Top Banner
Serine Proteases, A Basis of Immunity Through Evolution Master Thesis Project By Luke Morton Lars Hellman Lab
19

Serine Protease, A Basis of Immunity Through Evolution

Feb 17, 2017

Download

Documents

Luke Morton
Welcome message from author
This document is posted to help you gain knowledge. Please leave a comment to let me know what you think about it! Share it to your friends and learn new things together.
Transcript
Page 1: Serine Protease, A Basis of Immunity Through Evolution

Serine Proteases, A Basis of Immunity Through Evolution

Master Thesis ProjectBy Luke Morton

Lars Hellman Lab

Page 2: Serine Protease, A Basis of Immunity Through Evolution

Serine Proteases? Prolific Throughout Biological systems

Page 3: Serine Protease, A Basis of Immunity Through Evolution

Granulocytes

Page 4: Serine Protease, A Basis of Immunity Through Evolution

Granulocyte Proteases

Page 5: Serine Protease, A Basis of Immunity Through Evolution

Granulocyte Proteases

Page 6: Serine Protease, A Basis of Immunity Through Evolution

Protease Specificity By Family

The S1 Pocket of the protease conveys an aspect of the cleavage specificity, also dictating the P1 position nomenclature.

Page 7: Serine Protease, A Basis of Immunity Through Evolution

MrBayes MCMC (Markov Chain Monte Carlo) Bioinformatic association map based on sequence homology and surrounding genes, indicating likely protease specificities from various species.

Page 8: Serine Protease, A Basis of Immunity Through Evolution

Loci for Chicken Cathepsin G & Chinese Alligator Mast Cell

Protease-1

“[Serine Proteases] evolved in parallel with the immune cells in which they are now expressed; thus, […] variations open a window onto the origins and development of mammalian immune cells in their current state of complexity and specialization.” Caughey 2006

Page 9: Serine Protease, A Basis of Immunity Through Evolution

Quantification of Insert & Vector

Page 10: Serine Protease, A Basis of Immunity Through Evolution

Transfection into HEK 293

Major changes from previous pCEP4 vector:

• Introduction of puromycin resistance versus the previous hygromycin.

• Signal sequence from human BM40

• EcoRI sites upstream of the ampicilin resistance gene moved after extension of a polylinker to also include a NotI site

EBNA-1: Ebstein-Barr virus nuclear antigen 1, responsible for keeping cell in an altered state utilizing viral proteins to take advantage of cellular machinery (SV40).Col E1: Copy number regulation system designed to reduce plasmid expression collapse. P CMV: Cytomeglovirus promoterOri P: origin of replication.

Page 11: Serine Protease, A Basis of Immunity Through Evolution

Expression & Harvesting

•Once the vector has been selected for in the HEK 293 cells, they are grown and expanded, producing variable quantities of protein into the media, which is then collected and purified using Ni-NTA beads.

•SDS-PAGE shows the qualitative concentrations of the elutions done with imidazole.

Page 12: Serine Protease, A Basis of Immunity Through Evolution

Quantification of ProteaseChicken CTSG High ElutionDilution Factor X-values (OD) Y-Values (eq) Y-valuesxDF Avg Conc.5x 0,04 0,1095 0,54752x 0,092 0,2703 0,5406 0,5ug/ul1x 0,153 0,5459 0,5459

Low Elution5x 0,019 0,0534 0,2672x 0,046 0,1261 0,2522 0,2ug/ul1x 0,07 0,1968 0,1968

Alligator MCP-15x 0,025 0,0699 0,34952x 0,06 0,1663 0,3326 0,3ug/ul1x 0,072 0,203 0,203

Comparative quantification of the protease concentration is done through:

• Bradford Standard Assay

• Bovine Serum Albumin Dilution Assay

(eq) y=50.724x3-1.8662x2+2.6431x+0.0035

Page 13: Serine Protease, A Basis of Immunity Through Evolution

Activation of CTSG & MCP-1

EFHHHHHDDDDKIVGGRRARPHAWPFMVSLQLRGGHFCGSTLIAPNFVMSAAHCCVANVNVRAVRVVLGAHNLSRREPTRQV…

•Imitates zymogen cleavage of proteases in natural system.

•Found also in compliment activation, fibrinogen and kinin systems.

•Removes small protein flap from active site , allowing interaction.

Page 14: Serine Protease, A Basis of Immunity Through Evolution

Recombinant substrate assays

V2:VVRRAAAGV3:VVRRRAAG

HC: VVLFSEVLOC: VGLWLDRVHCV6: VVLLSEVL

CF1: RVTGMSLV

Page 15: Serine Protease, A Basis of Immunity Through Evolution

Chromogenic Substrate Assay• Results most likely from Enterokinase•Prefix (Suc, Boc, Z, Ac) to make substrate soluble in H2O•Suffix (pNA-paranitroaniline)

Page 16: Serine Protease, A Basis of Immunity Through Evolution

Phage Display

Chicken CTSG Chinese Alligator MCP-1

Page 17: Serine Protease, A Basis of Immunity Through Evolution

Phage Display Results

1 2 3 4 50.00

5.00

10.00

15.00

20.00

25.00

30.00

CTSG & MCP-1 vs. PBS 29/3/16

CTSGMCP-1PBS

Day

Ratio

vs.

PBS

1 2 3 4 50.001.002.003.004.005.006.007.008.009.00

10.00

CTSG & MCP-1 vs. PBS 18/4/16

CTSGMCP-1PBS

Day

Ratio

vs.

PBS

1 2 3 4 5 60.002.004.006.008.00

10.0012.0014.0016.00

CTSG & MCP-1 vs. PBS 02/05/16

CTSGMCP-1PBS

Day

Ratio

vs.

PBS

•Chicken CTSG & Alligator MCP-1 PFU ratios versus PBS. •PFU was calculated as an average from usually 2-3 different dilution sets for each day.•See a selection arc but towards the end of the week it crashes, otherwise it would continue.

Page 18: Serine Protease, A Basis of Immunity Through Evolution

Conclusions• Chicken CTSG & alligator MCP-1 have a extremely specific

cleavage specificity that is possibly addressed further up or downstream from the P5-P5’ site or with multiple interaction sites with its substrates.

• Many proteases interact with proteoglycans in and outside of granules and on the cell membrane, without these specific configurations or charge alignments there could be reduced affinity to primary targets.

• Augmenting phage display library (or trying different recombinant/chromogenic substrates) for better substrate representation, or attempt to have a protease/substrate/membrane interaction etc.

• Future…

Page 19: Serine Protease, A Basis of Immunity Through Evolution

Acknowledgements

• A big thanks to…Lars Hellman

Srinivas Akula

Zhirong Fu

Gurdeep Chahal

Payal Banerjee

The A8:2 Corridor!