Feb 2017 Role of the pearl millet Aquaporin genes in abiotic stress tolerance Reddy PS*, Divya K, Sivasakthi K, Tharanya M, Lale A, Bhatnagar-Mathur P, Kholova J, Sharma KK, Vadez V *E-mail: [email protected] Introduction • Pearl millet (Pennisetum glaucum L.) is an important cereal crop of semi-arid tropics, which is grown across India and Sub-Saharan Africa. It is well adapted to grow in regions of very low rainfall and it can withstand long periods of drought. • Aquaporins are members of Major Intrinsic Proteins (MIP) family known to be present in the cell membranes and are involved in the conductance of water. • Aquaporin proteins are of special interest for water deficit adaptaons as changes in AQPs have been linked to improved abioc stress response. Objective Harnessing the role of Aquaporins in water conservaon and abioc stress tolerance improvement in Pearl Millet. Results 1. Seven PgAQP genes were cloned using homology based gene cloning approach and evoluonarily closer to maize than rice. 0 2 4 6 8 10 12 14 Leaf Root Leaf Root Leaf Root Leaf Root ICMR 1122 ICMR 1086 ICMR 1152 ICMR 1078 Relative expression Genotypes PIP1.1 PIP1.2 PIP2.1 PIP2.3 PIP2.6 TIP1.1 TIP2.2 Figure 2. Transpiraon rate (Tr) response to increasing VPD in High Resoluon Cross (HRC) genotypes. Figure 3. Relave expression of PgAQP genes under high VPD condions using qPCR. 3. PgPIP2;6 transgenic tobacco plants were generated and funconal characterizaon was done in homozygous T2 generaon plants. LB 35s pro npt Poly A 35s pro PgPIP2;6 NosT RB b. Steps involved in tobacco transformaon c. PCR confirmaon of putave transgenic tobacco plants Figure 4. Genec transformaon of tobacco with 35s-PgPIP2;6-NosT construct using the Leaf disc method. Conclusion PgPIP2;6 can be deployed to engineer stress tolerant transgenic crops for sustained growth and producvity under unfavorable condions. Acknowledgements Science and Engineering Research Board (SERB), DST, Govt. of India for the research grant through Young Scienst Scheme SB/YS/LS-12/2013. This work has been undertaken as part of the CGIAR Research Program on Dryland Cereals. 2. Pearl millet genotypes showing contrasng transpiraon response to high vapour pressure deficit (VPD) were idenfied. PgAQPs exhibited increased expression in VPD-insensive genotypes under low and high VPD condions. 4. PgPIP2;6 transgenic plants showed a beer performance under drought stress and salinity compared to wild type plants. e. Transpiraon reducon of heat stressed transgenic and wild type plants in the presence of aquaporin inhibitor AgCl 2 . f. Relave water content measurement of drought stressed plants transgenic treated with aquaporin inhibitor AgCl 2 . a. Visual difference in wild type and transgenic leaf discs aſter 7 days of 300 mM salt stress. b. Depicng leaf disc assay under salt stress. c. The relave total chlorophyll levels of salt stressed leaf discs from transgenic as well as wild type plants. d. Lipid peroxidaon levels in salt stressed plants. Figure 1. Cloning and sequence analysis of pearl millet AQP genes. Cloning ARGAGGTSGA Y G TCCSGAARGART Degenerate primers from related species Phylogenec analysis Motif 1 Motif 2 Motif 3 PgPIP1;1 1 MEGKEEDVRLGANKYSERQPIGTAAQGGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYITILTVMG--------VSKSNTKCATVGIQGIA 93 PgPIP1;2 1 MEGKEEDVRLGANKYSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYISILTVMG--------VSKSQSKCATVGIQGIA 93 PgPIP2;1 1 MGKDDVIES-----------GAGGGEFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVLTVIGYKHQTDPTASGADAACGGVGILGIA 89 PgPIP2;6 1 MGKEVDVSA-----------LEAGG---VRDYADPPPAPLVDIDELGKWSLYRAVIAEFVATMLFLYITVATVIGYKHQTDASASGPDAACGGVGILGIA 86 PgTIP1;1 1 MAAAGIRLCRSESIAVGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFS------KLSPGG-SSPAGLISAA 69 PgTIP2;2 1 MSGNIAFGRFGDSFSAASLRAYVAEFISSLVFVFAGVGSAIAYR------KLSDGAPLDATGLVAVA 61 . .* ***... .*.. . . *. * Motif 4 Motif 5 PgPIP1;1 94 WSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANTVASGYTKGSGLGAEIIGTFVLVYTV 194 PgPIP1;2 94 WSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQEGLYMGNGGGANMVASGYTKGDGLGAEIVGTFVLVYTV 194 PgPIP2;1 90 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTV 190 PgPIP2;6 87 WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQCLGAICGVALVKGFQSGFYARYGGGANEVSAGYSTGTGLAAEIVGTFVLVYTV 187 PgTIP1;1 70 IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYWIAQLLGSTVACFLLRFSTGGLPTGTFG-----LTGISVWEALVLEIVMTFGLVYTV 165 PgTIP2;2 62 VCHGFALFVAVAIGANISGGHVNPAVTFGLVLGGQITMLTGLFYWIAQLVGAIVGAVLVQFSTG-VATPTHG-----LSGIGTLEGVVMEIIVTFGLVYIV 156 . .* * *.*****.******* . ... . * * .*. ... * .* . **. ** *** * H2 Motif 6 Motif 5 PgPIP1;1 195 FSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRDHAWSDHWIFWVGPFIGAALAAIYHQVIIRA------LPFKSRD 288 PgPIP1;2 195 FSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRSQAWDDHWIFWVGPFIGAALAAIYHQVIISA------IPFKSRS 288 PgPIP2;1 191 FSATDPKRNARDSHVPALAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSNA 290 PgPIP2;6 188 FSATDPKRNARDSHIPVLAPLPIGFAVFMVHLPTIPITGTGINPARSLGAAVVYNNSKAWSDQWIFWVGPFIGAAIAALYHQIVLRA-SARGYGSFRSNA 286 PgTIP1;1 166 YATAVD---PKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVS---WSWGYQWVYWVGPLIGGGLAGIIYEVLFIS---HTHEQLPSTDY 257 PgTIP2;2 157 YATAAD---PKKGSLGTIAPIAIGFIVGANILVAGPFSGGSMNPARSFGPAVAS---GDFTNIWIYWVGPLVGGGLAGIVYRYIYMC---GDHAPVASSEF 248 .... . . .**. *** * * * .*** * * *. *..**** .* .* . . * H5 LE1 LE2/P2 P3 P4P5 Sequence analysis for PgAQPs Figure 5. Funconal characterizaon of PgPIP2;6 transgenic tobacco plants under salt, drought and heat stress treatments. a. pMDC100 comprises PgPIP2;6 cassee About ICRISAT: www.icrisat.org ICRISAT’s scienfic informaon: hp://EXPLOREit.icrisat.org