA_DESAD tRNA pseudouridine synthase A OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=truA PE=3 SV=1

Match to Query 4465: 3210.401172 from(1071.141000,3+)Title: C:\Andrew Weston\TEMP\2_4027.pkl (query 48)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of RYPGQTEQEMILEVCGSGFLKQMVRFound in C6BW69, TRUA_DESAD tRNA pseudouridine synthase A OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=truA PE=3 SV=1

Match to Query 5956: 3210.598572 from(1071.206800,3+)Title: C:\Andrew Weston\TEMP\2_4060.pkl (query 167)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of RQQVMPPTEQSKRPRFound in Q8CHI8, EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=2

Match to Query 3568: 2188.031848 from(1095.023200,2+)Title: C:\Andrew Weston\TEMP\2_4054.pkl (query 343)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of RNVVKSMQGADLTQRFound in P54122, RNJ_CORGL Ribonuclease J OS=Corynebacterium glutamicum GN=Cgl1970 PE=3 SV=2

Match to Query 3146: 1948.959248 from(975.486900,2+)Title: C:\Andrew Weston\TEMP\2_4054.pkl (query 404)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of RMLLSTCKNFLSLQSCVYYEDIYYYEEIHKFound in Q5UR85, YR636_MIMIV Putative FNIP repeat-containing protein R636 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R636 PE=4 SV=1

Match to Query 4590: 4684.895296 from(1172.231100,4+)Title: C:\Andrew Weston\TEMP\2_4038.pkl (query 395)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of RCSVSVCGKFound in Q6P2L6, NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus GN=Whsc1l1 PE=1 SV=2

Match to Query 806: 1167.541248 from(584.777900,2+)Title: C:\Andrew Weston\TEMP\2_4040.pkl (query 288)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of RASQGLISAVENSESDSSEAKEEVSRFound in Q6PR54, RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus GN=Rif1 PE=1 SV=2

Match to Query 4729: 3153.511272 from(1052.177700,3+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 535)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QYVNVVEYLIRKFound in Q9J4Z9, V241_FOWPV Putative ankyrin repeat protein FPV241 OS=Fowlpox virus GN=FPV241 PE=4 SV=1

Match to Query 2943: 1831.803372 from(611.608400,3+)Title: C:\Andrew Weston\TEMP\2_4057.pkl (query 136)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QYGLSYVKFound in A7I2F2, SUCC_CAMHC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=sucC PE=3 SV=1

Match to Query 1301: 1264.685448 from(633.350000,2+)Title: C:\Andrew Weston\TEMP\2_4037.pkl (query 80)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QVMEEAGKFound in Q90871, IRF8_CHICK Interferon regulatory factor 8 OS=Gallus gallus GN=IRF8 PE=2 SV=1

Match to Query 766: 1134.563848 from(568.289200,2+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 15)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QVLKTVDVPTGSSVRFound in Q4ZNP2, RNFH_PSEU2 Protein rnfH OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rnfH PE=3 SV=1

Match to Query 2981: 1894.035672 from(632.352500,3+)Title: C:\Andrew Weston\TEMP\2_4035.pkl (query 478)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QTGGLTRAMDRGCKFound in Q751N2, ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii

GN=ATM1 PE=3 SV=1

Match to Query 3978: 1777.831848 from(889.923200,2+)

Title: C:\Andrew Weston\TEMP\2_4062.pkl (query 147)Data file C:\Program Files\Matrix Science\Mascot

Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QTFVRMLTCRKFound in Q646A3, TA2R8_GORGO Taste receptor type 2 member 8 OS=Gorilla gorilla gorilla GN=TAS2R8 PE=3 SV=1

Match to Query 2754: 1764.757448 from(883.386000,2+)Title: C:\Andrew Weston\TEMP\2_4036.pkl (query 356)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QTEAENNTLKFound in Q6NY15, TSG10_MOUSE Testis-specific gene 10 protein OS=Mus musculus GN=Tsga10 PE=1 SV=1

Match to Query 2011: 1457.727648 from(729.871100,2+)Title: C:\Andrew Weston\TEMP\2_4056.pkl (query 142)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QSLQAVLPEISGNKTSPLRFound in A7ZVM4, IRAD_ECO24 Anti-adapter protein iraD OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=iraD PE=3 SV=2

Match to Query 4348: 2549.341272 from(850.787700,3+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 369)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QSALGSYINSFTISKFound in P09510, CAPSD_BYDVP Major capsid protein OS=Barley yellow dwarf virus (isolate PAV) GN=ORF3 PE=3 SV=1

Match to Query 4539: 2084.097848 from(1043.056200,2+)Title: C:\Andrew Weston\TEMP\2_4063.pkl (query 238)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QQHVLLMTPALDDRAGKFound in Q5QWC7, KITH_IDILO Thymidine kinase OS=Idiomarina loihiensis GN=tdk PE=3 SV=1

Match to Query 3295: 2124.189972 from(709.070600,3+)Title: C:\Andrew Weston\TEMP\2_4031.pkl (query 245)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QQEIALITEHLMTTKFound in Q6PR54, RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus GN=Rif1 PE=1 SV=2

Match to Query 3615: 2240.835696 from(561.216200,4+)Title: C:\Andrew Weston\TEMP\2_4037.pkl (query 256)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QPLFVRGIGQDITQLKFound in Q6G0G3, ISPE_BARQU 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase OS=Bartonella quintana GN=ispE PE=3 SV=1

Match to Query 3397: 2123.184448 from(1062.599500,2+)Title: C:\Andrew Weston\TEMP\2_4050.pkl (query 279)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QNNVNAEGCLFDKFound in Q6XZ78, SCRK2_MAIZE Fructokinase-2 OS=Zea mays GN=FRK2 PE=1 SV=1

Match to Query 2587: 1682.933848 from(842.474200,2+)Title: C:\Andrew Weston\TEMP\2_4045.pkl (query 132)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QGISAQLMSVVVLLKFound in Q49Y09, RECO_STAS1 DNA repair protein recO OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=recO PE=3 SV=1

Match to Query 2889: 1832.919048 from(917.466800,2+)Title: C:\Andrew Weston\TEMP\2_4040.pkl (query 195)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QFSLPLLDMQAKFound in Q21HF7, Y2612_SACD2 UPF0341 protein Sde_2612 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=Sde_2612 PE=3 SV=1

Match to Query 2483: 1635.906048 from(818.960300,2+)Title: C:\Andrew Weston\TEMP\2_4037.pkl (query 367)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QEASNLLQESNCSQYMEKFound in Q13617, CUL2_HUMAN Cullin-2 OS=Homo sapiens GN=CUL2 PE=1 SV=2

Match to Query 4064: 2549.091448 from(1275.553000,2+)Title: C:\Andrew Weston\TEMP\2_4036.pkl (query 408)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of QAVVGYGRATKFound in B1YTE1, RUVC_BURA4 Crossover junction endodeoxyribonuclease ruvC OS=Burkholderia ambifaria (strain MC40-6) GN=ruvC PE=3 SV=1

Match to Query 1917: 1457.660048 from(729.837300,2+)Title: C:\Andrew Weston\TEMP\2_4030.pkl (query 38)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of NRGLHSPALMKFound in Q9FFU1, CAF2M_ARATH CRS2-associated factor 2, mitochondrial OS=Arabidopsis thaliana GN=At5g54890 PE=2 SV=1

Match to Query 2041: 1467.642848 from(734.828700,2+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 60)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of NNMLNALLDIKFound in Q9N4H4, PME1_CAEEL Poly(ADP-ribose) polymerase pme-1 OS=Caenorhabditis elegans GN=pme-1 PE=2 SV=1

Match to Query 3238: 1530.745448 from(766.380000,2+)Title: C:\Andrew Weston\TEMP\2_4071.pkl (query 133)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of NHGHSTNMQAAQIAKFound in B9DUP5, RNZ_STRU0 Ribonuclease Z OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rnz PE=3 SV=1

Match to Query 4402: 1998.947448 from(1000.481000,2+)Title: C:\Andrew Weston\TEMP\2_4069.pkl (query 215)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of NDWTTKFound in P09498, RDRP_WCMVM RNA replication protein OS=White clover mosaic virus (strain M) PE=3 SV=1

Match to Query 612: 991.526448 from(496.770500,2+)Title: C:\Andrew Weston\TEMP\2_4063.pkl (query 337)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of NDTLNDVINSIKNASRFound in Q9HIS2, RS8_THEAC 30S ribosomal protein S8P OS=Thermoplasma acidophilum GN=rps8p PE=3 SV=1

Match to Query 3234: 2084.057448 from(1043.036000,2+)Title: C:\Andrew Weston\TEMP\2_4029.pkl (query 190)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of NCSIMVRHYKFound in P27551, VE1_HPV41 Replication protein E1 OS=Human papillomavirus type 41 GN=E1 PE=3 SV=1

Match to Query 3766: 1713.748572 from(572.256800,3+)Title: C:\Andrew Weston\TEMP\2_4069.pkl (query 167)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of MYDFFNKFound in A8ZV69, RL5_DESOH 50S ribosomal protein L5 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rplE PE=3 SV=1

Match to Query 2293: 1314.712448 from(658.363500,2+)Title: C:\Andrew Weston\TEMP\2_4061.pkl (query 229)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of MTPLLCLHHLLQQVSVTKFound in Q08681, YO248_YEAST Putative

uncharacterized protein YOR248W OS=Saccharomyces cerevisiae GN=YOR248W PE=5 SV=1

Match to Query 4158: 2370.242448 from(1186.128500,2+)

Title: C:\Andrew Weston\TEMP\2_4046.pkl (query 269)Data file C:\Program Files\Matrix Science\Mascot

Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of MSNSGNIKLINIGFGNIVSANRFound in A4XL87, Y2087_CALS8 UPF0296 protein Csac_2087 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903) GN=Csac_2087 PE=3 SV=1

Match to Query 4475: 2647.248096 from(662.819300,4+)Title: C:\Andrew Weston\TEMP\2_4057.pkl (query 384)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of MSFSAVTKNELARFound in A4J8U4, WHIA_DESRM Putative sporulation transcription regulator whiA OS=Desulfotomaculum reducens (strain MI-1) GN=whiA PE=3 SV=1

Match to Query 3895: 1761.956448 from(881.985500,2+)Title: C:\Andrew Weston\TEMP\2_4065.pkl (query 446)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of MNSVCEKENTNATASNFound in Q9BVR0, HRC23_HUMAN Putative HERC2-like protein 3 OS=Homo sapiens GN=HERC2P3 PE=5 SV=2

Match to Query 3490: 2161.974648 from(1081.994600,2+)Title: C:\Andrew Weston\TEMP\2_4048.pkl (query 161)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of MLDGAQEKFound in Q9TW65, DMD_CAEEL Dystrophin-1 OS=Caenorhabditis elegans GN=dys-1 PE=1 SV=2

Match to Query 783: 1134.640648 from(568.327600,2+)Title: C:\Andrew Weston\TEMP\2_4044.pkl (query 12)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of MLADLEGEPLIVRTWQQATKSRLASRFound in Q8KBF7, KDSB_CHLTE 3-deoxy-manno-octulosonate cytidylyltransferase OS=Chlorobium tepidum GN=kdsB PE=3 SV=1

Match to Query 4784: 3214.609272 from(1072.543700,3+)Title: C:\Andrew Weston\TEMP\2_4050.pkl (query 410)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of MKETDQMQSLEGSGAERSVGTQTGSMTGQIPRFound in Q8BMD5, CDAC1_MOUSE Cytidine and dCMP deaminase domain-containing protein 1 OS=Mus musculus GN=Cdadc1 PE=2 SV=1

Match to Query 4851: 3660.226496 from(916.063900,4+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 434)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of MGMDAGLELKFound in C0R2M3, HEM3_WOLWR Porphobilinogen deaminase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=hemC PE=3 SV=1

Match to Query 1525: 1323.840072 from(442.287300,3+)Title: C:\Andrew Weston\TEMP\2_4034.pkl (query 72)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of MAVSFEKFound in Q9VU84, DBNL_DROME Drebrin-like protein OS=Drosophila melanogaster GN=CG10083 PE=1 SV=1

Match to Query 497: 1080.961824 from(1081.969100,1+)Title: C:\Andrew Weston\TEMP\2_4027.pkl (query 40)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of MASSSTSLKRFound in Q9C952, CPSF3_ARATH Cleavage and polyadenylation specificity factor subunit 3-I OS=Arabidopsis thaliana GN=CPSF73-I PE=1 SV=1

Match to Query 3455: 1592.994072 from(532.005300,3+)Title: C:\Andrew Weston\TEMP\2_4064.pkl (query 418)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of MARDNGNKFound in Q97CX4, RS18_CLOAB 30S ribosomal protein S18 OS=Clostridium acetobutylicum GN=rpsR PE=3 SV=1

Match to Query 1256: 1135.552048 from(568.783300,2+)Title: C:\Andrew Weston\TEMP\2_4062.pkl (query 5)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of LSDQSANNNNVFTKFound in Q86VP1, TAXB1_HUMAN Tax1-binding protein 1 OS=Homo sapiens GN=TAX1BP1 PE=1 SV=2

Match to Query 3122: 1942.912048 from(972.463300,2+)Title: C:\Andrew Weston\TEMP\2_4057.pkl (query 374)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of LLQGLANTSSPKPRFound in O80738, TPS10_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 OS=Arabidopsis thaliana GN=TPS10 PE=2 SV=1

Match to Query 3150: 1949.910048 from(975.962300,2+)Title: C:\Andrew Weston\TEMP\2_4050.pkl (query 356)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of LCASTLNGNIIGGKFound in Q6CSP8, ESF2_KLULA Pre-rRNA-processing protein ESF2 OS=Kluyveromyces lactis GN=ESF2 PE=3 SV=1

Match to Query 3643: 1669.811848 from(835.913200,2+)Title: C:\Andrew Weston\TEMP\2_4068.pkl (query 286)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of KTGLTDAVQTGTGRFound in Q49KY9, ACCD_EUCGG Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=accD PE=3 SV=1

Match to Query 3543: 1633.756048 from(817.885300,2+)Title: C:\Andrew Weston\TEMP\2_4067.pkl (query 277)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of KTDSSLVHQNPPNFound in O74525, YJ44_SCHPO Uncharacterized membrane protein C70.04c OS=Schizosaccharomyces pombe GN=SPCC70.04c PE=2 SV=1

Match to Query 4005: 1786.256472 from(596.426100,3+)Title: C:\Andrew Weston\TEMP\2_4058.pkl (query 114)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of KLDIRGVPTSEATANLARFound in B0T734, RPIA_CAUSK Ribose-5-phosphate isomerase A OS=Caulobacter sp. (strain K31) GN=rpiA PE=3 SV=1

Match to Query 3526: 2218.994648 from(1110.504600,2+)Title: C:\Andrew Weston\TEMP\2_4026.pkl (query 91)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of ISPQVSAGNYEVGQVSYKYNLLKSRFound in Q5QM27, TLP1_ORYSJ Tubby-like F-box protein 1 OS=Oryza sativa subsp. japonica GN=TULP1 PE=2 SV=1

Match to Query 4829: 3382.531572 from(1128.517800,3+)Title: C:\Andrew Weston\TEMP\2_4055.pkl (query 388)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of IRTNEIFDICVLAYPDSKFound in Q12440, APC2_YEAST Anaphase-promoting complex subunit 2 OS=Saccharomyces cerevisiae GN=APC2 PE=1 SV=1

Match to Query 5330: 2407.084096 from(602.778300,4+)Title: C:\Andrew Weston\TEMP\2_4069.pkl (query 489)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of ILLSEAKFound in Q8FTA8, ACON_COREF Aconitate hydratase OS=Corynebacterium efficiens GN=acn PE=2 SV=2

Match to Query 643: 1001.674448 from(501.844500,2+)Title: C:\Andrew Weston\TEMP\2_4061.pkl (query 83)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of IALSQAKFound in O08451, ACON_MYCAV Aconitate hydratase OS=Mycobacterium avium GN=acn PE=3 SV=1

Match to Query 371: 1001.660848 from(501.837700,2+)Title: C:\Andrew Weston\TEMP\2_4044.pkl (query 25)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of IAILSTGDPCFSGLLKFound in Q58917, CBIE_METJA Probable cobalt-precorrin-6Y C(5,15)-methyltransferase [decarboxylating] OS=Methanocaldococcus jannaschii GN=cbiE PE=3 SV=1

Match to Query 3396: 2123.183248 from(1062.598900,2+)Title: C:\Andrew Weston\TEMP\2_4056.pkl (query 213)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of IADQMAKFound in P24171, DCP_ECOLI Peptidyl-dipeptidase dcp OS=Escherichia coli (strain K12) GN=dcp PE=1 SV=4

Match to Query 697: 1020.633648 from(511.324100,2+)Title: C:\Andrew Weston\TEMP\2_4060.pkl (query 44)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of GVSIRIVQNQPSSSMPDTDTQNLAKFound in Q54SA1, PLDZ_DICDI Phospholipase D Z OS=Dictyostelium discoideum GN=pldZ PE=3 SV=1

Match to Query 5965: 3214.495272 from(1072.505700,3+)Title: C:\Andrew Weston\TEMP\2_4066.pkl (query 260)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of GVSIRIVQNQPSSSMPDTDTQNLAKFound in Q54SA1, PLDZ_DICDI Phospholipase D Z OS=Dictyostelium discoideum GN=pldZ PE=3 SV=1

Match to Query 5970: 3214.728672 from(1072.583500,3+)Title: C:\Andrew Weston\TEMP\2_4065.pkl (query 314)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of GVCRTKSTSDNETSRFound in Q0VD05, CCG3_BOVIN Voltage-dependent calcium channel gamma-3 subunit OS=Bos taurus GN=CACNG3 PE=2 SV=1

Match to Query 3354: 2088.021696 from(523.012700,4+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 36)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of GTTGVNCETKFound in P21783, NOTCH_XENLA Neurogenic locus notch protein homolog OS=Xenopus laevis GN=notch1 PE=1 SV=3

Match to Query 1844: 1398.668648 from(700.341600,2+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 45)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of GLLARSVIVVDENGKFound in Q8NRG3, TPX_CORGL Probable thiol peroxidase OS=Corynebacterium glutamicum GN=tpx PE=1 SV=1

Match to Query 3080: 1920.970248 from(961.492400,2+)Title: C:\Andrew Weston\TEMP\2_4050.pkl (query 380)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of GLCGGLNTNVLRMAVSKFound in Q2YCA4, ATPG_NITMU ATP synthase gamma chain OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=atpG PE=3 SV=1

Match to Query 3344: 2084.044048 from(1043.029300,2+)Title: C:\Andrew Weston\TEMP\2_4048.pkl (query 198)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of GFEEVLKSRFound in P77269, YPHF_ECOLI ABC transporter periplasmic-binding protein yphF OS=Escherichia coli (strain K12) GN=yphF PE=1 SV=1

Match to Query 2556: 1372.735848 from(687.375200,2+)Title: C:\Andrew Weston\TEMP\2_4066.pkl (query 87)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of GATDNAKFound in Q03V28, ATPG_LEUMM ATP synthase gamma chain OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=atpG PE=3 SV=1

Match to Query 265: 903.550248 from(452.782400,2+)Title: C:\Andrew Weston\TEMP\2_4068.pkl (query 5)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of FVSQFQGQNEVVVSLKFound in Q9V557, CP4P2_DROME Probable cytochrome P450 4p2 OS=Drosophila melanogaster GN=Cyp4p2 PE=1 SV=1

Match to Query 4707: 2162.113648 from(1082.064100,2+)Title: C:\Andrew Weston\TEMP\2_4061.pkl (query 338)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of FLIMLTGLSTAKFound in Q12340, YRM1_YEAST Zinc finger transcription factor YRM1 OS=Saccharomyces cerevisiae GN=YRM1 PE=1 SV=1

Match to Query 2652: 1698.055572 from(567.025800,3+)Title: C:\Andrew Weston\TEMP\2_4054.pkl (query 492)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of FFITQPAKFound in Q3UYK3, TBCD9_MOUSE TBC1 domain family member 9 OS=Mus musculus GN=Tbc1d9 PE=2 SV=2

Match to Query 1126: 1221.652048 from(611.833300,2+)Title: C:\Andrew Weston\TEMP\2_4045.pkl (query 38)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of FFITQPAKFound in Q3UYK3, TBCD9_MOUSE TBC1 domain family member 9 OS=Mus musculus GN=Tbc1d9 PE=2 SV=2

Match to Query 1082: 1221.650448 from(611.832500,2+)Title: C:\Andrew Weston\TEMP\2_4028.pkl (query 65)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of EVPTNLEYAKFound in P34268, FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2

Match to Query 2803: 1434.686448 from(718.350500,2+)Title: C:\Andrew Weston\TEMP\2_4067.pkl (query 526)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of EKLAYVALVMSKFound in P23344, ACT2_DAUCA Actin-2 OS=Daucus carota PE=2 SV=1

Match to Query 2995: 1851.951448 from(926.983000,2+)Title: C:\Andrew Weston\TEMP\2_4047.pkl (query 152)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of EKKQTHFLHQNNTGITQNLSYIGGFound in A7ZJJ0, MOAA_ECO24 Molybdenum cofactor biosynthesis protein A OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=moaA PE=3 SV=1

Match to Query 5994: 3267.648896 from(817.919500,4+)Title: C:\Andrew Weston\TEMP\2_4060.pkl (query 151)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of EKINTPSRFTTYDFound in Q121Q3, LPTD_POLSJ LPS-assembly protein lptD OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=lptD PE=3 SV=1

Match to Query 3408: 2162.152048 from(1082.083300,2+)Title: C:\Andrew Weston\TEMP\2_4031.pkl (query 169)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of EIYVSAKFound in Q0VNJ7, Y1803_ALCBS UPF0082 protein ABO_1803 OS=Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573) GN=ABO_1803 PE=3 SV=2

Match to Query 439: 1036.438248 from(519.226400,2+)Title: C:\Andrew Weston\TEMP\2_4048.pkl (query 130)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of EHIQSMDKFound in Q9I9D5, RX1_ASTFA Retinal homeobox protein Rx1 OS=Astyanax fasciatus GN=rx1 PE=2 SV=1

Match to Query 1250: 1232.715448 from(617.365000,2+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 86)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of EGSFAAASAKFound in P76369, YEEY_ECOLI Uncharacterized HTH-type transcriptional regulator yeeY OS=Escherichia coli (strain K12) GN=yeeY PE=4 SV=2

Match to Query 901: 1167.548648 from(584.781600,2+)Title: C:\Andrew Weston\TEMP\2_4055.pkl (query 222)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of EGSALPTTKGALFound in Q2P3K1, HIS7_XANOM Histidine biosynthesis bifunctional protein hisB OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=hisB PE=3 SV=1

Match to Query 2574: 1372.971048 from(687.492800,2+)Title: C:\Andrew Weston\TEMP\2_4058.pkl (query 103)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of EGHQMKFound in O93182, GAG_HV190 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag PE=3 SV=3

Match to Query 319: 1001.437848 from(501.726200,2+)Title: C:\Andrew Weston\TEMP\2_4040.pkl (query 252)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of EENNLYKIINNLEKFound in A8Z5Z5, SECA_SULMW Protein translocase subunit secA OS=Sulcia muelleri (strain GWSS) GN=secA PE=3 SV=1

Match to Query 3675: 2272.097172 from(758.373000,3+)Title: C:\Andrew Weston\TEMP\2_4035.pkl (query 234)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of EENNLYKIINNLEKFound in A8Z5Z5, SECA_SULMW Protein translocase subunit secA OS=Sulcia muelleri (strain GWSS) GN=secA PE=3 SV=1

Match to Query 3678: 2272.207272 from(758.409700,3+)Title: C:\Andrew Weston\TEMP\2_4032.pkl (query 151)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of EAAQFLAQASTKFound in Q93Q55, PROA_LISMO Gamma-glutamyl phosphate reductase OS=Listeria monocytogenes GN=proA PE=3 SV=1

Match to Query 2491: 1635.951448 from(818.983000,2+)Title: C:\Andrew Weston\TEMP\2_4054.pkl (query 497)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of CSAGSQKFound in Q8WZA9, IRGQ_HUMAN Immunity-related GTPase family Q protein OS=Homo sapiens GN=IRGQ PE=1 SV=1

Match to Query 501: 1046.562448 from(524.288500,2+)Title: C:\Andrew Weston\TEMP\2_4046.pkl (query 13)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of CDKLCLAGLEATLRFound in B8J1N0, SELA_DESDA L-seryl-tRNA(Sec) selenium transferase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=selA PE=3 SV=1

Match to Query 2951: 1832.958048 from(917.486300,2+)Title: C:\Andrew Weston\TEMP\2_4057.pkl (query 203)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of ATSNNVLMVSTEGGMEIEKFound in B3EN95, SUCC_CHLPB Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium phaeobacteroides (strain BS1) GN=sucC PE=3 SV=1

Match to Query 3819: 2272.073472 from(758.365100,3+)Title: C:\Andrew Weston\TEMP\2_4047.pkl (query 116)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of ASEAGIPVICYNTCINQKFound in P77269, YPHF_ECOLI ABC transporter periplasmic-binding protein yphF OS=Escherichia coli (strain K12) GN=yphF PE=1 SV=1

Match to Query 4059: 2548.943048 from(1275.478800,2+)Title: C:\Andrew Weston\TEMP\2_4030.pkl (query 97)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of ANLANMIEGVVNGYKFound in Q1GBK3, RL6_LACDA 50S ribosomal protein L6 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081) GN=rplF PE=3 SV=1

Match to Query 3079: 1920.968648 from(961.491600,2+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 154)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of ALVVFGCISKFound in P35608, NF1_CHICK Neurofibromin (Fragment) OS=Gallus gallus GN=NF1 PE=2 SV=1

Match to Query 1727: 1363.600848 from(682.807700,2+)Title: C:\Andrew Weston\TEMP\2_4057.pkl (query 110)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of AINQMAKFound in A7H2C7, PNP_CAMJD Polyribonucleotide nucleotidyltransferase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=pnp PE=3 SV=1

Match to Query 693: 1020.578048 from(511.296300,2+)Title: C:\Andrew Weston\TEMP\2_4063.pkl (query 109)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

MS/MS Fragmentation of AIFANPILQTSKFound in Q9Z7A5, UVRB_CHLPN UvrABC system protein B OS=Chlamydia pneumoniae GN=uvrB PE=3 SV=1

Match to Query 2377: 1574.917272 from(525.979700,3+)Title: C:\Andrew Weston\TEMP\2_4044.pkl (query 198)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf