Top Banner
Cover Details Page 3 Thursday 28 February 2013 76 PAGES OF PROPERTY | OPEN HOUSE LIFTOUT PAGES 37- 40 Illawarra
76

realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Mar 06, 2016

Download

Documents

realestateworld.com.au consists of a real estate portal supported by several leading print publications of the same name available across metropolitan and regional centres in NSW. realestateworld.com.au and its services are wholly owned and developed by the Estate Agents Co-operative Ltd.
Welcome message from author
This document is posted to help you gain knowledge. Please leave a comment to let me know what you think about it! Share it to your friends and learn new things together.
Transcript
Page 1: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Cover Details Page 3

Thursday 28 February 2013

76 PAGES OF PROPERTY | OPEN HOUSE LIFTOUT PAGES 37- 40

Illawarra

Page 2: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

BUNYA STREET

BONG BONG ROAD

MORSON AVENUE

BR

OO

KS

REA

CH

RO

AD

Page 3: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

28 February 2013 3

FOR SALE

WHERE

CONTACT

WEB

INSPECT

AGENT

Price guide above $2 million

Units 3 & 4, 3 Wollongong Street, Shellharbour

Martin Merritt 0412 424 226 [e] [email protected]

shellharbour.bevans.com.au

Exclusive viewing by Appointment only

Bevans Shellharbour - 4296 5111

Harbourside ExtravaganceFront Cover Feature Property

Indulge in a new standard of luxury living. Gracing the upper two levels of this newly completed boutique development are your choice of two, three bedroom penthouse apartments representing harbour side living at its most exclusive. With a fusion of world class design elements, aspire to the grand lifestyle on offer. Emphasising gracious living in its finest form, enormous wrap around alfresco dining sprawling across one whole level, all crowned by a sunlit rooftop entertainers terrace. Pure opulence designed to take full advantage of uninterrupted panoramic water views across Shellharbour beaches and along the Southern Illawarra Coastline. Live the highlife enjoying a superb combination of luxury and elegance in equal measure with breathtaking never to be built out views and state of the art finishes all in a relaxed resort like property. This special offering is sure to impress buyers looking for the best in waterfront living, an enviable lifestyle in a premier coastal locale with the convenience of the harbour, beaches, boat ramps, cafes, shopping village and fine dining at your doorstep.

Wendy Lepre 0431 322 192[e] [email protected] walker street4294 [email protected]

bevans

AUCTION: Sunday 24th March at 2pm on siteWHERE: 24a Station Street, Stanwell ParkINSPECT: Sun. 2nd 1 - 1.30pm & Wed. 6th 5.30pm - 6pm

bed 5 | bath 2 | car 4 | land size 585m2

Watergum Grove - Two Homes in OneFor the first time Stanwell Park’s Watergum Grove is now being offered for sale. One of the most successful bed and breakfast in the park, a business and lifestyle change is just the thing for the overworked corporate couple.Maybe you have a large family you need to accommodate, or a place for the inlaws, either way this home has so much opportunity. Just lock the internal door and you have two fully self-contained residences.This expansive property is located in such an enviable position. Backing onto parkland and a short stroll to the beach, fall asleep to the soothing sounds of the ocean as it lulls you to sleep.

Page 4: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

4 28 February 2013

Relax on a warm summers afternoon and enjoy a chilled glass of wine with a gentle cool ocean breeze. Call up your family and friends with the view to entertain and dine under the stars on the large wrap around deck, all admiring the Pacific ocean with the horizon in the distance. This renovated three bedroom house is only a 15 minute stroll to Coledale shops and cafes with beautiful beaches just down the road. And a short drive down to Thirroul Village with your art galleries, boutiques, restaurants and parks. So whether you are looking for a fabulous place to holiday or wish to live life like you are on holiday make sure you inspect this home. Positioned in the midst of landscaped gardens, surrounded by luscious greenery, this home promises the best of cosmopolitan luxury in seaside surrounds. Oh & wait until you see the view from the main bathroom!

John O’Reilly 0401 675 077[e] [email protected] bevansthirroul10/345 lawrence hargrave drive4267 3444 [email protected]

bevans

AUCTION: Saturday 23rd March at 1.30pm on siteWHERE: 476 Lawrence Hargrave Drive, WombarraINSPECT: This Saturday 11.30am - 12pm

bed 3 | bath 2 | car 1 | land size 546m2

To Live a Holiday

Come and see what its like living on the 14th Floor of the Creston. The views are simply breathtaking. Let waves of natural light wash over you as you gaze lazily out from the escarpment to the ocean horizon. Rarely does an opportunity like this become available to sit at the top of our beautiful city. This stylishly renovated executive style unit has to be seen to be believed. There is more to life than mowing lawns!

Daniel Field 0404 003 882 [e] [email protected]/345 lawrence hargrave drive4267 3444 [email protected]

bevans

AUCTION: Saturday 23rd March at 11.30am on siteWHERE: 79/22-26 Corrimal Street, WollongongINSPECT: This Saturday 11am - 11.30am

bed 2 | bath 1 | car 2 | residence size 68m2

Carefree Living

Page 5: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

28 February 2013 5

A quirky cottage in a prime, convenient location with an escarpment view and a beautiful established garden...all in Austinmer. Play in the park across the road, stroll only a little further and take in the area’s best beaches, Austinmer one way Thirroul the other! The popular local school is just over the hill and the village with eateries, fashion outlets, and transport also conveniently close. Enjoy the peace and quiet from your back garden or the community feel the area has to offer. Friends will definitely be in awe!

Justin Sydenham 0417 330 229[e] [email protected] bevansthirroul10/345 lawrence hargrave drive4267 3444 [email protected]

bevans

AUCTION: Saturday 16th March at 12.30pm on siteWHERE: 44 Kirton Road, AustinmerINSPECT: This Saturday 11.45am - 12.15pm

bed 3 | bath 1 | car 2 | land size 519m2

Austinmer Without the Price Tag

Nearly all coastal country towns had corner stores. Thirroul had many. But one shop, up on School Hill, was always more important than others, at least to the hordes of local kids who passed its doors each day. Sometimes a particular building can hold a special place in the life of a community - somewhere to meet, somewhere to play, somewhere to take a pause from the workaday world. And even when a building is no longer used for the same function it was originally intended, it always remains encased in memories. Though the front step might be ever slightly worn down with the tread of generations of residents and customers, such structures provide a familiar touchstone in times of change. One such local touchstone is the cute former general store on the south-western corner of Phillip Street and Virginia Terrace.

Kane Downie 0409 969 032 [e] [email protected]/345 lawrence hargrave drive4267 3444 [email protected]

bevans

AUCTION: Saturday 16th March at 11.30am on siteWHERE: 124 Phillip Street, ThirroulINSPECT: This Saturday 10.15am - 10.45am

bed 4 | bath 1 | car 2 | land size 955m2

The Old Corner Store

Page 6: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

6 28 February 2013

Proudly nestled off Fords Road, this tranquil block of land with its most generous proportions (600sqm) and private location has been well prepared for the most astute buyer. With all services connected and stunning architecturally designed four bedroom home plans approved to be built, an opportunity to realise your dream starts hereThe split level home, modern in appeal is also designed with the landscape in mind. Sitting across the block, the home maximizes the views of the ocean and invites a lifestyle envious of many. Low maintenance opportunities are highlighted by landscaping possibilities around the home, and with just enough lawn to chip a ball with your favourite 5 iron, you wont be forever mowing. Minutes drive to the water, moments from the cosmopolitan life of the village and yet tranquil enough to be serenaded by Kookaburra’s this fantastic opportunity presents rarely. Come along and secure your private piece of paradise.

Justin Sydenham 0417 330 229 [e] [email protected] bevansthirroul10/345 lawrence hargrave drive4267 3444 [email protected]

bevans

FOR SALE: Offers over $360,000WHERE: 35a Fords Road, ThirroulINSPECT: By Appointment

land for sale | land size 600m2

Best of Both Worlds

An awesome, unique and affordable development opportunity right in the very heart of Thirroul, where commercial and residential demand is high and new alternatives are non existent! The DA approval allows for demolition of the existing warehouse and construction of a mixed use development which includes a commercial ground floor café, first floor office space, and two residential apartments. A contemporary design, the 106m2 restaurant allows for full kitchen facilities, bathrooms, parking and opens up out to Railway Parade opposite the train station. We’ve already had some interest in the 174m2 of open office space on the first floor. Oversized glass doors open up to two external deck areas. There is exposure in this busy location for signage. Only two exclusive well designed apartments sit above it all on the second floor, with access via a lift. The demand for these single level apartments will be high. An ideal time to invest in the Northern Suburbs where all the planning & waiting for council has been done! Agents Interest.

Justin Sydenham 0417 330 229 [e] [email protected]/345 lawrence hargrave drive4267 3444 [email protected]

bevans

FOR SALE: $650,000 - $700,000WHERE: 6 Railway Street, ThirroulINSPECT: By Appointment

development for sale | land size 582m2

A Little Bit of Bondi in Thirroul

artists impression

location shot

artists impression

artists impression

Page 7: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

28 February 2013 7

bevansthirroul10/345 lawrence hargrave drive4267 3444 [email protected]

bevans

Woonona Offers above $650,000 6 Asquith Street, Inspect by Appointment

• Polished blue gum floors feature throughout this home with a cool summer breeze• One level and the home is elevated into the trees. Underneath is an artist studio of 70m2 • The double front doors open onto a deck among the trees, walking through this beautiful space; you are met with a serene feeling• The open nature of the living area flanked by windows, lets light in gently and evenlyContact: Kane Downie 0409 969 032 [e] [email protected]

bed 3 | bath 2 | car 2 | land size 575m2

25m

25m

41m

LAW

RE

NC

E H

AR

GR

AVE

DR

48m

1144m2(approx)

bevansthirroul10/345 lawrence hargrave drive4267 3444 [email protected]

bevans

Thirroul Auction This Saturday at 11am on site393 & 395 Lawrence Hargrave Drive, Open Saturday 10.30am - 11am

• Zoned R3 and ready for development, and enjoy an income of $450 per week• Opportunities like this do not come along often, nor are there many areas zoned R3 ready• There is a high demand for units in Thirroul, you build and they will sell• Close to train, shops, restaurants and shoppingContact: John O’Reilly 0401 675 077 & Justin Sydenham 0417 330 229

bed 3 | bath 1 | car 1 | land size 1144m2

bevansthirroul10/345 lawrence hargrave drive4267 3444 [email protected]

bevans

Corrimal Offers above $530,00015/3 Mountbatten Street, Open Saturday 1pm - 1.30pm

• Step inside and the warm, homely feel is immediate, with a roomy living area inviting you in• Three generous bedrooms all with ceiling fans and built ins with plenty of storage• The kitchen has more than enough room to downsize into, with stainless appliances and gas cooking to assist with the family feasts • Enjoy an afternoon beverage on the massive undercover back deck or enjoy the laughter of the grandkids playing on the magnificent lawnContact: John O’Reilly 0401 675 077 [e] [email protected]

bed 3 | bath 1 | car 2

bevansthirroul10/345 lawrence hargrave drive4267 3444 [email protected]

bevans

Woonona $590,000 - $620,00017 Mahogony Way, Inspect by Appointment

• This fabulous three bedroom home has the feel and characteristics of an ultra-modern 5 star villa• Keep cool or thaw out with the reverse cycle ducted air conditioning• Gorgeous tiles are in place for the high traffic areas and carpet where you would expect it to be• Entertain your guests inside or out, if the clouds appear then enjoy the electric retractable awning• The double garage features floor to ceiling 5 metre in length cupboards• A north facing and very private sunroom captures views of the escarpmentContact: John O’Reilly 0401 675 077 [e] [email protected]

bed 3 | bath 2 | car 2 | land size 393m2

Page 8: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

8 28 February 2013

bevanscorrimal1/183 princes highway42 442 [email protected]

bevans

Woonona Auction Saturday 23rd 2013 at 2 pm on site8 Beach Drive, Open Sunday 3rd March 1pm – 1:30pm

• You will never tire of the unique sunrises, watching the waves roll in or being able to feel the sand beneath your feet• Exquisite features inside and lovely low maintenance lawns and gardens outside • Spacious & modern this is unquestionably a perfect choice for beachfront living and entertaining• Easy access to shops, schools, transport and an amazing outdoor lifestyle • Currently used as a profitable holiday letting creating a fantastic investment opportunityContact: Troy Gibson 0433 433 168 [e] [email protected]

bed 4 | bath 2 | car 4

bevanscorrimal1/183 princes highway42 442 [email protected]

bevans

Bellambi Offers above $349,0006/215-217 Rothery Street, Open Saturday 12pm - 12.30pm

• Offering a relaxed lifestyle this attractive townhouse is in an appealing complex of only seven• Immediately welcomed by it stylish, modern appearance and spacious interiors • Presenting fantastic value this home is an exceptional start for first home buyers or investors • Conveniently located close to schools, transport and an easy stroll to the local bowling club• Fantastic courtyard provides the perfect area to entertain or relax and enjoy the afternoon sunContact: Phil Murray 0411 854 785 [e] [email protected]

bed 2 | bath 2 | car 2

bevanscorrimal1/183 princes highway42 442 [email protected]

bevans

East Corrimal Auction This Saturday at 3:30pm on site2 Thalassa Avenue, Open Saturday 3pm - 3.30pm

• Allow yourself to be captivated by the amazing lifestyle this character filled home presents • You will enjoy the expansive space this incredible home offers with its comfortable indoor and outdoor living• Plenty of natural light fills this home emanating and incredible feeling throughout • With a fully self-contained flat this property is an ideal opportunity to live in and invest• On a popular street in a prime location, moments to transport, schools, shops and beach Contact: Martin Merritt 0412 424 226 [e] [email protected]

bed 6 | bath 3 | car 1

bevanscorrimal1/183 princes highway42 442 [email protected]

bevans

Bellambi Offers above $299,0001/26 Owen Park Road, Open Saturday 11am - 11.30am

• Charming villa greets you with its well manicured gardens making a fantastic first impression• With enticing value this home represents a lifestyle of simplicity and convenience • An ideal investment opportunity, perfect beginning for first home buyers or downsizing • Study is an excellent space to utilise as a home office or convert into a third bedroom• Embrace the afternoon sun from the sunroom which opens out the patio which wraps around the back of the villaContact: Sam Vescio 0402 083 446 [e] [email protected]

bed 2 | bath 1 | car 1

Page 9: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

28 February 2013 9

bevansbevanscorrimal 1/183 princes highway

[t] 42 442 442[e] [email protected]

bevans

bevanswollongong94 market street4226 6222 [email protected]

Albion Park Rail Offers Above $309,00050 Maple Street, Open Saturday 12.30pm - 1pm

• Turn the key and move right into this convenient level three bedroom home• Great potential to grow with the family• Minutes to Stockland Shellharbour, local shops, transport, schools and local sporting facilities• Features three good size bedrooms all with built in wardrobes• Huge double car garage and carport for the boat and van • Cypress pine floorboards and tile floor coverings throughoutContact: Dragan Balaban 0488 443 910 & James Ianni 0411 587 003

bed 3 | bath 1 | car 4

bevanswollongong94 market street4226 6222 [email protected]

bevans

Bulli Auction Saturday 9th March at 11.30am on site41 Hospital Road, Open Saturday 10.45am - 11.30am

• Wake up to the sounds of crimson rosellas and laughing kookaburras• Sunlit northerly aspect with amazing ocean and picturesque escarpment views• Solid three bedroom family home, ideal kitchen space and light filled living rooms• Perfect entry level property to enter this premiere suburb• Put your own touch and feel into the home and expand your views and space• Positioned on the high side of the street and backs onto a luscious public reserveContact: James Ianni 0411 587 003 & Dragan Balaban 0488 443 910

bed 3 | bath 1 | price guide $400,000+

Russell Vale Offers above $529,00078 Collaery Road, Open Saturday 11am - 11.30am

• A prospective future is evident if you open your mind to all the possibilities this home has to offer• A number of development opportunities exist subject to council approval• A revamp to the backyard would be an excellent blank canvas for those that love landscaping • Living room provides a built-in split system air conditioner and a near new gas fire place• Sunroom has private access from the front veranda, good option for home business

Contact: Phil Murray 0411 854 785 [e] [email protected]

bed 3 | bath 2 | car 1

Thirroul Offers above $549,0007/13 Henley Road, Inspect by Appointment

• Whether you are starting up or slowing down, you will be impressed with this modern and spacious villa• Located at the rear of a very well maintained and pet friendly block, peace and privacy is assured• Large neat kitchen with plenty of cupboard space and breakfast bar• Sunny open plan living and dining area, leading out to the al fresco courtyard• The bustling atmosphere of Thirroul’s shops and restaurants are only a short walk from your front door

Contact: Jaine Connery 0410 426 320 [e] [email protected]

bed 3 | bath 1 | car 1

Tarrawanna Offers above $275,0002/79 Meadow Street, Open Saturday 1pm - 1.30pm

• With north east facing living areas this townhouse boasts outstanding value • In a quiet complex of only four conveniently located in the heart of Tarrawanna Village• Perfect opportunity for the astute investor or first home buyer seeking quality property at an affordable price• Enjoy village life with a cafe, butcher, fruit market, post office, school and transport all at your door• Peaceful garden steps down from the living areas and provides a lovely green sunny outlookContact: Chris Ljungdahl 0488 877 355 [e] [email protected]

bed 2 | bath 1 | car 1

Page 10: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

10 28 February 2013

A Contemporary MasterpieceOnce in a while a truly incredible property is presented to the market for sale. This is the time. Offering the convenience of East-side Woonona living, this stunning designed property is a metaphor for the modern lifestyle, sleek and edgy with the juxtaposition of a relaxed holiday feel. You will be inspired from the moment you step through the front gate, the Balinese theme symbolising your new found lifestyle. Step inside and look up in awe, high raked ceiling up to 6m create a sophisticated ambience and beckon you to hang your most precious art pieces. Step down just a few stairs and enter the dining area, massive picture windows take in the vista of the lap pool outside. From the hallway is a wonderful media room, just waiting for friends over for popcorn and movies. A kitchen lover’s kitchen is finished with slick stone benches, an amazing amount of cupboard space and a unique landscape picture window as your splash back. An absolutely gorgeous master suite is of incredible proportions complete with large walk-in robe, stunning en-suite with double rainfall shower heads and views over the pool. Host your winning ‘My Kitchen Rules’ restaurant in the very clever undercover poolside entertaining space. The beautiful heated 12m lap pool with outside hot and cold shower will have you re-discovering that lost fitness from yesteryear. Wonderfully positioned to the convenience of the shops, beach, transport and school, this is one of the most stunning contemporary designed properties will soon be yours to indulge, an inspection is a must.

bed 4 | bath 2 | car 1

AUCTION: Saturday 23rd March at 12.30pm on siteWHERE: 23 Railway Parade, WoononaINSPECT: This Saturday 12pm - 12.30pm

CONTACT: Andrew Hedley 0410 551 554 [e] [email protected]

bevanswollongong94 market street4226 [email protected]

Page 11: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

28 February 2013 11

Situated close to the gorgeous little village of Keiraville, this attractive renovated single level home has been completely rejuvenated with love and lots of hard work. Wake up on a Sunday and enjoy a stroll down to the local store to grab the papers, coffee and supplies for a relaxing picnic at the nearby Botanical Gardens. The home features, a new kitchen with polyurethane cupboards, stainless steel built in oven, microwave & dishwasher, garbage disposal unit and stylish stone bench tops. Wooden flooring flows through all the living and high traffic areas with neutral toned carpets for added comfort in the bedrooms. A wonderful paved outdoor entertainment area, boasts undercover pergola, gas outlet for your BBQ and a relaxing 6 person spa bath to ease away the working week. The large backyard is perfect for kids and pets to run free or potter in the veggie garden with the chooks. Plenty of land at rear of home to accommodate a second dwelling (STCA). Within close proximity UOW, Wollongong CBD, botanical gardens and great schools.

Tracey Pascoe 0499 499 990Lisa Brooke 0423 901 094bevanswollongong94 market street4226 6222 [email protected]

bevans

AUCTION: Saturday 9th March at 12.30pm on siteWHERE: 12 Bell Street, KeiravilleINSPECT: This Saturday 12pm - 12.30pm

bed 3 | bath 1 | car 2

Rejuvenated with Love and Hard Work

Andrew Hedley 0410 551 554[e] [email protected] bevanswollongong94 market street4226 6222 [email protected]

bevans

AUCTION: Saturday 23rd March at 2.30pm on siteWHERE: 59 George Avenue, BulliINSPECT: This Saturday 2pm - 2.30pm

bed 3 | bath 1 | car 1

Bulli s Friendliest StreetPerched in an elevated position on a fabulous corner block, this north facing classic family home is sure to set the hearts racing. With bush walking and mountain biking trails on your door step and the beach just a few minutes away, you will love your new found life style. First impressions are of a classic 70s brick home, with space at the front and back yards to perfect your ‘Sir Walter’. Step inside and appreciate a wonderful layout with two large living spaces providing a range of entertaining options. A lovely renovated kitchen with stone benches, gas cooking and plenty of cupboard space is the perfect place to whip up one of Jamie’s 30 minute meals. Off the lounge is a huge undercover deck, a lovely place to relax on summer evenings. Downstairs are three good sized bedrooms, all with built-in robes. For those commuting to Sydney, you will love how quickly you will be onto Bulli Pass. Whether you are a first home purchaser or moving to the area, this has to be one of the most affordable on the market today.

Page 12: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

12 28 February 2013

bevansshellharbourbevans

123 shellharbour road[t] 4296 5111[e] [email protected]

bevansshellharbour123 shellharbour road4296 5111 [email protected]

bevans

Shell Cove Offers above $689,0005 Edgecombe Court, Open Saturday 11.30am – 12pm

• Fabulously positioned in a quiet cul-de-sac within minutes drive to pristine beaches• Immaculately kept with expansive interiors and spotted gum timber flooring • Large gourmet kitchen with state-of-the-art, smeg stainless steel appliances• Expansive master suite offers walk-in robe and large ensuite with dual basin• Perfectly proportioned with each bedroom including mirrored built-in robes • Entertain in the undercover balcony area flowing off the kitchen and dining roomContact: Alastair Reid 0434 767 553 [e] [email protected]

bed 5 | bath 2.5 | car 2

bevans

Blackbutt From $399,0001-24/1001 Albatross Drive, Open Saturday 10am – 11am

• A stunning selection of three bedroom villas and townhouses available• Expansive living spaces throughout with a focus on outdoor entertainment• Free stamp duty for first home buyers plus the $15,000 new home grant scheme• Other government grants available with the $5,000 new home grant• Plans and information packs are available on request• Conveniently located just minutes away from all the offerings of Shellharbour CBDContact: Martin Merritt 4296 5111 [e] [email protected]

bed 3 | bath 2 | car 2

bevansshellharbour123 shellharbour road4296 5111 [email protected]

artist impression

Barrack Point Offers above $1,250,0008 Shell Cove Road, Open Saturday 11.30am- 12pm

• Uninterrupted water views are best enjoyed from this premium waterfront position• A statement in exclusivity and seaside opulence perfectly set the scene for a holiday-like lifestyle• Impeccably presented embracing sensational panoramic views of the Southern Illawarrra coastline• Spacious free flowing interiors, five bedrooms, additional study, contemporary kitchen and three car garage • A substantial sundrenched 904sqm parcel of land, unparalleled lifestyle of sun, sea and surf

Contact: Martin Merritt 4296 5111 [e] [email protected]

bed 5 | bath 1 | car 3

Albion Park Rail Offers above $799,000135 Koona Street Open Saturday 12.30pm – 1pm

• Immerse yourself in the secluded sanctuary that is this amazing family home• Set on a 2483 m2 parcel of land and offering an unsurpassed lifestyle of peace and tranquillity • Backing onto your own private jetty where you can do a spot of fishing or take your kayak out for a paddle• Enjoy your BBQ’s in the large private courtyard or on your entertaining deck overlooking the back yard• Separate dwelling including kitchen, bathroom, bedroom with plenty of room for the extended family

Contact: Alastair Reid 0434 767 552 [e] [email protected]

bed 4 | bath 3 | car 5

Shell Cove Offers above $629,00012 Bribie Avenue, Open Saturday 12.30pm – 1pm

• Contemporary family home offers freshly painted interiors and low maintenance exteriors • The gourmet kitchen offers breakfast bar style seating with an island bench and quality fittings• Four bedrooms with built-in robes and the master room offering ensuite and walk-in robe• Remote double garage with drive through access for a small boat or third car• Family living and dining spaces open to the outdoors by large sliding glass doors

Contact: Martin Merritt 4296 5111 [e] [email protected]

bed 4 | bath 2 | car 2

Blackbutt Offers above $369,0002/40 College Avenue, Open Saturday 11.30am – 12pm

• Immersed in natural light this townhouse offers expansive interiors spread across two levels• Three spacious bedrooms with built-in robes and the master room including ensuite• Fantastic outdoor entertainment area as well as nice sized yard for the kids swing set • The living room offers gas facilities and a fantastic outlook of the Shellharbour coastline • Conveniently positioned a short stroll from major shopping centres, schools and transport

Contact: Alastair Reid 0434 767 552 [e] [email protected]

bed 3 | bath 2 | car 1

Page 13: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

28 February 2013 13

bevansdapto25 princes highway4261 [email protected]

bevans

Dapto Offers above $349,000245 Kanahooka Road, Open Saturday 10.30am - 11am

• Large 708m2 block of land• Garage has a separate room at the rear for storing all your tools • Floating floors through the hall, kitchen and dining areas • Potential rental return of $360pw to $380pw• Generous size living areaContact: Simon Halcrow 0402 371 001 [e] [email protected]

bed 3 | bath 1 | car 1

bevansdapto25 princes highway4261 [email protected]

bevans

Horsley Offers above $345,00028 Highland Park Drive, Open Saturday 11am - 11.30am

• This delightful single level home provides all the ingredients for comfortable family living• Exceptional opportunity for first home buyers or investors• The home is tucked away in a quiet enclave promoting a relaxed and low maintenance lifestyle• Impressive and spacious living area with air conditioning, flows through to dining • Three good sized bedrooms all with mirrored robes and ceiling fans• Large covered outdoor entertaining area, ideally located in a family friendly neighbourhoodContact: Rebecca Coe 0413 148 509 [e] [email protected]

bed 3 | bath 1 | car 1

bevansdapto25 princes highway4261 [email protected]

bevans

Horsley Offers above $990,00077 Shone Avenue, Open Saturday 12pm - 12.30pm

• Grand home set on a tranquil 5.45 acres with approx 7140sqm of vacant land• Zoned R2 creating an amazing opportunity for future development (STCA) • Escape the strain of everyday city life and immerse yourself in a peaceful rural lifestyle.• Three large living areas – plenty of room for the whole family• Large entertaining area with built in BBQ and pizza ovenContact: Sam Vescio 0402 083 446 [e] [email protected]

bed 5 | bath 3 | car 5 | land size 2.21ha

bevansdapto25 princes highway4261 [email protected]

bevans

Dapto Offers above $362,00093 Compton Street, Open Saturday 10am - 10.30am

• Exuding a warm and welcoming ambiance • Salt water in-ground pool, great for those summer months• Perfect size lounge and dining rooms • Polished floor boards throughout living areas• Near new kitchen plus appliances and modernized bathroom with separate toilet• Reverse cycle air conditioner in the lounge room Contact: Rebecca Coe 0413 148 509 [e] [email protected]

bed 3 | bath 1 | car 2

Page 14: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

14 28 February 2013

COMMERCIAL INDUSTRIAL RESORT NEWBUSINESS

ACROSS THE ILLAWARRAACROSS ALLMARKETS

CREATIVESTRATEGIES TO SELL UNIQUE PROPERTIES

SOLDAndrew Hedley[m] 0410 551 554Will Soeterboek[m] 0415 898 109

SOLDJohn O’Reilly[m] 0401 675 077Justin Sydenham[m] 0417 330 229

bevansbevansdapto 25 princes highway

[t] 4261 5222[e] [email protected]

Dapto Offers above $289,0002/77a Marshall Street

• Situated at the rear of a quiet complex of two • Lovely covered entertaining area looking out to the rear yard• Nice size lounge room with ceiling fan• Separate dining room with reverse cycle air conditioning• Two bedrooms, main with walk in robe, 2nd bedroom with built in robe

Contact: Simon Halcrow 0402 371 001 [e] [email protected]

bed 2 | bath 1 | car 1

Berkeley Offers above $165,000Views

• Sloping 640m2 parcel of land • Picturesque views of Lake Illawarra• Located in a child friendly quiet cul-de-sac • Set amongst luxury homes with the popular Port Beach just minutes away• Located in close proximity to major shopping centres and schools

Contact: Rebecca Coe 0413 148 509 [e] [email protected]

land for sale

“I welcome the opportunity to express my gratitude for the satisfaction I feel in the sale of my home. I certainly could not have received better service anywhere else than what I have received from Bevans. Also it was a pleasure being represented by Simon. His service was excellent from start to finish and I’m very proud of him! He has worked very diligently”Irene Goodwin

SIMON HALCROW EVIDENCE OF EXCELLENCE

To achieve the highest possible price for your property contact:Simon Halcrow [m] 0402 371 001[e] [email protected]

Page 15: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

wollongong

3500 007yourrealestatename.com.au64 Flinders Street, Wollongong 4226 6772www.teamsold.com.au

Robb Grubbm:e:

Open: Address: View Online: Wollongong Office:

llllll

OPEN HOUSE

224

Open: Address: View Online: Contact:

OPEN HOUSE

Open: Address: View Online: Contact:

OPEN HOUSE

Open: Address: View Online: Contact:

OPEN HOUSE

Open: Address: View Online: Contact:

OPEN HOUSE

Open: Address: View Online: Contact:

OPEN HOUSE

Address: View Online: Contact:

Open: Address: View Online: Contact:

OPEN HOUSE

Open: Address: View Online: Contact:

OPEN HOUSE

Open: Address: View Online: Contact:

OPEN HOUSE

Open: Address: View Online: Contact:

OPEN HOUSE

Open: Address: View Online: Contact:

OPEN HOUSE

Open: Address: View Online: Contact:

OPEN HOUSE

Page 16: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

DEVELOPER’S SPECIALOVER 50 SOLD!Free stamp duty rebate on settlement for next 20 sales For e.g $420,000 purchase price equates to a rebate of $14,390. Each apartment delivers its own unique view - be it the city lights, mountain backdrop or glistening ocean views, there is an apartment that can suit your needs.The Vantage is perfectly located opposite to Wollongong train station making it the ideal home for the commuter or student with both TAFE and Wollongong University nearby. Estimated Completion by December 2013 - Visit the website....www.thevantage.com.au

22-32 GLADSTONE AVENUE

Stadia - City Living by The SeaBoutique complex offering 24 luxuriously appointed apartments with 4 per floor. Most apartments have stunning views of the Pacific.

Perfectly placed in one of the most sought after and vibrant parts of Wollongong, Stadia is located within easy stroll to the city centre, as well as being ideally located within the entertainment district of town, Wollongong Golf Club, and pristine beaches virtually at your doorstep.

All units come furnished and are in excellent condition.

1-24/5-7 STEWART STREET

Ground Floor Villa Style Apartment

• Fully refurbished apartment.• Consisting of a good size lounge room and 2 attractive b/rms both with BIW´s that have bi-fold door access leading out to an attractive timber deck overlooking a private fully fenced courtyard. • Contemporary kitchen, exceptional bathroom, huge laundry and your own rear access into the apartment. The apartment complex is tucked away creating a more peaceful and secure place to live and is positioned only seconds away from transport and just minutes from Wollongong CBD, TAFE and the Hospital. • An opportunity is here also for the investor with a previous return of $375 per week.

2/15 MYRTLE STREET

• This light filled 2 bedroom unit is within a small complex of 8 situated on the ground floor. North facing with balcony, timber floors and a renovated kitchen. Main bedroom is fitted with generous BIW, internal laundry and modern bathroom. Walking distance to major shopping complex, cinemas, bike track, lake and public transport at door.

• This is a great little starter for the first home buyer or astute investor.

2/23 FIRST AVENUE

$187,000

• In a block of only 3 this 2 b/rm unit is a great little investment or starter for the first home buyer.

• BIW´s in both rooms, modern carpet and an undercover carport. • You will be only seconds away from town, transport, schools and only

minutes from the lake and Shellharbour Shopping Centre. • Currently rented at $200 per week.

2/22 DAVID AVENUE

$189,000

• This 2 b/rm unit is part of a well maintained complex of 8 units, situation on the second floor with a bright northerly aspect.

• Long term tenants anxious to stay currently paying $260 p/w rent. • The unit has a renovated kitchen, internal laundry and a single lockup

garage. • Short walk to beach, shops and transport at the door.

4/102 CAWLEY STREET

$259,000

• Feel completely at home with the impressively renovated living area and kitchen with large tiles and down lights creating a modern open plan feel.

• Double glazed windows keeping the home quiet and peaceful. • Convenient location with Free Shuttle Bus right at your door. • 3 bedrooms with separate bathroom and toilet.• Split system air conditioning and large backyard.

174 PRINCES HIGHWAY

$394,000

• Basketball, footy, golf, beach, shops, parks, movies, cafes and restaurants are all located only seconds away from this apartment.

• This 2nd floor 3 bedroom apartment has a spacious lounge and separate dining, nice kitchen, 2 bathrooms including ensuite, BIW´s, internal laundry and south east balcony with some water views.

• Set in a security block with security parking.

5/9 STEWART STREET

Offers Above $439,000

• Meticulously maintained single level home.• Unique in design, comprising 2 complete kitchens, 4 separate living

spaces, enough room for any family dynamic. • This home offers easy family living with flow through entertaining options

onto a level 669m2 north facing backyard with loads of storage options. • Walking distance to schools, train station, shopping centre and beaches.

110 MURRAY ROAD

$659,000

Page 17: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

30 Perth Road, Port Kembla

Close to Port Kembla Beach & Pool

4 | 2 | 2 • Huge timber kitchen, open plan design• All double bedrooms, 2 with BIW’s• Security shutters on every window• Double garage with internal access • Garden storage shed and fernery• Close to Port Kembla beach and pool

Guide Over $470,000

Auction Sat 9 Mar 2013, 2.30pm

Viewing Sat 11.30 - 12.00pm

Contact Sally Absalom 0415 424 257

Office ONEAGENCY Sally Absalom 3/19-21 Princes Highway Fairy Meadow 02 4285 7400Web oneagency.com.au

SALLY ABSALOM

28 February 2013 17

Page 18: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

All information contained herein is gathered from sources we consider to be reliable. However we cannot guarantee or give any warranty about the information provided andinterested parties must solely rely on their own enquiries. Residential | Commercial | Rural | Finance

ljhooker.com.au

LJ Hooker Warrawong4274 0334Shop 3, 53-57 King Street

This spacious modern villa offers three bedrooms all with built-in wardrobes with the main bedroom featuring an ensuite. The home has the added convenience of a single remote control garage. Positioned in a quiet block just approximately 150m to the white sandy shores of Thirroul beach. Short easy level walk to railway station, shops, parks and bowling club.

AuctionThis Saturday On-site 3:00pm

ViewSaturday 2:30pm to 3:00pmljhooker.com.au/912GMH

ContactDusko Vasileski 0411 713 523

LJ Hooker Warrawong4274 0334Shop 3, 53-57 King Street

The families have decided it’s time for the family home of over 50 years to go on the market and they hope it gives the next family a life time of memories as it has for them.So now is the time for the new family to dust off the power tools and bring out the paint brushes and restore this family home to its former glory, or if you like you can start fresh and knock down and rebuild the choice is yours.

AuctionThis Saturday On-Site 12:30pm

ViewSaturday 12pm to 12:30pmljhooker.com.au/91AGMH

ContactDusko Vasileski 0411 713 523

1

Situated right at the end of a quiet cul-de-sac street is where you will find this neat and tidy 3 bedroom home, which is an ideal start for the young family or that first investment property.

LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street

For Sale $249,000View Saturday 10:00am - 10:30am Contact Dusko Vasileski 0411 713 523

1

You’ll love the way this home has been renovated with fabulous timber floors, wonderful colour schemes and a sensational open plan living. The chef in the house will just adore the spacious timber kitchen with Island.

LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street

For Sale $295,000View By Appointment Contact Dusko Vasileski 0411 713 523

1

2LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street

For Sale 169,000View By AppointmentContact Dusko Vasileski 0411 713 523

This beautifully presented one bedroom unit is a fabulous investment. Your property portfolio will benefit from having this wonderful property. The property is currently leased to a great tenant at $210.00per week on a 12 month lease that’s right 6.4% return better than most banks.

1

2LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street

Auction 16th March 2013 On-site 1:30pmView Saturday 1:00pm to 1:30pmContact Dusko Vasileski 0411 713 523

You will enjoy the glittering lights over Lake Illawarra and the sunsets closing onto the mountains. Your summer will be complete with the inground swimming pool, undercover barbeque area and even a jetty close by for those relaxing fishing moments. Your winters will be magical, filled with love and warmth in front of the cosy fire place.

This is your chance to grab an opportunity of a lifetime with this cottage style home and the glorious views it has to offer.

1

Fully renovated with 3 bedrooms, cosy lounge room with combustion fireplace, light filled timber kitchen and dining room and the ultimate workshop/man house with triple car garage, high ceilings, bathroom and separate living area.

LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street

The House That Just Keeps Giving...

For Sale $495,000View Saturday 11:00am - 11:30am Contact Dusko Vasileski 0411 713 523

1

Warilla Beach or Lake Illawarra the choice is yours...they are both within a short walk from this ideally located 2 bedroom ground floor unit which is the perfect hideaway from the busy lifestyles most of us live.

LJ Hooker Warrawong 4274 0334Shop 3, 53-57 King Street

For Sale $199,000View Saturday 4:00pm - 4:30pm Contact Dusko Vasileski 0411 713 523

Page 19: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

All information contained herein is gathered from sources we consider to be reliable. However we cannot guarantee or give any warranty about the information provided andinterested parties must solely rely on their own enquiries. Residential | Commercial | Rural | Finance

ljhooker.com.au

1

2LJ Hooker Wollongong 4229 105568 Market Street

For Sale $319,000View Saturday 2nd March 10:00 - 10:30amContact Phil Oppenauer 0408 422 864,Marnie Oppenauer 0421 039 659

Clad home with decramastic tile roofing. Set on a low side landscaped & terraced 689m2 allotment. Features sep air cond lounge with combination fire, eat-in style tidy laminate kitchen & gas cooktop. 2 dble bedrooms both with built-in robes plus study. Tiled bathroom with shower over bath. Extensive storage space under plus laundry & potential to extend. Freshly painted with new carpet, linoleum in kitchen. ONLY ONE AT THIS PRICE!! HURRY!

1

LJ Hooker Wollongong4229 105568 Market Street

Auction On Site Saturday 2nd March at 11amView Saturday 2nd March 10.30-11.00amContact Marnie Oppenauer 0421 039 659

• R2 Low Density Residential zoning, total combined land size approximately 1,257m2

• 107 The Avenue - 739.8m2 block with 24.3 metre frontage, possible duplex site subject to council approval

• 109 The Avenue - 518.1m2 block comprising a 3 bedroom house, garage and shed.

• Ideal opportunity for dual family living side by side - not together!

1

2LJ Hooker Wollongong 4229 105568 Market Street

For Sale $499,000View By AppointmentContact Phil Oppenauer 0408 422 864

Highly sought after location close to primary school & shopping. Level landscaped approx 600m2 block. 3 bedroom brick & tile with fully self contained detached studio room ideal for extended family. Sunroom, air cond lounge, Tasmanian Oak kitchen & adjoining sep dining. All bedroom with built-ins & 2nd W.C in int laundry. Huge u/cover pergola overlooking pool, new garden locker plus sep workshop. Extras incl plantation shutters, solar electricity & hot water & bamboo timber flooring.

1

2LJ Hooker Wollongong 4229 105568 Market Street

For Sale $445,000View Saturday 2nd March 1:00 - 1:30pmContact Phil Oppenauer 0408 422 864

Every feature you could want for a growing family including ducted air cond, 4 bedrooms, main with ensuite, walk-in robe, adjoining state of the art Blue Haven spa. Sep lounge, sep formal dining room both opening onto u/cover wrap deck ideal for alfresco entertaining. Super size family room with breakfast bar, magnificent kitchen with loads of cupboard & bench space. High roofed detached double garage, offering miles of storage. Dog friendly landscaped yard of approx 676m2.

1

2LJ Hooker Wollongong 4229 105568 Market Street

For Sale $575,000View By AppointmentContact Marnie Oppenauer 0421 039 659

Glorious mountain views from this double brick home sited on 870sqm allotment in a cul-de-sac location. North facing backyard hosts pool, fully fenced & terraced lawn. Freshly painted home with new flooring and 2 brand new bathrooms! Custom designed kitchen, black granite benchtops. Raked cathedral ceilings in open plan living opening onto balcony via glass sliding doors. Downstairs to rumpus room, 4th bedroom plus internal laundry.

1

2LJ Hooker Wollongong 4229 105568 Market Street

For Sale $499,900View Saturday 2nd March 12:00 - 12:30pmContact Marnie Oppenauer 0421 039 659

Brand new with the WOW factor! Contemporary master built Torrens Title residence on easy care 380m2 allotment. Quality construction & design with large open floorplan showcasing top of the range Rosewood floors, high ceilings & state of the art kitchen with ceasarstone benches and stainless steel appliances. North facing glass sliding doors onto the undercover alfresco terrace and lawn. $15,000 grant with stamp duty concessions for first home buyer, $5,000 grant for all other buyers!

1

1st floor 2 bedroom apartment. Security intercom, large open plan lounge opening to north facing balcony. Separate tiled dining, laminate kitchen. Built in robes, extra balcony off main bedroom. Bath & shower in bathroom. 2 toilets & internal laundry with dryer. Lock up garage in basement.

LJ Hooker Wollongong 4229 105568 Market Street

For Sale $305,000View By Appointment Contact Phil Oppenauer 0408 422 864

1

2nd floor, huge undercover terrace with ocean glimpses/city views. Defined dining area adjoins white poly kitchen with black granite benchtops. Open plan air conditioned living area, bigger than most! Double lock up garage. Lift access.

LJ Hooker Wollongong 4229 105568 Market Street

One block back from Cliff Road!

For Sale $585,000View By Appointment Contact Marnie Oppenauer 0421 039 659

1

A must see if you are on a tight budget... this 2 bedroom unit has new kitchen with polished timber floors, wall oven & dishwasher. Good sized lounge & fully renovated bathroom/int laundry. Front unit in a well maintained block.

LJ Hooker Wollongong 4229 105568 Market Street

Renovated 2 Bedroom Unit With Car Space!

For Sale $225,000View By Appointment Contact Phil Oppenauer 0408 422 864

1

Situated in new bushland cul de-sac amidst other new homes. Unusually shaped approx 805sqm building block with approx 404sqm building envelope. A 20 metre frontage (approx) will offer a site suitable for a variety of homes.

LJ Hooker Wollongong 4229 105568 Market Street

AFFORDABLE HOME SITE

For Sale $249,500View By Appointment Contact Phil Oppenauer 0408 422 864

Page 20: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

All information contained herein is gathered from sources we consider to be reliable. However we cannot guarantee or give anywarranty about the information provided and interested parties must solely rely on their own enquiries. Residential l Commercial l Rural l Finance

ljhooker.com.au

1

2LJ Hooker Dapto 4261 3444

64 Princes Highway

For Sale Offers Above $580,000

View Saturday 9:30am-10:00am

Contact Patrick Ciocca 0405 373 916

This brand new & architecturally designed home is well on its way to completion. With 4

bedrooms all with BIW’s & high ceilings. The main offers a WIR & an ensuite. The open family, dining & kitchen areas are spacious & well equipped. The kitchen & bathroom will be

tastefully designed. Entertaining will be easy with the covered entertainment area. The family room offers access to a balcony. This

home boasts a games/theatre room downstairs along with an extra large 4 car garage & 4th toilet & vanity with under house storage.

1

2LJ Hooker Dapto 4261 3444

64 Princes Highway

For Sale Expressions Of Interest

View By Appointment

Contact Sharon Horner 0402 844 636

Lots 5, 6 & 7.

- The site is rectangular, sloped to the frontage along Kanahooka Road, with overhead power lines transversing it.- All lots are subject to overhead power lines.

- Comprises of 3 separate lots each at 613m2 (12.2m x 50.3m ) total area of 1839m2. - Surplus Land

Buy one or all three...

Expressions of Interest - Closing 25 March

2013 at 11:00am

1

2LJ Hooker Dapto 4261 3444

64 Princes Highway

For Sale $950,000-$980,000

View By Appointment

Contact Sharon Horner 0402 844 636

- Stunning four bedroom plus study

residence on level 5532m2 allotment- Two spacious living areas plus formaland informal dining area- Huge full length sunny verandah

- Gourmet kitchen- Professional stable complex- Inground pool with pergola

- Side and rear access- Potential to sub-divide- So much more...

1

2LJ Hooker Dapto 4261 3444

64 Princes Highway

For Sale $325,000-$340,000

View Saturday 1:00pm-1:30pm

Contact Sharon Horner 0402 844 636

THREE BEDROOM RESIDENCE WITH FULL DA FOR 2ND DWELLING..

- 3 bedroom existing residence with large balcony off lounge room.- Timber deck out the back along with grassy courtyard.

- Under the house has 2 car spaces.- Front and rear lane access.- Live in the existing house whilst you build

your dream home, then rent out the other.- Full plans available on request.

20 28 February 2013

All information contained herein is gathered from sources we consider to be reliable. However we cannot guarantee or give anywarranty about the information provided and interested parties must solely rely on their own enquiries. Residential l Commercial l Rural l Finance

ljhooker.com.au

1

2LJ Hooker Albion Park Rail 4256 3344

195 Princes Highway

For Sale $285,000

View Sat 2nd March 11am - 11.45am

Contact Craig Hyde 0404 497 521

Centrally located and close to all amenities is this 3 bedroom brick veneer home is perfect

for any investor or first home buyer.

This property offers loads of potential, with a little bit of a personal touch this home would

truly be yours.

Currently occupied as an investment property,

you can either continue or occupy.

1

2LJ Hooker Albion Park Rail 4256 3344

195 Princes Highway

For Sale $269,000

View By Appointment Only

Contact Craig Hyde 0404 497 521

Presenting a superb investment opportunity. This home boasts a central position as it is just

metres to shops and transport options. Situated on a level 600sqm block a home like this is hard to find. There is something here for all the family to enjoy including a cubby house

that the kids will just love. This home features, 3 bedrooms (two with built in wardrobes) updated kitchen and bathroom, reverse cycle

a-c unit and not to forget the oversized garden shed ready to store all your tools. Don’t miss out on this incredible opportunity.

1

2LJ Hooker Albion Park Rail 4256 3344

195 Princes Highway

For Sale $449,000 Each

View Agent On Site Sat 2nd March 10am -

10.30am

Contact Craig Hyde 0404 497 521

A stunning selection of 2 Torrens Title duplex properties which are currently under

construction. Each residence has been thoughtfully designed featuring 3 great sized bedrooms, main with ensuite and walk in robe, double garage, balcony at the rear and finished

with quality inclusions.

Due for completion approx March 2013. Take

advantage of the Government Grants on offer and concessions $$.

1

2Location Shot

LJ Hooker Albion Park Rail 4256 3344

195 Princes Highway

For Sale Units From $219,000

View Sat 2nd March 11am - 12pm

Contact Vito Scioscia 0402 121 870

A perfect start for a first home buyer or investor with these town house’s currently on

offer in Bellambi.

Neat and tidy home offering 2 bedrooms with balcony off main bedroom, situated in a block

of 7 units in total - some of them have been partially renovated, located within walking distance to beaches, boat ramps, shops and

public transport.

Page 21: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

All information contained herein is gathered from sources we consider to be reliable. However we cannot guarantee or give any warranty about the information provided andinterested parties must solely rely on their own enquiries. Residential | Commercial | Rural | Finance

ljhooker.com.au

LJ Hooker Dapto4261 344464 Princes Highway

Only 5 yrs young, located in a rural/residential Estate. With 4 spacious bedrooms, the master having WIR & large ensuite. From the light filled entry foyer through to either the study/office or formal lounge room. Flowing out to the kitchen with Caesarstone bench tops, glass splashbacks along with the breakfast bar. An awesome theatre room situated off the main living areas. Also offering town water + 2 rain water tanks, triple garage & a large American barn.

For SaleExpressions Of Interest

ViewSaturday 11:30am-12:30pm

ContactSharon Horner 0402 844 636

With Over 2 Acres With Near New Single Level Residence

1

With breathtaking views, 40 solar panels, water tank, an Independent bio-cycle sewerage system, the homestead has full federation/bull nose verandah, 4 bedrooms plus study, 2 bathrooms & two living areas & a double garage.

LJ Hooker Dapto 4261 344464 Princes Highway

Get Back To Nature - Eco Friendly 13 Acres

For Sale $850,000View Saturday 10:00am-10:30am Contact Sharon Horner 0402 844 636

1

Large 3 bedroom, single level, clad residence on level 632m2 allotment. With separate kitchen & lounge & 3 spacious bedrooms. With side access to rear yard & detached double garage. 2nd toilet & shower next to garage.

LJ Hooker Dapto 4261 344464 Princes Highway

Great House, Great Price.. Be Quick!

For Sale $279,000View By Appointment Contact Sharon Horner 0402 844 636

1

This business has serviced the district with quality meats & professional services for over 91 yrs. With a solid client base incl clubs & venues throughout the area, providing approx 1,000 weekly meat trays. Purchase freehold or negotiate a lease.

LJ Hooker Dapto 4261 344464 Princes Highway

Wholesale Retail/Business Or Building Or Both

For Sale Business: $199,000 - $219,000 Building: $300,000View By Appointment Contact Patrick Ciocca 0405 373 916

1

This property offers a good size kitchen/dining & separate lounge area. There are 2 generous bathrooms & a carport. With a self contained Granny Flat with a kitchen, dining & lounge open plan area with a bedroom & bathroom.

LJ Hooker Dapto 4261 344464 Princes Highway

Great Return Potential

For Sale $319,000View 11:15am-11:45am Contact Patrick Ciocca 0405 373 916

1

Immaculately presented, no work to do, this functional home will be the envy of family and friends with the tranquil landscaped gardens, huge 4 car garage and large workshop. Upper level perfect for retreat or 4th bedroom.

LJ Hooker Dapto 4261 344464 Princes Highway

Move Straight In!

For Sale $350,000-$370,000View Saturday 12:15pm-12:45pm Contact Daniel Lambert 0468 944 961

1

Premier building parcel ready to build your dream home with an expansive and beautiful backdrop. A large 762m2 near level lot highly sought after and to be surrounded by prestigious homes.

LJ Hooker Dapto 4261 344464 Princes Highway

Premier Building Block

For Sale $359,000View By Appointment Contact Daniel Lambert 0468 944 961

1

2LJ Hooker Dapto 4261 344464 Princes Highway

For Sale $690,000 - $715,000View Saturday 1:15pm-1:45pmContact Patrick Ciocca 0405 373 916

Located in a premier position & the opportunity to have all the family under the one roof. With loads of space downstairs, a formal entry & 2 bedrooms. The kitchen has had a makeover with quality appliances. There is also a separate living & dining area with access to the large yard & workshop/storeroom. The main bathroom has been completely renovated. Upstairs you will find an open plan living room with access to the front deck. There is a kitchenette/combined dining area. With 3 bedrooms upstairs & a fantastic sitting area.

1

Privately situated vacant land ready to build on. 740m2 & DA approved for a modern home. Enjoy the privacy of this battleaxe block with sweeping northern views in an established neighbourhood surrounded by prestigious homes.

LJ Hooker Dapto 4261 344464 Princes Highway

DA Approved Dream Home

For Sale Offers Above $165,000View By Appointment Contact Daniel Lambert 0468 944 961

1

This stunning home offers side access & a great size yard for the family & kids to enjoy. With 4 bedrooms with BIW’s & the main bedroom with an ensuite & WIR, 3 living areas, a fantastic size separate kitchen & dining room & double garage.

LJ Hooker Dapto 4261 344464 Princes Highway

Stunning Home

For Sale $579,999View Satuday 11:15am-11:45am Contact Patrick Ciocca 0405 373 916

1

Light & airy residence on 638m2 block. With brand new bathroom, modernised kitchen, high ceilings, polished floors & large windows. All 3 bedrooms are spacious & have BIW’s. There is a carport & a large shed. Rental potential for $360 p/wk.

LJ Hooker Dapto 4261 344464 Princes Highway

Investor or First Home Buyer

For Sale $309,000View By Appointment Contact Patrick Ciocca 0405 373 916

1

This beautifully appointed home has had loads of work done. With an open plan dining, 2nd family area & galley style kitchen. 3 of the 4 bedrooms boast BIW’s. Externally, a good size yard, covered ent area & a sparkling in-ground salt water pool.

LJ Hooker Dapto 4261 344464 Princes Highway

Renovated Family Home

For Sale Reduced to $339,000View Saturday 10:15am-10:45am Contact Patrick Ciocca 0405 373 916

Page 22: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

REAL ESTATE

arre.com.au 4228 2555 (formerly FANNING REAL ESTATE)

West Wollongong

Here it is!For Sale: $429,000Open: By appointment

• Immaculate brick clad & tile roof home• Three generous size bedrooms• Neat & tidy kitchen, modern bathroom• Large living / dining areas with polished floors• Large level backyard flowing from kitchen• Single lock up garage, walk to Westfield Figtree• Option to keep wonderful tenants or move in

21 London Drive

Scott Phillips0422 183 341

arre.com.au/2064

Primbee

Massive Block With Lake AccessFor Sale: $539,000Open: By appointment

• Magnificent 2030m2 level block with spectacular views• Side access to beautiful Lake Illawarra foreshore• Three bedroom clad home with detached garage• Covered verandah, brick wood-firied barbeque• Floorboards hidden under the floor coverings• Garden shed for storage and water tank• Quiet but convenient location

26 Windang Road

Sharyn Moffat0499 989 998

arre.com.au/2059

Worrigee

Opportunity KnocksFor Sale: Offers From $309,000Open: Sat 11:30am - 12:00pm

• Well maintained family home spanning a single level • Open plan dining & lounge with new dishwasher & oven• Three bedrooms, all with built-in wardrobes• Alfresco entertaining area, low maintenance gardens• Freshly painted and featuring new carpet• Oversize single garage with additional off street parking

26 Socrates Place

Chris Atlee0466 631 545

arre.com.au/2052

Unanderra

47 Blackman Parade

Expansive Panoramic ViewsFor Sale: $349,950

Open: Sat 1:00-1:30pm

• Solid four bedroom home priced to sell!• Sunny and light filled interior• Great size lounge and functional kitchen• Single garage and big workshop under• Located in pleasant neighbourhood• Just waiting for you to add your finishing touches

Renee Lambert0418 423 636

arre.com.au/2064

Lake Heights

37 Northcliffe Drive

Spectacular Lake ViewsFor Sale: $425,000

Open: By appointment

• Spectacular lake views from lounge & dining room• Almost 900m2 backing on to Lake Illawarra• Two large bedrooms with built in robe to main• Recently painted with new floor coverings throughout• Level manicured yard - enjoy the lakeside location• Conveniently located close to Club, shops & schools

Sharyn Moffat0499 989 998

arre.com.au/2036

Page 23: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

REAL ESTATE

arre.com.au 4228 2555 (formerly FANNING REAL ESTATE)

Unanderra

A Home : A Farm : An Income = Win : Win : Win For Sale: $2,200,000Open: By appointment only

• Truly unique 5.35 hectare (13 acre) property - a rare find• Four bedroom brick ranch style home with so many features• Large open plan kitchen, dining & living with stunning bluegum floors• Workshop 1 - 162m2 with mezzanine office currently tenanted• Workshops 2 - 108m2 divided into shop with separate workshop• Two extra large stables (one with vet crush) & tack room

Lot 2 Berkeley Road

Sharyn Moffat 0499 989 998

arre.com.au/2061

Page 24: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

PRICE G

UIDE

ABOVE $580,000

Nor

th W

ollo

ngon

g

Owner Loves• Stunning 2 bedroom Penthouse apartment plus study• Large sunny lounge room with floor to ceiling windows leading out onto the oversized

east facing balcony

Inspect: Sat 2 Mar 1:00-1:40pm

Auction: On Site Sat 16 March 1:30pm

Contact: Danny O´Neill 0416 089 884 - [email protected]

8/6 Virginia StreetNew! AUCTION

2

2

1

Plus• Spacious modern kitchen complete with Miele appliances• Master bedroom with ensuite & BIW’s and 2nd bedroom with mirrored BIW’s• Short walk to North Beach, cafe’s, public transport and Wollongong CBD

Wol

long

ong

Owner Loves• Oversized 2 with potential for 3 bedroom townhouse• Small complex of 3• Generous bedrooms with built-in wardrobes

Inspect: Sat 2 March 10:00-10:40amSale: $439,000Contact: Jason Capelo 0424 372 722 [email protected]

3/8 Gilmore StreetNew Price! $439,000

2

2

2

Plus• Internal access from double garage• Large courtyard, great for entertaining• Handy location near public transport

Kei

ravi

lle

Owner Loves• Renovated 2 bedroom unit• Outdoor patio area great for entertaining• Polished floorboards throughout living areas

Inspect: Sat 2 Mar 11:00-11:40amSale: $289,000Contact: Jason Capelo 0424 372 722 [email protected]

3/48 Robsons Road$289,000

2

1

1

Plus• Located close to public transport & Wollongong Uni• Single lock up garage• Both bedrooms have built-in wardrobes

Wo

ono

na

Owner Loves• The unlimited opportunities the block provides• That it’s so close to Woonona’s CBD

Inspect:By Appointment

Sale:$399,000

Contact:Danny O´Neill 0416 089 [email protected]

12 Popes Road$399,000

Plus• Build your own home, subdivide or develop• Rare block measuring approx 2,000 sqm

Fai

ry M

ead

ow

Owner Loves• Quiet complex with lots of natural light• Conveniently located close to the Uni, Tafe, shops,

beaches & public transport

Inspect:Sat 2 Mar 12:00-12:40pm

Sale:$274,000

Contact:Danny O´Neill 0416 089 [email protected]

21/192-198 Princes HighwayNew Price! $274,000

2

1

1

Plus• Enclosed balcony providing extra living space plus large

secure storage room• Great investment opportunity

Page 25: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

top performers providing a diverse range of real estate solutions

Daniel Hastings0416 283 876

David Geary0418 423 782

Phil Jones0418 421 468

Paul Baxter02 4253 2743

Maurice Bertapelle0412 029 131

Daniel Frazer0408 944 434

Natalie Lowe0401 745 678

Sam O’Halloran0423 825 072

George Szymkiewicz0448 046 450

Amy Andersen02 4253 2743

Yenson Mui0421 882 541

Geoff Jones0418 421 074

Tim Jones0409 456 299

Travis Machan0447 300 800

MMJWollongong.com.au6-8 Regent Street, WollongongPhone 4229 5555 | Email [email protected]

Deb Cummins0412 426 495

Pat Cummins02 4256 6666

Dale Whittaker0414 376 720

Mark De Cresci0422 744 097

Joyce Mantuano02 4256 6666

Natalie Reale0405 998 211

MMJshellharbourcity.com.au57 Central Road, Oak flats Phone 4256 6666 | Email [email protected]

Luke Fox0424 248 165

Julie Taylor0415 160 683

Greg Truebody0412 626 964

Troy Phipps0412 425 801

Roger Hughes0412 424 071

Greg Ellul0412 421 214

Glenice McMahon0407 293 466

Jade O’Byrne0405 180 593

Frank Belsito0416 032 986

MMJNorth.com.au251-253 Princes Highway, CorrimalPhone 4285 5999 | Email [email protected]

Luke Collins0401 405 874

Adam Martin0408 411 723

MMJSouth.com.au231 Windang Road, Windang Phone 4296 4444 | Email [email protected]

John Tisma0409 612 000

Ian Fitzgibbon0418 333 149

Bradd O’Brien0400 002 255

Alan Chaffers02 4261 3822

Greg Edwards0438 613 822

MMJDapto.com.au49 Princes Highway, DaptoPhone 4261 3822 | Email [email protected]

stay connectedGet the latest news, property updates & more online. #mmjrealestate @mmjrealestatewww.facebook.com/mmjrealestatewww.youtube.com/mmjrealestate

what’s open this weekend?Find out what’s open this weekend. Scan this code with your smart phone to go straight to our open house list.

MMJ’s weekly hot tip!P icking the right property.Thinking of purchasing? By doing your research every step of the way and arming yourself with knowledge about the property and the region it is located in, it is very much possible to make a purchase that will continue to benefit you and your family for years to come.

Head to our blog to read more on picking the right property >>>

Page 26: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

MMJ Wollongong l 4229 [email protected]

first time advertised!

Wollongong, Unit 5 / 78 - 82 Campbell Street

Modern 3 bedroom unit with fresh carpet and paint throughout• Open-plan living with a huge wrap-around balcony for entertaining• Built-in wardrobes in all bedrooms with ensuite to main• Double lock-up garage in basement, well-maintained building• Beautiful views of the escarpment, great rental history• Located in a central location close to beach, schools and CBD•

3 2 2

Entertain your guests while watching the sun set over our beautiful escarpment

FOR SALE $469,000View Saturday 2:00 - 2:30pmContact Daniel Frazer 0408 944 434 Bradd O’Brien 0400 002 255Email [email protected] iD mmj.com.au/3P3637

Page 27: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

MMJ Wollongong l 4229 [email protected]

A perfect marriage of size and locationwollongong, Unit 18 / 71-83 Smith Street

A massive apartment with cite and escarpment views • All bedrooms are huge with robes, main with ensuite • Enormous open plan living with a fully covered outdoor area • Approx 250m walk to Wollongong City Mall and all amentities • Top fl oor unit with security to complex and car park•

3 2 2

for sale $460,000View Saturday 11:00 - 11:30am Contact David Geary 0418 423 782Email [email protected] iD mmj.com.au/3P3712

stylish, neat and affordablewOLLONGONG, Unit 4 / 21 Bank Street

3 bedrooms, perfect for home offi ce • 3 balconies’, 1 courtyard• DLUG with lift access • Private street entrance • Modern Kitchen with stainless steel appliances• Plenty of storage space•

3 3 2

for sale $579,990View By AppointmentContact Sam O’Halloran 0423 825 072Email [email protected] iD mmj.com.au/3P0393

reside, rent out or both!gwynneville, 41 Lucinda Street

3 bedroom home plus 1 bedrooms fl at• Level corner site with trains, buses & local shopping all within 3-5 minutes • Wollongong CBD & University within 4 minute drive • Single garage plus potential for more parking• Renovate for ideal living or improved rental potential•

4 2 1

for sale $499,000View Saturday 12:00 - 12:30pm Contact Daniel Hastings 0416 283 876Email [email protected] iD mmj.com.au/3P3810

forced sale - the rural dream close to towndombarton (dapto), 246 Sheaffes Road

5 allotments ranging in size from 4,000m• 2 to 10,950m2

Electricity and Bitumen surfaced road access to all lots• Gently sloped building envelopes with varying degrees of elevation• Privately situated estate for those looking to avoid the city’s hustle, but •

retain convenience as well.

for sale from $299,000View Saturday 1:00 - 1:30pm Contact Daniel Hastings 0416 283 876Email [email protected] iD mmj.com.au/3P3634

Page 28: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

MMJ Wollongong l 4229 [email protected]

Renovate or re-developfigtree, 102 Bellevue Road

Original and solid brick home with generous living• Gently sloped 620m• 2 corner lotVersatile enclosed back verandah• Renovators will recognise great potential or plans drawn for impressive duplex • developmentCurrent Lease in place•

3 1 1

offers above $399,000View Saturday 10:00 - 10:30am Contact Daniel Hastings 0416 283 876Email [email protected] iD mmj.com.au/3P3796

purchase in one line or seperatelyunanderra, 8 & 10 Grace Square

2 properties situated on level allotments in convenient “walk everywhere” • addressOne home is divided into 2 tenacies, The other is a 3 b/r home• All tenants have long term track records• Excellent home buying opportunities or investment• Shopping, train station, parks & schools are all within easy stroll•

3 1 1

for sale NO 8 $329,000For sale N0 10 $339,000View By AppointmentContact Daniel Hastings 0416 283 876Email [email protected] iD mmj.com.au/3P3770

modernised and affordable unanderra, 13 Coral Crescent

Very Spacious living with defi ned dining • Modernised kitchen and bathroom• Secured parking with potential to expand vehicle accommodation • Ample storage & access under the home • Private reserve to the rear maintains excellent privacy•

offers above $349,000View Saturday 11:00 - 11:30amContact Daniel Hastings 0416 283 876Email [email protected] iD mmj.com.au/3P3805

3 1 1

Low maintenance livingdapto, 2 Shiraz Drive

Impressive outdoor entertaining accessed via french doors off the main living • 3 bedrooms with walk in robe & ensuite off the main • Double garage space with minor conversion • Low maintenance home purchase• Excellent affordable home & ideal for “empty nesters”•

3 2 2

offers above $399,000View Saturday 12:00 - 12:30pmContact Daniel Hastings 0416 283 876Email [email protected] iD mmj.com.au/3P3788

Quality Townhouse & Villa Homes - Will Be Soldnowra, 8 McKinnon Street

auction if not sold prior6pm Wednesday, 6th March 2013Shoalhaven Entertainment Centre, Bridge Road, Nowra

MMJ Wollongong 4229 5555Tim Jones 0409 456 [email protected] Clyde Poulton Real Estate 4421 2644Karl Poulton 0401 824 [email protected]

Unit 5

Unit 10

Unit 11Unit 4

140m² (approx) level villa home• Family area with direct access to lawn•

3 2 1unit 4

Master bedroom with access to lawn area• North facing living area, 140m² (approx)•

3 2 1unit 5

Two separate living rooms and meals area• Private fenced lawn area, 150m² (approx)•

3 2 2unit 10

160m² (approx) total area• Low maintenance backyard•

3 2 1unit 11

Open for Inspection Saturday 10:00 - 10:30am

• Selection of three bedroom townhouse or villas to be auctioned individually• Less than 6 years old and featuring double insulation in ceilings and walls, stainless steel appliances, quality kitchens and natural gas / electrical services• Walking distance to State and Catholic High Schools and adjacent to Nowra Private Hospital • On established bus route and short drive to Nowra Town Centre

Page 29: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

MMJ North l 4285 [email protected]

beachside unit with ocean views!THIRROUL, 5/10 The Esplanade

• Superbly positioned just 3 properties from the beachfront

• Filtered North Eastern views across the park to the sea

• Topfloorlightfilledunitiswellstructuredandisinoriginalneatcondition

• A‘CommonArea’gamesroomprovidesanextraoptionforsocialising

• Nocommonwallsandcomplexofonlysix

2 1 1

for sale $475,000View Sat 02/03 2.00 - 2.45pmContact GregTruebody0412626964Email [email protected] iD mmj.com.au/4P3698

great opportunity - ideal locationfairy meadow, 29FairyAvenue• 3 bedroom brick home with sunroom in popular family suburb

• Openplankitchen/diningareawithgascookinganddishwasher

• Separatecosyloungeroom,spaciousandtidybathroom

• SundrenchedlevelyardwithswimmingpoolandundercoverBBQarea

• Singlelockupgarage,2ndwcinlaundry,level771sqmblock

3 1 1

by neg $460,000 - $490,000View Sat 02/03 11.00 - 11.45amContact GregEllul0412421214Email [email protected] iD mmj.com.au/4P3714

Ultra Modern Brand New Townhousescorrimal, 273RotheryStreet• Architecturallydesignedformaximumbenefit.Interiorsaremodern&vibrant

• Offeringanabundanceoflightandspacethroughout

• Front and rear courtyards

• Spaciouslivingareas

• Central location

3 2 2

from $450,000 View Sat 02/03 12.00 - 1.45pmContact GregEllul0412421214Email [email protected] iD mmj.com.au/4P3585

dream location!BALGOWNIE, 4NewMountPleasantRoad• Renovate,extendorre-build-Unlimitedpossibilities!

• Superb710sqmblockwithsweepingviewstoNorthernBeaches

• 3bedroombrickandtilehomewithgarageunder

• HugeNorthfacingyardreadyforpoolandcabana

• Arareopportunityinsuchadesirablelocation!

3 1 1

for sale $620,000View Sat 02/03 12.00 - 1.00pmContact TroyPhipps0412425801Email [email protected] iD mmj.com.au/4P

Page 30: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

MMJ North l 4285 [email protected]

discerning buyer wanted!corrimal, 4/37 The Avenue

• Uniquetownhouselocatedinasmallcomplexofonlyfive• Largeopenplanlivingareaupstairswithpolishedfloors&modernkitchen• Livingareaopenstolargeterracecourtyardwithbreathtakingoceanviews• Two double bedrooms, main with WIW and ensuite and BIW in the second• Doubleremotelockupgaragewithintaccessandaccesstocourtyard

2 2 2

for sale $455,000View By AppointmentContact Greg Ellul 0412 421 214Email [email protected] iD mmj.com.au/4P3686

peacefully private....WOONONA, 3/25 Popes Road

• Freshlypaintedlargefunctionalkitchen&openplanlivingwithnewtimberfloors• 2 double bedrooms both with BIW’s and new carpet and blinds throughout• Large bathroom set up for disable use• Locatedattherearofthedevelopmentinasmallblockof4totallyfreestanding• CompletewithdoubleremotelockupgarageandaspaciousUshapedc/yard

2 1 2

for sale $359,900View Sat 02/03 2.00 - 2.30pmContact Greg Ellul 0412 421 214Email [email protected] iD mmj.com.au/4P3678

tree studded hideaway! bulli, 14 Cope Place

• ThistrilevelresidenceispositionedonacornerlotbackingontoGrevilleaPark• Recently refurbished interiors with new Berber carpet and freshly painted• Features cathedral ceilings, ensuite and W.I.W to main bedroom• Separate dining plus family room. Internal access to garage• Ampletimberdecksaffordtranquilviewswithchildfriendlyyardspace

4 2 2

offers above $560,000View By AppointmentContact Roger Hughes 0412 424 071Email [email protected] iD mmj.com.au/4P3621

a1 investment!CORRIMAL, 3/15 Underwood Street

• Riskfree,topshelfinvestment,idealforSMSF• Potential rent of $340-$360pw• 1st class interiors with new ensuite and bathroom• Minuteswalktoeveryamenity• Vacant and able to lease before settlement

3 2 2

by neg $320,000 - $360,000View Sat 02/03 1.00 - 1.30pmContact Roger Hughes 0412 424 071Email [email protected] iD mmj.com.au/4P3536

huge home - great spot!towradgi, 63MurranarRoad• It’s not often we have a family sized house this close to the beach• Rear ballroom sized living area and upstairs parents retreat• High ceilings and generous room sizes throughout• Choice of 3 or 4 bedrooms, beaut timber patio at rear with a level lot• Soughtaftersuburbandonlyfiveminuteswalktosurfandcycleway

4 3 2

offers above $640,000View Sat 02/03 12.00 - 12.30pmContact Roger Hughes 0412 424 071Email [email protected] iD mmj.com.au/4P3564

choice of units!corrimal, TheAvenue&ParkRoad• Choice of one and two bedroom units• Central locations• Currently leased• Great investment opportunity• Orgreatfirsthome

2 1 1

from $225,000 - $239,000View By AppointmentContact Greg Ellul 0412 421 214Email [email protected] iD mmj.com.au/4P3210

great buy in a quiet locationbalgownie, 10b Terrell Place

• ModernTorrensTitletownhousetenantedat$380perweek• Two generous sized bedrooms both with BIW’s and balconies• Polishedsolidtimberflooringwithanopenplanliving/diningarea• Neattimberkitchenwithinductioncooktop• Second toilet off the laundry opening out to an oversized private courtyard

2 1 1

offers above $379,500View Sat 02/03 10.45 - 11.15amContact GleniceMcMahon0407293466Email [email protected] iD mmj.com.au/4P3628

centrally located unitCORRIMAL, 9/25UnderwoodStreet• Five minute stroll to retail shops, services and transport• North/South orientation with balcony• Good size bedrooms, open plan lounge/dining and internal laundry• Singleallocatedparkingatrearofcomplex• Currentlyrentsfor$260perweek

2 1 1

for sale $209,000View By AppointmentContact GregTruebody0412626964Email [email protected] iD mmj.com.au/4P3526

Page 31: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

MMJ North l 4285 [email protected]

brand new villawoonona, 1/105-107 Campbell Street

• Brand new single level villa home, 2 huge bedrooms with BIW’s• An ideal retirement package, only a short walk to shops and beach• Largeopenplanlivingopeningto2sunfilledprivatecourtyards• Finishedtothehighestqualitywithpremiumfittingsthroughout• AtrulyrarefindintheNorthernSuburbs

2 1 1

offers above $390,000View By AppointmentContact Troy Phipps 0412 425 801Email [email protected] iD mmj.com.au/4P3435

as new!primbee, 7a Overhill Road

• 2 year old brick and tile family home• Boasting vogue kitchen and bathroom, 3 good sized bedrooms with BIW’s• Fullytiledopenplanlivingareaflowingtooutdoorentertainingarea• Set on a fully landscaped level 516sqm block• A low maintenance lifestyle only a short walk to lake

3 1 1

for sale $389,950View Sat 02/03 11.00 - 11.45amContact Jade O’Byrne 0405 180 593Email [email protected] iD mmj.com.au/4P3610

stop paying rent!figtree, 48 Risley Road

• Yes the price is right, a brick and tile home for the price of a unit• 3 good sized bedrooms with BIW’s• Boasting modern timber kitchen and neat bathroom• Featuringpolishedtimberfloorsandpavedoutdoorentertainingarea• Opposite acres of parkland and only minutes to Figtree Shopping Centre

3 1 1

by neg $325,000 - $355,000View Sat 02/03 12.15 - 1.00pmContact Jade O’Byrne 0405 180 593Email [email protected] iD mmj.com.au/4P3620

“hillcrest”corrimal, 6/225 Princes Highway

• Featured in a brand new development• Secure underbuilding parking• Luxuriously appointed throughout• Centrally located in Corrimals CBD• Be quick to qualify for Government Grant

2 1 2

for sale $429,950View By AppointmentContact Troy Phipps 0412 425 801Email [email protected] iD mmj.com.au/4P0075

artists impression

be quick!CORRIMAL EAST, 8/102 Cawley Road

• Moderntopfloor2bedroomunit• SpaciouslivingroomopeningtoNorthfacingbalcony• Featuringrenovatedkitchen,timberfloorsthroughoutandtrendybathroom• Remote lock up garage and internal laundry complete the package• Short level walk to beach, schools, shops and transport

2 1 1

for sale $249,000View Sat 02/03 11.15 - 12.00pmContact Troy Phipps 0412 425 801Email [email protected] iD mmj.com.au/4P3441

invest or owner occupyfairy meadow, 7 Chapman Street

• 3bedroomhouseplusattached1bedroomflat&freestandingworkshop• Ideal investment with potential return of $670 per week• Oroccupytheworkshopandlettheflatspayitoff!• Houseandflatarewellpresentedwithmodernkitchenandbathrooms• Workshop 150sqm plus mezanine and high clearance roller door

4 2 3

for sale $510,000View By AppointmentContact Luke Fox 0424 248 165Email [email protected] iD mmj.com.au/4P0087

stop paying rent!corrimal, 4/28 Thurston Crescent

• Situated in a quiet location• Walking distance to Stocklands Corrimal and public transport• Idealforfirsthomebuyerorinvestor• Polishedtimberfloors,Tidykitchenandmodernbathroom• Currently tenanted with expired lease at $200 per week

1 1 1

for sale $195,000View Sat 02/03 10.30 - 11.00amContact Luke Fox 0424 248 165Email [email protected] iD mmj.com.au/4P

location shot

Investment/ Development Opportunitywollongong, 75 Kenny Street

• D.A approved for a large warehouse/showroom with ample parking• Currently2flatsreturning$370pw• Fantastic level 660sqm block in sought after business precinct• Build your new business premises or lease out• Atrulyrareopportunitythatwillnotlast!

3 2 0

by neg $440,000 - $460,000View By AppointmentContact Troy Phipps 0412 425 801 Email [email protected] iD mmj.com.au/4P3474

Page 32: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

MMJ Dapto l 4261 [email protected]

Experience the design difference - open saturdayHORSLEY, 48 Huxley Drive

• Unique architecturally designed residence with many individual features• Sunken formal lounge, separate dining, loft area• Near new timber kitchen, family room, large covered entertaining area• 3 bedrooms all with built in robes, main with new ensuite• Double garage, extensively landscaped yard, privacy and security assured.

3 2 2

for sale $439,900View Saturday 1.00-1.30 Contact Alan Chaffers 0418 425 443 Email [email protected] iD mmj.com.au/5P1032

IMPECCABLE - open saturday!dapto, 56 Emerson Road

• Modernised 4 bedrooms brick veneer & tiled family home• Formal entry foyer, large air conditioned lounge room• Dining area off the modern kitchen, modern decor throughout • BBQ pergola area, large double garage and double carport• Great views, beautiful gardens & nothing to do but move in

4 1 2

for sale $369,900View Saturday 11.00-11.30Contact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1056

YOU’LL LOVE IT - OPEN SATURDAY !KANAHOOKA, 13 William Beach Road

• This family home features 3 good size bedrooms 2 with built in robes• Modern formal lounge, formal dining, new kitchen stainless appliances• Bathroom consist of shower bath and vanity, detached workshop• Side access to the back yard, covered decked entertaining area • Air-conditioning, access to Lake Illawarra fi sh out of the back yard..

3 1 0

for sale $359,900View Saturday 12.00-12.30Contact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1055

spacious living vilas - call to inspect wollongong, 1/18 & 2 /18 Rowland Avenue

• Take a look at this spectacular fully renovated 2 brm villa • Formal lounge, timber kitchen & spacious combined formal dining. • Brand new bathroom,new carpets & freshly painted throughout• There is a spacious single car garage, outdoor BBQ/ent. area . • Electronic security gates at the front of the home for that added

2 1 1

for sale from $379,900View By AppointmentContact Bradd O’Brien 0400 002 255 Email [email protected] iD mmj.com.au/5P1030

new price - open saturdaydapto, 25 Bright Parade

• This home has size and space for the growing family to enjoy• Formal lounge and formal dining with escarpment views• Features an impressive 5 brms with BIR’s, spacious kitchen• Double garage and room for workshop• There is a spacious 2 car garage and loads of room for workshop

5 1 2

Contact Greg Edwards 0438 613 822 Email [email protected] iD mmj.com.au/5P1015

For Sale $389,900 View Saturday 11.00-11.30

townhouse special - open saturdaydapto, 2/19 Baan Baan Street

• Immaculate brick veneer & tile townhouse, minutes to town centre. • Open plan living areas with A/C, spacious kitchen, internal laundry.• Two bedrooms each with built in robes, main bathroom with corner spa • Single garage with remote door & internal access.• Living area opens onto a private courtyard and neat gardens.

2 1 1

Contact Ian Fitzgibbon 0418 333 149Email ian.fi [email protected] iD mmj.com.au/5P1057

For Sale $325,000 View Saturday 12.00-12.30

forest grove - open saturdayKANAHOOKA, 6 Grantham Close

• Located in popular Forest Grove being a secure & gated estate• Immaculate 3 bedroom home with quality inclusions through out• Spacious living areas & main bedroom with two walk in robes• 2 bathroom plus 3 air conditioners & heaps of cupboard space.• All in a safe cul de sac being ideal for the retiree or working couple

3 2 2

Contact Greg Edwards 0438 613 822 Email [email protected] iD mmj.com.au/5P1018

For Sale $479,900 View Saturday 1.00-1.30

VERY NEAT PACKAGE - open saturday HORSLEY, 6 Greenbrook Place

• Immaculate 3 bedroom brick & tiled family home all with built in’s• New kitchen with granite bench tops, plus gleaming new bathroom • Featuring new fl oating fl oors with R/C air conditioning • Large lock up garage with side access to good size yard • Located in safe & quiet cul de sac only a short stroll to local shops

3 1 1

Contact Greg Edward 0438 613 822Email [email protected] iD mmj.com.au/5P0982

For Sale $335,000 View Saturday 12.00-12.30

WORK FROM HOME - 2018m2 level block kembla grange, 6 Tirfecta Place

• Impressive home on a half an acre level block in a quiet cul-de-sac street• Formal lounge & dining, timber kitchen, family & meals room, ensuite, pergola• Attached double garage plus a separate 7 car size shed at the rear plus 3 carports• Separate 1 bedroom granny fl at, great back yard, wheelchair friendly & more• Work from home, room to park the truck or simple live the lifestyle.

3 3 12

for sale $799,000View By AppointmentContact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1039

magnificent executive residence!Horsley, 23 Armitage Avenue

• Fastidiously maintained brick veneer and tile residence with 2.7m high ceilings • Formal lounge and dining, spacious kitchen, breakfast room, family room & rumpus • Four double bedrooms, ensuite and walk in to robe main, built ins in all three• Fantastic triple garage with workshop, side access to rear yard • Quality fi xtures and fi ttings throughout plus a host of extras to numerous to mention

4 2 3

for sale $629,000View By AppointmentContact Ian Fitzgibbon 0418 333 149Email ian.fi [email protected] iD mmj.com.au/5P1063

Page 33: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

MMJ Dapto l 4261 [email protected]

hidden oasis - call to inspect calderwood, 102 Mellows Road

• Approximately 120 acres set at the foothills of the escarpment with stunning views• Located at the end of the street this property is private and truly impressive• Open prime pastures, tall cedar trees, rainforest walking tracks & permanent stream• Unique three bedroom family home with IG pool nestled unobtrusively into its local• Large machinery shed, spring fed water supply, 100% solar electricity, stunning

3 1 3

for sale $1,795,000View By AppointmentContact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1035

SIMPLY PERFECT - open this saturday ! horsley, 19 Kerang Court

• This home is immaculate, and located in a cul de sac location• The home feature’s formal lounge, defi ned formal dining• Spacious modern kitchen, rumpus or family room• 4 good bedrooms, with built ins, main ensuite & walk in robe• Quality cover entertaining area and a stunning in ground pool

4 2 2

for sale $459,900View Saturday 1.00-1.30Contact Ian Fitzgibbon 0418 333 149 Email ian.fi [email protected] iD mmj.com.au/5P1040

ITS IMPRESSIVE - open saturday!Horsley, 176 Bong Bong Road

• The home features a stunning formal lounge and formal dining room• 4 bedrooms all with built in robes (main ensuite and walk in robe) • Study, ducted air conditioning, modern kitchen quality appliances • Informal dining, family room and rumpus room, internal laundry• Double garage, drive thru access, private covered entertaining area.

4 2 2

for sale $519,900View Saturday 2.00-2.30Contact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1054

new price - open saturdayKANAHOOKA, 60 Angophora Crescent

• Situated in the security of Lakeline Village Estate• Air conditioned lounge room, separate dining area.• Spacious kitchen with ample cupboards• Two bedrooms, main with built in mirror robe.• Carport under main roof, loads of storage available

2 1 1

Contact Ian Fitzgibbon 0418 333 149 Email ian.fi [email protected] iD mmj.com.au/5P0957

For Sale $169,500View Saturday 11.00-11.30

new price - must inspect saturdaydapto, 2/21 Kent Road

• Great investment in a handy location close to CBD • 2 good sized bedrooms, main with large built-in robe • Modernise bathroom, kitchen & décor, open plan design• Currently leased to great tenants receiving $275 pw• Off street parking, small complex, low maintenance

2 1 0

Contact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1044

For Sale $239,900 View Saturday 10.00-10.30

this is massive - open saturday DAPTO, 3 Carlyle Close

• This home is certainly a surprise package, it has size and space.• Private entry foyer, huge formal lounge, open plan formal dining• Stunning modern kitchen, separate study or 5th bedroom, sunroom• Huge games room with kitchen and bathroom, separate rumpus room• Outside is a sparkling in ground pool for summer & beautiful views

5 3 2

for sale $609,900View Saturday 1.00-1.30Contact John Tisma 0409 612 000 Email [email protected] iD mmj.com.au/5P1014

IDEAL FAMILY HOME penrose, 22 Huntley Road

• Brick veneer and tile home on a landscaped low maintenance 650m2 block• Sunken lounge, separate ding and family area, modern kitchen• 4 bedrooms, main with ensuite & built in mirror robe, modern bathroom, separate toilet• Detached brick and tile double garage with additional off street parking• Fully screened and enclosed rear deck ideal for entertaining, side access available.

4 2 2

for sale $379,900View By AppointmentContact Ian Fitzgibbon 0418 333 149Email ian.fi [email protected] iD mmj.com.au/5P1059

LOW MAINTENANCE VILLADAPTO, 3/1 Yorkshire Road

• Well presented brick and tile villa, complex of only 3• Open plan lounge and dining, split system air conditioning• Well appointed kitchen with breakfast bar• Two generous size bedrooms, tiled bathroom, two toilets• Single garage with internal access, private courtyard

2 1 1

Contact Ian Fitzgibbon 0418 333 149 Email ian.fi [email protected] iD mmj.com.au/5P1058

For Sale $279,900 View By Appointment

GREAT START - OPEN SATURDAY!DAPTO, 2 Kundle Street

• The family home features a combined formal lounge and dining area• Spacious family room, front patio/sunroom, kitchen, internal laundry• 3 bedroom’s, possible 4th bedroom with a modifi cation to bedroom 2• There is a detached garage loads of room for a car & work benches• Kids retreat above garage, Entertaining area over looking level yard

4 1 1

Contact Alan Chaffers 4261 3822 Email [email protected] iD mmj.com.au/5P1049

For Sale $309,900 View Saturday 12.00-12.30

prestigious homeKANAHOOKA, 3 Orpheus Close

• Master built executive residence on 816m2 landscaped block.• Formal lounge, formal dining, timber kitchen, family room, rumpus • 4 bedrooms, master with e/s and wir, main bathroom with corner spa• Extended double garage, side access available• Outstanding views of lake and mountains, cul de sac location

4 2 2

Contact Ian Fitzgibbon 0418 333 149 Email ian.fi [email protected] iD mmj.com.au/5P1027

For Sale $675,000 View By Appointment

must sell this weekend!KANAHOOKA, 55 Edgeworth Avenue

• Take a look at this modern single level home in Kanahooka• The home features formal lounge, formal dining, family room• Modern kitchen & informal dining area, spacious bathroom• 4 bedrooms all with built in’s, main with ensuite walk in robe • Outdoor entertaining area and double garage with internal

4 2 2

Contact Ian Fitzgibbon 0418 333 149 Email ian.fi [email protected] iD mmj.com.au/5P0953

For Sale $469,900View Saturday 2.00-2.30

Page 34: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Live in or rent outcringila, 23 Dorman Street

• Maximise your investment - Potential dual income• Original condition with ample room for improvement• Centrally located, 10 min from Wollongong CBD• Ample storage and nice yard – You’d best hurry

3 2 1

Guide above $250,000View Saturday 10:00am - 10:20amContact Adam Martin 0408 411 723 [email protected] Luke Collins 0401 405 874 [email protected] Web iD mmj.com.au/6P1521

class actwindang, 86 Kruger Avenue

• Breathtaking family home in top location• A few minutes’ walk to Windang Beach• Open plan living with cool rear entertaining• Awesome property – WILL SELL QUICKLY!

4 2 3

Guide above $540,000View Saturday 11:50am - 12:10pmContact Adam Martin 0408 411 723 [email protected] Luke Collins 0401 405 874 [email protected] Web iD mmj.com.au/6P1520

Ocean Streetwindang, 78 Ocean Street

• Here’s your chance to buy into Windang• Original cottage in great solid condition• Great location with stacks of potential• Everyday could be a holiday - CALL NOW!

2 2 1

Contact Adam Martin 0408 411 723 Dimitty Tabor 0434 745 520Web iD mmj.com.au/6P1480

guide above $380,000 View By Appointment

First Property Or First Investment?windang, 2/232 Windang Road

• Great unit in complex of two close to Lake Illawarra• Single garage with sun drenched yard to boot• Wonderful investment opportunity currently at $270 pw• No better time to buy than today - hurry hurry

2 1 1

guide above $230,000 View By Appointment

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1389

You Won’t Be Disappointedunanderra, 156 Princes Highway

• Big home ready for moving in and or home business• Freshly painted throughout with beds up and down stairs• Large living, great floor and undercover entertaining area• Centrally located to all amenities - 10 mins to Wollongong• Great little money making investment at this price!

4 1 1

guide above $290,000 View By Appointment

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1379

Solid Investmentport kembla, 70 Darcy Road

• Rare Solid Investment Opportunity • Block of four 2 bedroom units• Top condition with yet more fantastic potential• Annual rental income of $42,900 - Below market!

4 x 2 4 4

guide above $630,000 View By Appointment

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1439

Looking To Develop?port kembla, 71 Donaldson Street

• Combined total area of 1256sqm (24.43/38.05X41.91/40.28)• Plot ratio of 0.5:1 - build 5 or 6 villas/townhouses• Prime land with view of Lake Illawarra & coastline• Great Government incentive for buyer’s buying new

3 1 OSP

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1362

guide above $490,000 View By Appointment

Top Spot!port kembla, 45 Parkes Street

• Superbly presented character filled residence• Big rooms, 2 bathrooms, high ceilings & Study area• Level landscaped yard & fitted garage (rumpus)• Only minutes from arguably South Coast’s best beach

3 2 1

guide above $340,000 View Saturday 10:40am - 11:00am

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1340

Revamped - Will Move Quick!port kembla, 1/55 Tobruk Avenue

• Located a few minutes walk to beach & Port Kembla pool• Tastefully revamped property with balcony and car space• Suburb becoming “hot spot”, attracting great prices• 5 mins to shopping hub and 10 min to Wollongong Central

2 1 1

guide above $220,000 View Saturday 11:10am - 11:30am

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1450

Smell The Sea Airlake illawarra, 1/74 Peterborough Ave

• Large 3 bedroom townhouse right by the beach• Huge bedrooms, spacious open plan kitchen & living• North facing courtyard/BBQ/entertaining area• 2nd bathroom downstairs and single lock up garage• 1 of 3 in complex, across the road from beach

3 2 1

guide above $330,000 View By Appointment

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1251

MMJ South l 4296 [email protected]

MMJ South l 4296 [email protected]

Tranquil Livingalbion park, 7 Jerrara Street

• State of the art character filled home in Tullimbar• Big open plan design with formal and informal areas• High ceilings and manicured gardens• Move straight in, with nothing left to do!

4 2 2

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1408

guide above $468,000 View By Appointment

BEACHSIDE HAVENport kembla, 15 Surfside Drive

• Huge home on huge block adjoining Port Beach Reserve• Character filled design with stacks of space & light• Splendid opportunity like no other. Come see yourself• EVERYDAY COULD BE A HOLIDAY! You’d best hurry

4 2 3

AUCTION 10:00am On-Site, Sat 30th March View By Appointment

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1503

Pristine Paradisewindang, 25 Ocean Street

• Quality family residence recently renovated to boot• Separate self-contained 2 bed accommodation• Entertainer’s delight internally and externally• You won’t regret looking at this property!!!

5 2 1

guide above $680,000 View Saturday 12:20pm - 12:40pm

Contact Adam Martin 0408 411 723 Dimitty Tabor 0434 745 520Web iD mmj.com.au/6P1506

Apartment Living At Its Bestlake illawarra, 5/78 Addison Avenue

• Modern development in quiet neighbourhood• Open plan 3 bedroom top floor unit with spunk• Large sun drenched balcony with sweeping views• Hop skip and a jump to our beautiful Lake’s Entrance

3 2 2

guide above $360,000 View By Appointment

Contact Adam Martin 0408 411 723 Luke Collins 0401 405 874Web iD mmj.com.au/6P1491

Page 35: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

MMJ Shellharbour City l 4256 [email protected]

new listing - open saturdayshellharbour, 34 Eastern Avenue

• Expansively proportioned & enjoying a tranquil position. Block 765.1m2 • This 1970’s home has been beautifully modernised with further room for

enhancement. Boasting 2 separate living areas & enormous chef’s kitchen• Perfect for entertaining, both indoors and out, mountain views and a leafy

outlook, wraparound balcony, easy care fl oors, ducted air conditioning• Prime location, walk to patrolled beach, fi ne dining, schools and more...

3-4 3 2

for sale $719,000View Saturday 1.00pm-1.30pmContact Deb Cummins 0412 426 495Email [email protected] iD mmj.com.au/8P1074

open saturdayoak flats, 1/82 Barton Street

• A quiet location, convenient to all amenities, minutes to shops & bus stop• A brick and tile 2 bedroom unit presented in IMMACULATE condition• Boasting a modern kitchen and bathroom/laundry, built-in robes, open plan

living and dining, ceiling fans and a lock up garage• Only 4 in the block making this a great opportunity to buy into popular Oak

Flats at an affordable price! Potential rent for investors: $270 per week!

2 1 1

for sale $249,000View Saturday 12.00pm-12.30pmContact Deb Cummins 0412 426 495Email [email protected] iD mmj.com.au/8P1069

open saturdayOAK FLATS, 117 The Boulevarde

• Enjoying a tranquil position in an exclusive waterfront location• Encompassed by a massive 1246m2 block, this spacious residence is

waterfront living at its best! Very convenient to schools, shops & transport• Beautifully presented with 3 separate living areas and home offi ce• Soak up stunning lake and escarpment views from the full width sun

soaked deck and swim in your own inground pool

4 2 2

for sale $732,000View Saturday 11.00am-11.30amContact Deb Cummins 0412 426 495Email [email protected] iD mmj.com.au/8P1060

only 4 left...don’t miss out!lake illawarra, Corner of Entrance St and Pur Pur Ave

• The only thing between you and the surf is the reserve

• Waterfront property - watch the sunrise daily

• Design your dream home in this sought after location (subject to council approval)

• Metres to Warilla Surf Club and boat ramp, walking distance to all amenities

Just a 5 minute drive to Stockland Shellharbour

for sale from $395,000View By AppointmentContact Deb Cummins 0412 426 495 [email protected] Mark De Cresci 0422 744 097 [email protected] iD mmj.com.au/8P1032

Page 36: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

A brilliant new beachside place to call home.easy living in warilla Warilla’s newest place to call home, Sunset Private Estate, will be a breath of fresh air to the already established community.

First Home Buyers save up to $30,000 Everyone Else saves up to $5,000

Home + Land Packages from $325,000

Subject to purchasers being eligible for selected Government Grants.

Register online nowwww.sunsetwarilla.com.au}more info?

Maurice bertapelle 0412 029 131

only 3left in stage 1

hurry !3

get better results at MMJfind out more. contact our team today

mmj.com.au

Page 37: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Thursday 28 to Wednesday 6 March

Albion Park 2527 10:00-10:30 Sat 173-175 Terry St Right Choice +61402084026 $525,000 H1:15-1:45 Sat 1/25 Yellow Rock Rd Professionals 0411 315 450 Fr $365,000 V1:20-1:40 Sat 4/72 Daintree Dr Doug.Harcourts 0414 490 595 $310,000 V2:00-2:20 Sat LOT/22 Wingello Tce Professionals 0411 315 450 $398,000 H10:30-11:00 Sun 5 Daintree Dr Doug.Harcourts 0405 454 624 $439,900 H11:30-12:00 Sun 5 Ashton Cl Doug.Harcourts 0405 454 624 $489,900 H12:30-1:00 Sun 1/72-74 Terry St Doug.Harcourts 0405 454 624 $259,900 V

Albion Park Rail 2527 10:30-11:00 Sat 9/30 Bateman Ave Coastside First 0411 306 323 $242,000 TWN11:15-11:45 Sat 20 Gow Ave LJ Hooker 0405 373 916 $319,000 H12:00-12:30 Sat 47 Kaylaur Cres PRDnationwide 0408 424 474 $329,950 H12:00-12:30 Sat 7 Shearwater Bvd Ray White 4271 4000 $360,000 - $410,000H12:30-1:00 Sat 135 Koona St Bevans 0412 424 226 O/A$799,000 H12:30-1:00 Sat 50 Maple St Bevans 4226 6222 O/A$309,000 H

Austinmer 2515 10:30-11:00 Sat 1/2a Headland Ave Urban 0409 368 247 $690,000 TWN11:45-12:15 Sat 44 Kirton Rd Bevans 0417 330 229 Auction H1:00-2:00 Sat 2 Kennedy Rd Ray White 0433 175 681 Auction H2:30-3:00 Sat 3/43 Mountain Rd Raine & Horne 0438684014 $499,000 V3:00-3:30 Sat 74 Mountain Rd Raine & Horne 0438684014 Exp of InterestH

Balgownie 2519 10:45-11:15 Sat 10b Terrell Pl MMJ North 0407 293 466 379,500 TWN11:00-11:30 Sat 11 Church St Peter Taranto 0417 124 313 $269,000 H12:00-12:30 Sat 6/43 Chalmers St Scholtens 0418 689 609 $455,000 TWN12:00-1:00 Sat 4 New Mount Pleasant Rd MMJ North 0412 425 801 $620,000 H3:00-3:45 Sat 3 Terrell Pl Peter Taranto 0418 627 220 $685,000 H

Barrack Heights 2528 2:30-3:00 Sat 7/4 Blackbutt Way Coastside First 0413 747 322 $229,000 U

Barrack Point 2528 11:30-12:00 Sat 8 Shell Cove Rd Bevans 0411 627 825 O/A$1,250,000H

Bellambi 2518 10:00-10:30 Sat 8/74 Cawley St Doug.Harcourts 0412 188 171 $289,000 V11:00-12:00 Sat 6/134 Rothery Rd LJ Hooker 0402 121 870 $219,000 U11:00-11:30 Sat 10/74 Cawley St Wiseberry 0414 539 699 $305,000 D11:00-11:30 Sat 1/26 Owen Park Rd Bevans 0402 083 446 O/A $299,000 V12:00-12:30 Sat 6/215-217 Rothery St Bevans 0402 083 446 O/A $349,000 U

Berkeley 2506 10:00-10:30 Sat 31 Nolan St PRDnationwide 0418 244 601 $390,000 - $420,000H10:00-10:30 Sat 289 Northcliffe Dr Scholtens 0418 689 609 $369,000 H11:00-11:30 Sat 79 Nottingham St Park Trent 4229 1655 $319,000 H11:00-11:30 Sat 14 Osprey Dr Master 0434 970 439 $429,000 H12:00-12:45 Sat 76 Essex St Right Choice +61402084026 $299,000 V12:00-12:45 Sat 17 Oliver Pl Codina 0418 421 600 $389000 H12:30-12:50 Sat 1B York St Professionals 0411 315 450 $699,000 H1:00-1:30 Sat 546 Nothcliffe Dr Ray White 4271 4000 $275,000 - $305,000H1:00-1:30 Sat 217 Nolan St Raine & Horne 0419 991 500 $395,000 H1:00-1:30 Sat 22 Holborn St L J Hooker 0411 713 523 Auction H

Blackbutt 2529 10:00-11:00 Sat 1-24/1001 Albatross Dr Bevans 0412 424 226 From $399,000 U11:15-11:45 Sat 89 Chillawong Cct McPhail 0410 868 632 $390,000 H11:30-12:00 Sat 2/40 College Ave Bevans 0412 424 226 O/A $369,000 TWN

Bulli 2516 10:00-10:30 Sat 74 Hospital Rd Bevans 0404 003 882 O/A $630,000 H10:45-11:30 Sat 41 Hospital Rd Bevans 4226 6222 Auction H2:00-2:30 Sat 59 George Ave Bevans 4226 6222 Auction H

Clifton 2515 11:30-12:00 Sat 346 Lawrence Hargrave Dr Urban 4267 3311 $680,000 H

Coniston 2500 11:00-11:45 Sat 2/15 Myrtle St Clayton R/E 4226 1074 $329,000 U11:00-12:00 Sat 3/40 Bridge St Huxley 0409 299 407 $289,000 U11:45-12:15 Sat 2/13 Pine Cres Doug.Harcourts 4229 8255 $215,000 - $225,000U1:00-1:30 Sat 3/44 Bridge St Right Choice +61402084026 $189,500 U

Cordeaux Heights 2526 10:00-10:30 Sat 7 Deenyi Cl Ray White 4271 4000 Auction H12:00-12:30 Sat 73 Derribong Dr Ray White 4271 4000 $430,000 - $465,000 H12:00-12:30 Sat 31 Kooranga Cres Ray White 4271 4000 $489,000 H12:00-12:30 Sat 23 Staff Rd Raine & Horne 0419 991 500 $530,000 H

1:00-1:30 Sat 51 Taminga Cres O’Connor 0416 266 055 $799,000 H1:00-1:30 Sat 41 Coachwood Dr Ray White 4271 4000 $390,000-$420,000 H1:00-1:30 Sat 7 Deenyi Cl Ray White 4271 4000 Auction H

Corrimal 2518 10:30-11:00 Sat 4/28 Thurston Cres MMJ North 0424 248 165 $195,000 U11:00-11:30 Sat 55 Underwood St Doug.Harcourts 0411 385 833 Auction H11:00-12:00 Sat 6/20 Jones Pl Huxley 0414 428 401 $349,000 U11:00-12:00 Sat 4/20 Jones Pl Huxley 0414 428 401 $289,000 U12:00-1:45 Sat Unit 1/273 Rothery St MMJ North 0412 421 214 $480,000 - $500,000 TWN12:00-12:30 Sat 5 Robson St Doug.Harcourts 0412 188 171 $499,000 H1:00-1:30 Sat 32 Thurston Cres Doug.Harcourts 0412 188 171 Exp of Interest H1:00-1:30 Sat 3/15 Underwood St MMJ North 0412 424 071 $320,000 - $360,000 TWN1:00-1:30 Sat 15/3 Mountbatten St Bevans 0401 675 077 O/A$530,000 V

Corrimal East 2518 11:15-12:00 Sat 8/102 Cawley Rd MMJ North 0412 425 801 $249,000 U2:15-2:45 Sat 88A Murray Rd Peter Taranto 0403 618 988 O/A$350,000 H

Cringila 2502 10:00-10:20 Sat 23 Dorman St MMJ 0408 411 723 O/A$250,000 H11:00-11:30 Sat 41 Newscastle St Master 0410 418 680 O/A$299,000 H

Dapto 2530 10:00-10:30 Sat 88 Parkside Dr PRDnationwide 4261 0333 $310,000 - $340,000 H10:00-10:30 Sat 52 North Tce O’Connor 0416 266 055 $469,000 H10:00-10:30 Sat Unit 2/21 Kent Rd MMJ 0409 612 000 $239,900 U10:00-10:30 Sat 93 Compton St Bevans 0413 148 509 O/A $362,000 H10:45-11:15 Sat 27 Melaleuca Ave PRDnationwide 4261 0333 $320,000 - $350,000 H11:00-11:20 Sat 5 Kapooka Ave Doug.Harcourts 0422 244 098 $359,000 H11:00-11:30 Sat 5 Avonlea St PRDnationwide 0408 424 474 $329,000 H11:00-11:30 Sat 56 Emerson Rd MMJ 0409 612 000 $369,900 H11:00-11:20 Sat 8 Prince Edward Dr Doug.Harcourts 0414 490 595 $329,000 H11:00-11:30 Sat 25 Bright Pde MMJ 0400 002 255 $389,900 H11:40-12:00 Sat 81 Byamee St Doug.Harcourts 0413 097 710 $330,000 H11:40-12:00 Sat 36 Parkside Dr Doug.Harcourts 0422 244 098 $335,000 H12:00-12:30 Sat 1/65-67 Mount Brown Rd Ray White 4271 4000 $360,000 - $410,000 V12:00-12:30 Sat 64 Laver Rd PRDnationwide 0418 244 601 $365,000 H12:00-12:30 Sat 2 Kundle St MMJ 0400 002 255 $309,900 H12:00-12:30 Sat 2/19 Baan Baan St MMJ 0418 333 149 $325,000 TWN12:00-12:30 Sat 2 Shiraz Dr MMJ 0416283876 O/A $399,000 H12:15-12:45 Sat 125 Burke Rd LJ Hooker 0468 944 961 $350,000 - $370,000 H12:20-12:40 Sat 18 Craig Cres Doug.Harcourts 0413 097 710 $360,000 H12:30-1:00 Sat 7 Kapooka Ave Coastside First 0411 306 323 O/A $400,000 H12:30-1:00 Sat 55 Compton St Ray White 0422 050 392 $299,000-$319,000 H1:00-1:30 Sat 3 Carlyle Cl MMJ 0400 002 255 $609,900 H1:15-1:45 Sat 77 Compton St Peter Taranto 4228 1622 $329,000 H1:30-2:00 Sat 9 Chardonnay Ave Coastside First 0423 507 488 $448,000 H2:00-2:30 Sat 1/78 Byamee St Right Choice +61402084026 $255,000 TWN2:00-2:30 Sat 1/65-67 Mount Brown Rd Ray White 4271 4000 $360,000 - $410,000 V2:30-3:00 Sat 12 Unara Rd PRDnationwide 0418 244 601 $320,000 - $350,000 H9:30-10:00 Sat 4 Hermitage Pl LJ Hooker 0405 373 916 O/A$580,000 H

East Corrimal 2518 11:00-11:45 Sat 37 Murray Rd AM Rutty 4229 6311 $529,950 H12:00-12:30 Sat 110 Murray Rd Clayton R/E 0421 304 248 $659,000 H3:00-3:30 Sat 2 Thalassa Ave Bevans 0402 083 446 Auction H

Fairy Meadow 2519 11:00-11:45 Sat 29 Fairy Ave MMJ North 0412 421 214 $460,000 - $490,000 H12:00-12:40 Sat 21/192-198 Princes Hwy Southern Estate 0416 089 884 $274,000 U1:00-1:30 Sat 174 Princes Hwy Clayton R/E 0417 041 603 $394,000 H1:00-1:30 Sat 12/31-33 Princes Hwy Peter Taranto 0414 977 711 $379,000 U

Farmborough Heights 2526 10:00-10:30 Sat 22 Aminya Pl Ray White 4271 4000 $380,000 H11:00-11:30 Sat 2 Stanley Ave O’Connor 0416 266 055 $399,000 H11:00-11:30 Sat 91 Panorama Dr Raine & Horne 0419 991 500 $375,000-$385,000 H12:45-1:15 Sat 75 Waples Rd Doug.Harcourts 4229 8255 O/A $319,000 H2:00-2:30 Sat 91 Panorama Dr Raine & Horne 0419 991 500 $375,000-$385,000 H3:00-3:30 Sat 275 Farmborough Rd Ray White 4271 4000 $430,000 H5:00-5:30 Thu 22 Aminya Pl Ray White 4271 4000 $380,000 H

Fees, charges and lending criteria apply. Terms and conditions available on request. Different rates apply to other loan products and fixed rate periods. These rates are current as at 11 February 2013 and are available to new and existing customers who meet RAMS’ eligibility criteria. RAMS will apply the fixed rate that is available at the loan settlement date or the date the fixed rate period commences, unless the customer locks a fixed rate in on the loan using our rate lock feature. The rate lock fee is 0.15% of the fixed loan amount. Existing applicants who have locked in rates prior to 11 February 2013 will receive the rate at which they locked in. At the end of the fixed rate period, the interest rate will convert to the variable interest rate applicable on the day. For new customers on the Fixed Rate Home Loan, this will be the Standard Variable Rate. *This comparison rate is based on a $150,000 RAMS Fixed Rate Home Loan over a term of 25 years. WARNING: This comparison rate is true only for the examples given and may not include all fees and charges. Different terms, fees or other loan amounts might result in a different comparison rate. RAMS Home Loans Wollongong is owned and operated by Wollongong Financial Services Pty Ltd ABN 82 108 210 804. Credit provider: Westpac Banking Corporation ABN 33 007 457 141 AFSL and Australian credit licence 233714

Busy? No problem we’ll come to you. So call RAMS today! Call 13 RAMS or jump online.RAMS Home Loans Wollongong: Wollongong – 4229 5455 Dapto – 4261 3200RAMS.com.au

6.49% p.a.Comparison Rate*

4.99% p.a.RAMS Fixed Rate Home Loan – 1 year rate

RAMS can fix your rate!

Page 38: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Thursday 28 to Wednesday 6 March

Figtree 2525 10:00-10:30 Sat 13 Darragh Dr Park Trent 4229 1655 O/A$420,000 V10:00-10:30 Sat 102 Bellevue Rd MMJ 0416283876 O/A$399,000 H10:30-11:00 Sat 12 Zelang Ave Coastside First 0411 306 323 $438,000 H11:00-11:30 Sat 39 Valley Dr Raine & Horne 0419 991 500 $499,000-$529,000 H11:00-11:30 Sat 10 Cranford Lane Ray White 4271 4000 Auction H11:30-12:15 Sat 110 O’briens Rd Ray White 0422 050 392 $539,000-$579,000 H12:00-12:30 Sat 18 Herne St Peter Taranto 0417 124 313 $479,000 H12:00-12:40 Sat 230 O’Briens Rd Peter Taranto 0411 754 884 $1,299,000 H12:15-1:00 Sat 64 Bellevue Rd Peter Taranto 0418 627 220 $495,000 H12:15-1:00 Sat 48 Risley Rd MMJ North 0412 425 801 $325,000 - $355,000 H1:00-1:30 Sat 39 Valley Dr Raine & Horne 0419 991 500 $499,000-$529,000 H3:00-3:30 Sat 10 Cranford Lane Ray White 4271 4000 Auction H

Flinders 2529 10:00-10:30 Sat 17 Meroo Cl LJ Hooker 0404 497 521 $449,000 C/H10:00-10:30 Sat 19 Meroo Cl LJ Hooker 0404 497 521 $449,000 C/H11:00-11:30 Sat 9 Conjola Cl Bevans 0409 969 202 O/A$620,000 H11:15-11:45 Sat 33 Byron Cct LJ Hooker 0405 373 916 $579,999 H12:00-12:30 Sat 17 Yarle Cres Right Choice +61402084026 $559,000 H

Gerringong 2534 12:00-12:45 Sat 177 Toolijooa Rd Ray White 0407 126 077 Auction H

Gwynneville 2500 11:00-11:20 Sat 135 Gipps Rd Professionals 0411 315 450 $549,000 H11:00-11:30 Sat 2 Paulsgrove St Ray White 4271 4000 Auction H12:00-12:30 Sat 41 Lucinda St MMJ 0416283876 $499,000 H1:30-2:00 Sat 35 Eastern St Peter Taranto 0417 124 313 $585,000 H10:30-11:00 Sun 2 Paulsgrove St Ray White 4271 4000 Auction H

Haywards Bay 2530 1:00-1:30 Sat 19 Riverside Cres PRDnationwide 0408 424 474 $595,000 H2:00-2:30 Sat 16 Bayview Ave PRDnationwide 0418 244 601 $655,000 - $685,000 H

Helensburgh 2508 10:00-10:30 Sat 28 Halls Rd Bevans 4294 3699 $639,000 H1:00-1:30 Sat 4 Old Station Rd Bevans 4294 3699 O/A $490,000 H2:00-2:30 Sat Unit 4/33 Stuart St Bevans 4294 3699 O/A $390,000 V

Horsley 2530 10:00-10:30 Sat 7 Yeldah Dr PRDnationwide 0408 424 474 $387,000 H11:00-11:30 Sat 28 Highland Park Dr Bevans 0413 148 509 O/A $339,000 H11:45-12:15 Sat 38 Ritchie Cres PRDnationwide 4261 0333 $390,000 - $410,000 H12:00-12:30 Sat 6 Greenbrook Pl MMJ 0438 613 822 $335,000 H12:00-12:30 Sat 77 Shone Ave Bevans 0402 083 446 O/A $990,000 H1:00-2:00 Sat 13 Ashwood Pl Scholtens 0418 689 609 O/A $465000 H1:00-1:30 Sat 48 Huxley Dr MMJ 0418 425 443 $439,900 H1:00-1:20 Sat 12 Glengarry Way Doug.Harcourts 0414 490 595 $510,000 - $550,000 H1:00-1:30 Sat 19 Kerang Ct MMJ 0400 002 255 $459,900 H1:30-2:15 Sat 7 Galway Ct Peter Taranto 0418 627 220 $445,000 H1:45-2:15 Sat 14 Riverpark Way PRDnationwide 0418 244 601 $435,000 - $465,000 H2:00-2:30 Sat 2/6 Horsley Dr Right Choice +61402084026 $249,950 V2:00-2:30 Sat 176 Bong Bong Rd MMJ 0400 002 255 $519,900 H

Kanahooka 2530 10:30-11:00 Sat 245 Kanahooka Rd Bevans 0412 424 226 O/A $349,000 H11:00-11:30 Sat 60 Angophora Cres MMJ 0418 333 149 $169,500 H12:00-12:30 Sat 13 William Beach Rd MMJ 0409 612 000 $359,900 H12:00-12:30 Sat 40 Edgeworth Ave Peter Taranto 0403 618 988 $395,000 H1:00-1:30 Sat 167 Kanahooka Rd LJ Hooker 0402 844 636 $325,000 - $340,000 H1:00-1:30 Sat 6 Grantham Cl MMJ 0438 613 822 $479,900 H2:00-2:30 Sat 55 Edgeworth Ave MMJ 0400 002 255 $469,900 H

Keiraville 2500 10:30-11:00 Sat 2 Georgina Ave Peter Taranto 0429 809 856 $569,000 H11:00-11:40 Sat 3/48 Robsons Rd Southern Estate 0424 372 722 $289,000 U11:00-12:00 Sat 7/29 Robsons Rd Scholtens 0418 689 609 $559,000 TWN11:15-11:45 Sat 27 Dallas St Peter Taranto 0429 809 856 $689,000 H12:00-12:30 Sat 12 Bell St Bevans 4226 6222 Auction H11:15-11:45 Sun 27 Dallas St Peter Taranto 0429 809 856 $689,000 H

Kiama 2533 10:30-11:00 Sat 152 Terralong St Doug.Harcourts 0412 638 708 Auction TWN11:00-11:30 Sat 27b Bland St Ray White 0414 898 237 $439,000 TWN11:00-11:30 Sat 111 Bland St Ray White 0409 461 756 Auction H11:00-11:30 Sat 5/126 Terralong St Ray White 0402 047 414 Red $329,000 U12:00-12:45 Sat 4 Adina Ave Ray White 0402 047 414 Auction H12:00-12:30 Sat 4/115 Manning St Ray White 0414 898 237 O/A $620,000 TWN

12:00-12:45 Sat 93 Manning St Raine & Horne 0408 641 623 Auction H12:00-12:45 Sat 42 Banksia Dr Raine & Horne 0450 099 227 $769,000 H12:45-1:15 Sat 3/113 Manning St Ray White 0407 126 077 $539,000 TWN1:00-1:30 Sat 10 Coachwood St Ray White 0402 047 414 $449,000 TWN1:00-1:45 Sat 12 Noorinan St Raine & Horne 0450 099 227 $619,000 H1:15-1:45 Sat 84 Minnamurra St Ray White 0412 763 077 $659,000 H1:30-2:00 Sat 49 Minnamurra St Ray White 0407 126 077 $540,000 TWN1:30-2:00 Sat 67 Marsden St Ray White 0414 898 237 $575,000 H2:00-2:30 Sat 14/130 Shoalhaven St Doug.Harcourts 0412 638 708 $365,000 V2:00-2:45 Sat 18 Chapman St Raine & Horne 0450 099 227 Auction H2:00-2:30 Sat 1 Spring Creek Dr Bevans 4296 6055 O/A$820,000 H12:00-12:30 Sun 166 Manning St Ray White 0407 126 077 $649,000 H12:45-1:15 Sun 3/113 Manning St Ray White 0407 126 077 $539,000 TWN2:00-2:30 Sun 1 Spring Creek Dr Bevans 4296 6055 O/A$820,000 H

Kiama Downs 2533 10:00-10:45 Sat 33 Johnson St Raine & Horne 0450 099 227 Auction H10:00-10:30 Sat 13 Flinders Ave Ray White 0409 461 756 $499,000 H11:00-11:30 Sat 8 Holt St Ray White 0412 763 077 $899,000 H11:00-11:45 Sat 11 Hoolong Ave Raine & Horne 0450 099 227 $699,000 H12:00-12:30 Sat 38 Newing Cct Ray White 0409 461 756 $599,000 H12:30-1:00 Sat 34 Alexander Ave Doug.Harcourts 0412 271 091 $530,000 H12:30-1:00 Sat 17 Oxley Ave Ray White 0412 763 077 $439,000 H1:00-1:30 Sat 5 Elliott Pl Doug.Harcourts 0412 638 708 O/A $600,000 H1:00-1:45 Sat 31 Flinders Ave Raine & Horne 0408 641 623 $485,000 H1:30-2:00 Sat 38 Eureka Ave Doug.Harcourts 0412 271 091 $1,150,000 H2:00-2:30 Sat 2/29 Tarrant Ave Ray White 0409 461 756 $330,000 TWN

Kiama Heights 2533 11:00-11:30 Sat 90 Attunga Ave Ray White 0409 461 756 $689,000 H12:00-12:30 Sat 48 Kalang Rd Ray White 0409 461 756 P.O.A H12:00-12:30 Sat 29A South Kiama Dr Doug.Harcourts 0412 638 708 Auction H1:00-1:45 Sat 50 South Kiama Dr Ray White 0409 461 756 $535,000 H

Koonawarra 2530 10:15-10:45 Sat 31 Eleebana Cres LJ Hooker 0405 373 916 Redto $339,000 H11:00-11:30 Sat 8 Balarang Pl PRDnationwide 0418 244 601 $300,000 - $320,000 H11:30-12:00 Sat 19 Culgoa Cres Coastside First 0423 507 488 $279,000 H12:20-12:40 Sat 9B Gilba Rd Doug.Harcourts 0422 244 098 $339,000 H1:00-1:30 Sat 9 Kurrawa Cres PRDnationwide 4261 0333 $315,000 - $330,000 H

Lake Heights 2502 10:30-11:00 Sat 7 Barina Ave Professionals 0411 315 450 $429,000 H10:30-11:00 Sat 364 Northcliffe Dr Master 0409 810 800 O/A 389000 H12:00-12:45 Sat 262 Northcliffe Dr Park Trent 4229 1655 O/A$399,000 H9:30-10:00 Sat 71 Lake Heights Rd Professionals 0411 315 450 $299,000 H9:45-10:15 Sat 39 Hassan St Master 0419 461 187 O/A $350,000 H

Lake Illawarra 2528 11:00-11:30 Sat 140 Pur Pur Ave Ray White 4271 4000 Auction H2:00-2:30 Sat 99 Reddall Pde Ray White 4271 4000 $315,000 - $345,000 H3:00-3:30 Sat 140 Pur Pur Ave Ray White 4271 4000 Auction H

Mangerton 2500 11:00-12:00 Sat 3 Walter St Laing + Simmons 0421 307 664 Auction H11:30-12:00 Sat 10 Payne St Coastside First 0411 306 323 $443,000 H11:40-12:00 Sat 10a McArthur Pde Professionals 0411 315 450 $739,000 H12:00-12:30 Sat 79 St John’s Ave L J Hooker 0408 422 864 $499,900 H12:15-12:45 Sat 42 McAndrew Cres Peter Taranto 0429 809 856 $629,000 H12:30-1:30 Sat 13/1 Mangerton Rd Huxley 0409 299 407 $265,000 U12:30-1:00 Sat 3 Phillips Cres Professionals 0411 315 450 $469,000 H12:15-12:45 Sun 42 McAndrew Cres Peter Taranto 0429 809 856 $629,000 H

Minnamurra 2533 11:45-12:15 Sat 11 The Vlge Ray White 0412 763 077 $595,000 H

Mount Keira 2500 11:00-11:30 Sat 129 Koloona Ave Bevans 4226 6222 O/A$549,000 H11:30-12:00 Sat 56 Morandoo Ave Professionals 0411 315 450 O/A $439,000 H1:00-1:30 Sat 2 Balook St O’Connor 0414 946 000 $579,000 H2:15-2:45 Sat 6 Parkman Pl Peter Taranto 0429 809 856 $699,000 H

Page 39: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Thursday 28 to Wednesday 6 March

Purchasing or Refinancing?Not all lenders are the same and it can be very confusing.

Let my 25 years lending experience help you find the right home loan

4296 8888

Mount Kembla 2526 10:00-10:30 Sat 10 Bradley Ave O’Connor 0416 266 055 $390,000 H2:00-2:30 Sat 315 Cordeaux Rd McPhail 0412 422 294 $395,000 H

Mount Ousley 2519 1:00-1:30 Sat 19 Greenslopes Ave Doug.Harcourts 0412 188 171 $479,000 H

Mount Pleasant 2519 11:00-11:30 Sat 49 Ramah Ave Ray White 4271 4000 Auction H2:00-2:30 Sat 49 Ramah Ave Ray White 4271 4000 Auction H11:30-12:00 Sun 49 Ramah Ave Ray White 4271 4000 Auction H

Mount Saint Thomas 2500 10:30-11:00 Sat 107-109 The Ave L J Hooker 0408 422 864 Auction H11:45-12:15 Sat 53 Taronga Ave Peter Taranto 0411 754 884 $375,000 H12:00-12:30 Sat 44 Ocean St Peter Taranto 0418 627 220 $395,000 H

Mount Warrigal 2528 11:00-11:30 Sat 28 Henricks Pde Right Choice +61402084026 $429,000 H2:00-2:20 Sat 97 Cuthbert Dr Doug.Harcourts 0422 244 098 $395,000 H

North Wollongong 2500 10:00-10:30 Sat 9/58 Bourke St Professionals 0411 315 450 O/A$349,000 U10:00-10:45 Sat 54/7-9 Corrimal St AM Rutty 0408 424 155 $219,000 U11:00-11:45 Sat 7/42-44 Cliff Rd AM Rutty 0408 424 155 $725,000 U1:00-1:40 Sat 8/6 Virginia St Southern Estate 0416 089 884 Auction U

Oak Flats 2529 10:00-10:30 Sat 2/22 David Ave Clayton R/E 4226 1074 $189,000 U11:00-11:30 Sat 5/55 The Boulevarde Peter Taranto 0414 977 711 $609,000 V11:00-11:30 Sat 117 The Boulevarde MMJ 0412 426 495 $732,000 H12:00-12:30 Sat Unit 1/82 Barton St MMJ 0412 426 495 $249,000 U1:00-1:45 Sat 33 The Esp Ray White 0409 461 756 Auction H

Port Kembla 2505 10:00-10:45 Sat 54 Bland St Park Trent 0415 112 702 $339,000 H10:40-11:00 Sat 45 Parkes St MMJ 0408 411 723 O/A$340,000 H11:00-11:30 Sat 1 Dovers Dr Peter Taranto 0411 754 884 $530,000 H11:10-11:30 Sat Unit 1/55 Tobruk Ave MMJ 0408 411 723 O/A$220,000 U11:30-12:00 Sat 30 Perth Rd One Agency 0415 424 257 AUCTION H12:00-12:30 Sat 22 Third Ave L J Hooker 0411 713 523 Auction H1:00-1:30 Sat 201 Wentworth St Domain First Na 0412 717 444 $239,000 H1:15-1:45 Sat 128 Military Rd Peter Taranto 0418 627 220 $399,000 H1:30-2:00 Sat 2/173 Wentworth St Coastside First 0413 747 322 O/A $185,000 U

Primbee 2502 11:00-11:45 Sat 7a Overhill Rd MMJ North 0412 425 801 $389,950 H11:00-11:45 Sat 176 Lakeview Pde Park Trent 0415 112 702 O/A $430,000 H

Russell Vale 2517 11:00-11:30 Sat 78 Collaery Rd Bevans 0411 854 785 O/A$529,000 H

Shell Cove 2529 10:00-10:30 Sat 10 Makaha Way Ray White 4271 4000 Auction H11:30-12:00 Sat 5 Edgecombe Ct Bevans 0412 424 226 O/A$689,000 H12:30-1:00 Sat 12 Bribie Ave Bevans 0412 424 226 O/A$629,000 H2:00-2:30 Sat 10 Makaha Way Ray White 4271 4000 Auction H1:30-2:00 Sun 10 Makaha Way Ray White 4271 4000 Auction H

Shellharbour 2529 1:00-1:30 Sat 34 Eastern Ave MMJ 0412 426 495 $719,000 H

Stanwell Park 2508 11:00-11:30 Sat 13 Sheridan Cres Bevans 4294 3699 $759,000 H5:30-6:00 Wed 24a Station St Bevans 4294 3699 Auction H1:00-1:30 Sun 24a Station St Bevans 4294 3699 Auction H

Tarrawanna 2518 12:00-12:30 Sat 18 Brissendon Cl O’Connor 0416 266 055 $760,000 H1:00-1:30 Sat 2/79 Meadow St Bevans 0488 877 355 O/A$275,000 TWN1:15-1:45 Sat 42 Brooker St LJ Hooker 0405 373 916 $690,000 - $715,000 H

Thirroul 2515 10:15-10:45 Sat 124 Phillip St Bevans 0409 969 032 Auction H10:30-11:00 Sat 393-395 Lawrence Hargrave Dr Bevans 0401 675 077 Auction H11:00-11:45 Sat 50a Pass Ave Ray White 0433 175 681 $675,000 H11:30-12:00 Sat 476 Lawrence Hargrave Dr Bevans 0401 675 077 Auction H12:00-1:00 Sat 57 Armagh Pde Ray White 0433 175 681 $595,000 H12:00-12:45 Sat 5 The Waves NA Ray White 0433 175 681 $685,000 H12:30-1:00 Sat 55 Armagh Pde Raine & Horne 0402 021 527 $699,000 H1:00-1:30 Sat 9 Hewitts Ave Wiseberry 0414 539 699 $680,000-$700,000H

2:00-2:45 Sat 5/10 The Esp MMJ North 0412 626 964 $475,000 U2:30-3:00 Sat 7/18-22 Harbord St L J Hooker 0411 713 523 Auction TWN

Towradgi 2518 10:30-11:00 Sat 17/42 Carters Lane Huxley 0408 423 051 $379,000 TWN11:00-11:45 Sat 1 Juanita Ave McPhail 0412 422 294 Auction H12:00-12:30 Sat 63 Murranar Rd MMJ North 0412 424 071 O/A$640,000 H

Tullimbar 2527 10:15-11:00 Sat 34 Broughton Ave Doug.Harcourts 0405 454 624 Auction H6:00-6:30 Thu 34 Broughton Ave Doug.Harcourts 0405 454 624 Auction H

Unanderra 2526 11:00-11:30 Sat 26 Stratford Rd Raine & Horne 4229 9600 $265,000-$295,000 H11:00-11:30 Sat 13 Coral Cres MMJ 0416283876 O/A $349,000 H12:30-1:00 Sat 2/46 Central Rd Coastside First 0423 507 488 $359,000 U1:00-1:30 Sat 1 Coral Cres L J Hooker 0408 422 864 $445,000 H1:00-1:30 Sat 47 Blackman Pde ARRE 0418 423 636 $349,950 H

Warilla 2528 10:00-10:30 Sat 24/1 Sparta Ave Peter Taranto 0417 124 313 $309,000 V1:30-2:00 Sat 2/57 Lake Entrance Rd Ray White 0422 050 392 $199,000 U

Warrawong 2502 10:00-10:30 Sat 6 Second Ave Master 0410 418 680 $520,000 H11:00-11:30 Sat 2/23 First Ave Clayton R/E 0421 304 248 $187,000 U11:00-11:30 Sat 159 Flagstaff Rd Codina 0418 421 600 $319,000 H9:00-9:30 Sat 24 Third Avenue North Ave Master 0419 461 187 $0 H11:00-11:30 Sun 159 Flagstaff Rd Codina 0418 421 600 $319,000 H

West Wollongong 2500 10:00-10:30 Sat 3/24 Fisher St Ray White 0433 175 681 $549,000 T10:30-11:00 Sat 1 Buckle Cres One Agency 0415 424 257 Auction BLK12:00-12:30 Sat 46 London Dr Ray White 4271 4000 $429,000 H

Windang 2528 10:15-10:45 Sat 2 Boundary Rd McPhail 0410 868 632 $495,000 H11:50-12:10 Sat 86 Kruger Ave MMJ 0408 411 723 O/A$540,000 H12:00-12:30 Sat 99 Ocean St Raine & Horne 0419 991 500 $599,000-$620,000 H12:20-12:40 Sat 25 Ocean St MMJ 0408 411 723 O/A$680,000 H

Wollongong 2500 10:00-10:40 Sat 3/8 Gilmore St Southern Estate 0424 372 722 $439,000 TWN10:00-10:30 Sat 24/48 Smith St Doug.Harcourts 0408 422 644 $310,000 U10:00-10:30 Sat 7/26 Market St Peter Taranto 4228 1622 $389,000 U10:00-10:20 Sat 11/54 Church St Doug.Harcourts 0413 097 710 $335,000 U10:00-4:00 Sat 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $345,000 U10:00-10:30 Sat 52/59-67 Corrimal St Ray White 4271 4000 $879,000 U10:30-11:00 Sat 9/35 Corrimal St Cooper & Cooper 0414 912 288 $319,000 U11:00-11:30 Sat 58/3-15 Belmore St Doug.Harcourts 4229 8255 O/A $699,000 U11:00-11:30 Sat 79/22-26 Corrimal St Bevans 0404 003 882 Auction U11:00-11:30 Sat 18/71-83 Smith St MMJ 0418 423 782 $460,000 U11:00-11:30 Sat 60/60-62 Harbour St Peter Taranto 4228 1622 O/A $669,000 U11:00-11:30 Sat 22/80-84 New Dapto Rd Peter Taranto 0418 627 220 $399,500 U11:15-11:45 Sat 6/2-12 Young St Master 0419 461 187 O/A$400,000 U11:45-12:15 Sat 43/59-67 Corrimal St Peter Taranto 0417 124 313 $675,000 U12:00-12:30 Sat 7/2-12 Young St O’Connor 0416 266 055 $425,000 U12:00-12:45 Sat 5/6 Parkside Ave AM Rutty 0408 424 155 $250,000 U12:00-12:30 Sat 4/46-48 Corrimal St McPhail 0412 422 294 $519,000 U12:30-1:00 Sat 12/9-13 Smith St One Agency 0415 424 257 Over $690,000 U12:45-1:15 Sat 181 Church St Ray White 0422 050 392 Auction H1:00-1:30 Sat 15/10 Market Pl O’Connor 0416 266 055 Auction U1:00-1:30 Sat 3/21 Market St O’Connor 0416 266 055 $340,000 U1:00-1:30 Sat 5/27 Campbell St McPhail 0412 422 294 $329,000 U1:00-1:45 Sat 7/53 Corrimal St AM Rutty 0408 424 155 $275,000 U2:00-2:30 Sat 5/78-82 Campbell St MMJ 0408 944 434 $469,000 U2:00-2:30 Sat 31/59-67 Corrimal St O’Connor 0414 946 000 $669,000 U2:00-2:30 Sat 58/3-15 Belmore St Doug.Harcourts 4229 8255 O/A$699,000 U10:00-5:00 Fri 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $345,000 U10:00-5:00 Thu 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $345,000 U10:00-8:00 Wed 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $345,000 U10:00-5:00 Tue 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $345,000 U10:00-5:00 Mon 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $345,000 U10:00-4:00 Sun 22-32 Gladstone Ave Clayton R/E 0414 271 444 From $345,000 U

Page 40: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Published by WEBSTAR PRINTING1/83 Derby Street, Silverwater NSW 2128

Advertising enquiries to 1300 137 161The Publisher does not accept any responsibilitiyfor the information provided in this magazine.2A/175 James Ruse Drive Rosehill NSW 2142

Gracing the upper two levels of this newly completed boutique development are your choice of two, three bedroom penthouse apartments representing harbour side living at its most exclusive. With a fusion of world class design elements, aspire to the grand lifestyle on offer. Emphasising gracious living in its finest form, enormous wrap around alfresco dining sprawling across one whole level, all crowned by a sunlit rooftop entertainers terrace. Pure opulence designed to take full advantage of uninterrupted panoramic water views across Shellharbour beaches and along the Southern Illawarra Coastline. Live the highlife enjoying a superb combination of luxury and elegance in equal measure with breathtaking never to be built out views and state of the art finishes all in a relaxed resort like property. This special offering is sure to impress buyers looking for the best in waterfront living, an enviable lifestyle in a premier coastal locale with the convenience of the harbour, beaches, boat ramps, cafes, shopping village and fine dining at your doorstep.

Harbourside Extravagance - Indulge in a new standard of luxury living.

WHERE: INSPECT: CONTACT:Units 3 & 4, 3 Wollongong Street, Shellharbour Exclusive viewing by appointment only Martin Merritt: 0412 424 226AGENT: PRICE: [e] [email protected] Shellharbour - 4296 5111 Price guide above $2m.

SHELLHARBOUR VILLAGE

Presenting this family home with sylvan setting, modern kitchen and in ground pool with distant ocean views. There are three good size bedrooms upstairs with a large area suitable as a parent or teenagers retreat.A spa bathroom is off the downstairs retreat plus storage, good bones and peaceful setting on a good 910 square metre serene block.With great potential to improve this area there is little to do but move in and enjoy the lifestyle of the Northern Burbs.This is a good family home and is well priced for this area.

Peaceful Setting, Ocean Views with Northern Burbs Lifestyle

WHERE: INSPECT: 55 Armagh Parade, Thirroul Saturday 12.30-1pm AGENT: PRICE: CONTACT:Raine & Horne Austinmer - 4268 1399 NEW LISTIING - $699,000 John McGuiness - 0402 021 527 Lisa de Ruyter - 0438 684 014

THIRROUL

Photos by Lisa de Photos

FEATUREPROPERTIES

Thursday 28 to Wednesday 6 March

Stage 2 of a 4 stage plan now selling!94 Island Point Road, St Georges Basin NSW 02 4443 6789 www.rosevalevillage.com

Stage 2 starting from $215,000HOMES AVAILABLE NOW!

Independent Lifestylefor the over 50sRosevale Home Village

BRAND NEW 2 & 3 BEDROOM HOMESAll bedrooms with built in mirrored robes, modern kitchens, lounge room, bathroom, laundry, vertical

blinds, carpets, vinyl, varandah, carport, garden shed, water tanks, fencing & much more.All you have to do is move your furniture in & connect your telephone.

Stage 3 starting from $215,000

HOMES AVAILABLE NOW!

Stage 2 of a 4 stage near completion.94 Island Point Rd, St Georges Basin NSW, Ph: 02 4443 6789“A residents right to occupy premises under the residential tenancy agreement is a leasehold right only and not a freehold or other right of unlimited or perpetural nature and may in certain circumstances be terminated”.

PETS

WELCO

ME

Woonona 2517 10:00-10:30 Sat 2 Kulgoa Rd O’Connor 0414 946 000 Auction H10:30-11:15 Sat 11/44 Russell St Ray White 0433 175 681 $365,000 H11:30-12:00 Sat 32 Mitchell Rd Huxley 0408 423 051 $445,000 H12:30-1:00 Sat 8/26 Popes Rd Doug.Harcourts 0411 385 833 $450,000 TWN1:00-1:30 Sat 1/9 George Tate Cl Ray White 4271 4000 $650,000 - $690,000 TWN1:30-2:00 Sat 32 Harriet Spearing Dr One Agency 0415 424 257 $980,000 H1:30-2:00 Sat 94 Popes Rd Doug.Harcourts 0411 385 833 $650,000 H2:00-2:30 Sat 3/25 Popes Rd MMJ North 0412 421 214 $359,900 V1:00-1:30 Sun 8 Beach Dr Bevans 0433 433 168 Auction H

Yallah 2530 11:30-12:30 Sat 11 Larkins Lane LJ Hooker 0402 844 636 Exp Of Interest H

Yellow Rock 2527 11:30-12:30 Sat 513 Yellow Rock Rd Doug.Harcourts 0405 454 624 Auction H

Wollongong North 2500 10:30-11:00 Sat 1/30 Cliff Rd O’Connor 0416 266 055 Auction U11:00-11:30 Sat 5/27 Church St O’Connor 0416 266 055 $333,000 U11:00-11:30 Sat 7/3-5 Corrimal St Peter Taranto 0411 754 884 $1,590,000 U12:30-1:00 Sat 2/50-54 Corrimal St Peter Taranto 0411 754 884 $539,000 U12:30-1:00 Sat 7/57 Bourke St O’Connor 0414 449 631 $359,000 U1:15-1:45 Sat 20/7 Edward St Peter Taranto 0429 809 856 $979,000 U3:15-3:45 Sat 3/55-57 Church St Peter Taranto 0403 618 988 $519,000 U10:30-11:00 Sun 3/55-57 Church St Peter Taranto 0403 618 988 $519,000 U1:15-1:45 Sun 20/7 Edward St Peter Taranto 0429 809 856 $979,000 U

Wollongong West 2500 10:00-10:30 Sat 23 Gundarun St L J Hooker 0408 422 864 $319,000 H11:30-12:00 Sat 16 Sheppard St O’Connor 0414 946 000 Auction H

Wombarra 2515 2:00-2:30 Sat 114 Morrison Ave Wiseberry 0414 539 699 $630,000 H2:30-3:00 Sat 14 Clutha Pl Wiseberry 0414 539 699 O/A$700,000 H2:30-3:00 Sat 4 Sweeney Pl Professionals 0411 315 450 O/A $780,000 H

Page 41: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

AUCTION ACTION AUCTION UPDATEA brief outline of upcoming auctions

RESIDENTIAL

Bevans Corrimal2 Thalassa Avenue, East Corrimal - 2/3/2012 - 3.30pm (on site)8 Beach Drive, Woonona - 23/3/2013 - 2pm (on site)Bevans Thirroul15 Doris Avenue, Woonona - 2/3/2013 - 10.30am (on site)393-395 Lawrence Hargrave Drive, Thirroul - 2/3/2013 - 11am (on site)124 Phillip Street, Thirroul - 16/3/2013 - 11.30am (on site)44 Kirkton Road, Austinmer - 16/3/2013 - 12.30pm (on site)Bevans Wollongong411 Lawrence Hargrave Drive, Thirroul - 2/3/2013 - 11.30am (on site)41 Hospital Road, Bulli - 9/3/2012 - 11.30am (on site)12 Bell Street, Keiraville - 9/2/2012 - 12.30pm (on site)Dougmal Harcourts Albion Park34 Broughton Ave., Tullimbar - 2/3/2013 - 11am (on site)513 Yellow Rock Road, Yellow Rock - 2/3/2013 - 12.30pm (on site)Dougmal Harcourts Kiama29a South Kiama Drive - 16/3/2013 - (on site)Dougmal Harcourts Northern Suburbs55 Underwood Street, Corrimal - 2/3/20123 - 11.45am (on site)Elders Wollongong27 Williamson Street, Tarrawanna - 2/3/2012 - 10am (on site)149 Flagstaff Road, Warrawong - 2/3/2012 - 11am (on site)First National O’Connor1/30 Cliff Road, Wollongong - 2/3/2013 - 11am (on site)16 Sheppard Street, West Wollongong - 2/3/2013 - 12pm (on site)14 Frances Street, Gwynneville (land) - 23/3/20113 - 12pm (on site)Laing & Simmons Wollongong3 Walter Street, Mangerton - 23/3/2012 - 4pm (on site)LJ Hooker Warrawong22 Third Avenue, Port Kembla - 2/3/2013 - 12.30pm (on site)7/18-22 Harbord Street, Austinmer - 2/3/2013 - 3pm (on site)22 Holborn Street, Berkeley - 16/3/2013 - 1.30pm (on site)LJ Hooker Wollongong107-109 Mt. St. Thomas - 2/3/2013 - 11am (on site)McPhail Wollongong1 Juanita Street, Towradgi - 16/3/2013 - 12pm (on site)MMJ South15 Surfside Drive, Port Kembla - 30/3/2013 - 10am (on site)MMJ WollongongUnits 4, 5, 10, 11, 8 McKinnon Street, Nowra - 6/3/2013 - 6pm (Shoalhaven Ent. Centre)One Agency Fairy Meadow30 Perth Road, Port Kembla - 9/3/2013 - 2.30pm (on site)Ray White North Beach Wollongong181 Church Street Wollongong - 9/3/2012 - on siteRay White Thirroul2 Kennedy Road, Austinmer - 9/3/2013 - 11.30am (on site)Ray White Unanderra70 Ellengowan Crescent, Fairy Meadow - 23/2/2013 - 3.45pm (on site)49 Ramah Avenue, Mount Pleasant - 3/3/2013 - 12 pm (on site)2 Paulsgrove Street, Gwynneville - 3/3/2013 - 12pm (on site)10 Makaha Way, Shell Cove - 3/3/2013 - 2pm (on site)Ray White Wollongong61 Marshall Street, Dapto - 2/3/2013 - 11.30am (on site)5 Pur Pur Avenue, Lake Illawarra - 2/3/2013 - 4pm (on site)3 John Street, Gwynneville - 16/3/2013 (on site)29 Russell Street, Woonona (land) - Wed. 20/3/2013 - 6pm (on site)

For clear expert advice or Free Quote call

4294-4716 | 0408 032 503

• Local, Country and Interstate• Difficult access specialist water

fronts• Barge access & right of ways

• Pre packing, cartons• Assistance cleaning, car & pet

transport• Storage & Insurance

As a leading Shire Removalist,Butlers Removals has built a strong reputation for efficiancy, reliability and trust. With professional friendly staff with 28 years of expertise, our family business is dedicated to customer service.

NEWSRain Affects Auction results…..Except One!

While the heavy rain on Saturday had an obvious effect on numbers attending auctions on the weekend, one achieved an exceptional result with a large crowd in attendance and eight registered bidders.John Kay from Ray White Unanderra said he was astounded at the success of the auction for 70 Ellengowan Crescent, Fairy Meadow. There was an exceptional turn out with the property selling under the hammer for $460,000.

In Austinmer, while 6 Asquith A venue (Bevans Thirroul) didn’t sell at auction, an offer was accepted soon afterwards.

Also in Austinmer, 74 Mountain Road (Raine & Horne Austinmer) wasn’t sold under the hammer with the highest bid being $850,000. John and Lisa from that office said they were still happy with the numbers that turned up and with several registered bidders, the outlook is still positive. Negotiations are continuing with several parties, but in the meantime it’s back on the market as expression of interest.

Other properties offered, but passed in were: 18 Elanora Road, Kiama Heights (Dougmal Harcourts Kiama) price yet to be determined; 32 Thurston Crescent, Corrimal (Dougmal Harcourts Northern Suburbs) price yet to be determined; 70 Darcy Road, Port Kembla (MMJ South) on market with price guide above $630,000.

NEW DISPLAY HOMES IN HORSLEY GIVE BUYERS GREATER CHOICE

FIRST NATIONAL COASTSIDE FEATURES IN STATE AWARDS

Two new Metricon home designs never seen before on display have opened at the new Horsley display centre in the Brooks Reach Estate. The new display centre is the first for Metricon in the area and takes the total to seven centres across New South Wales for this rapidly expanding home builder.

The Horsley display centre showcases two great value single storey designs. One is an acreage design, which is a first for the company in NSW and relevant to our area. The homes on display are the Mantra 25 Coastal and Kalarney 29 Vogue. Mantra 25 has four bedrooms, two big living areas, walk-in pantry, a full-size spare bathroom as well as master ensuite with adjacent walk-in-robe. Kalarney 29 suits acreage living with its wide frontage and expansive floor plan. Four bedrooms and two bathrooms satisfy the needs of a larger family.

Metricon Homes NSW sales and marketing manager, Regina Barnes, says that the new centre has some real attractions for local home buyers. “Besides great looking homes, there is a very distinct advantage for local buyers at Horsley,” says Regina. “We have consultants who know the area intimately and can help buyers through their local knowledge and building experience.

Regina says the new designs exhibit a good understanding of Australian family living with their use of open spaces, outdoor living and modern features. Additionally, each home has its own personality with a wide choice of facades and optional extras to customise to your requirement.

On Saturday night the First National group held its 2013 State Awards.

Maria Field won a Diamond award for the highest number of Residential Sales while Darren Mansell won Gold for the highest number of Residential Sales.

Rachel Hutchinson won two property management awards for highest net gain of properties under management, both individual and office combined.

The awards were held at the Crown Plaza in Coogee.

70 Ellengowan Crescent, Fairy Meadow - SOLD under the hammer for $460,000 by Ray White Unanderra.

State Chairman, Mark Millington presents awards to Maria, Darren and Rachel

Page 42: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Accelerating success.

www.colliers.com.au

AUCTION

Retreat, Resort, Recreation, Rural

JAMBEROO VALLEY MOTEL, 406 Jamberoo Mountain Road, Jamberoo

Rare motel investment & freehold opportunity. This asset offers an incoming purchaser secure cash flow with enormous potential for capital growth. This investment is a WIWO deal with the ability to service any forward book-ings immediately. This is a blue sky opportunity and is the ideal venue for conferences, retreats, conventions and resort relaxation. The location of the site is within 5 minutes from the village of Jamberoo, 10 minutes from the seaside township of Kiama, approximately 30 minutes from Wollongong CBD and 90 minutes south of Sydney. It is only a 7 minute drive from Jamberoo Action Park and 10 minute drive from Minnamurra Rain forest and Falls.

Auction 28 March 10:30am, Angel Place, 123 Pitt Street, Sydney Inspect By appointment onlyView www.colliers.com.au/500628439

Simon Kersten0419 333 53302 4222 7222

• Large 2.8ha site surrounded by landscaped gardens and natural bushland• Comprising 45 rooms, restaurant, large variety of conference rooms, outdoor courtyard and amenities such as tennis court and swimming pool• Established for over 30 years with regular repeat bookings and solid track record• Lots of potential for growth; currently under management• Management company can stay or manage yourself

Viktor Desovski0419 487 09102 4222 7222

42 28 February 2013

76 Kanahooka Road Kanahooka

CALL 4261 3333 www.brooksterrace.com.au

Lakeside Living with a Slice of History Boutique estate of just 81 elevated lots Sizes ranging from 450m2 - 831m2

Uninterrupted views to Lake Illawarra Perfectly positioned for fishing, kayaking,

sailing, golf, cycling, walking and tennis Walk to the nearby childcare centre,

primary schools and high schools House & Land Packages available

* On selected lots. Conditions apply. ‡ Exclusive offer to purchasers at Brooks Terrace Land Development Kanahooka. Normal IMB lending criteria, terms and conditions apply. Limited time only. IMB Ltd. ABN 92 087 651 974. AFSL/ACL 237 391

Preferred Finance PartnerExclusive‡ finance package available

Call 133 462 for more informationPhone: 02 4261 3333 Mobile: 0408 424 474

Contact Greg Pollard

For the next 10 lucky buyers*First home buyers

get extra $15k

Page 43: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

4261 0333www.prddapto.com.au Sell Smarter

This immaculately presented home is a credit to its current owners and offers 4 huge bedrooms with BIW’s plus ensuite and WIR to main. Walk into the formal lounge and be impressed by the vaulted ceilings which offer a sense of exclusivity and style. From here it’s a short stroll down the light filled hall to the more informal areas of the house where you can sit relax and enjoy all this fine home has to offer. Outside gardens and a large covered entertaining area spill out to complete a truly stunning home.

Horsley, 14 Riverpark Way 4 BED 2 BATH 2 CAR

VIEW Saturday 1:45-2:15pm PRICE $435,000 - $465,000

CONTACT Jeremy Tillman 0418 244 601 [email protected]

So much better than new

You will be pleasantly surprised with what this home has to offer. Situated on a massive 892m2 block with ponds and water features you and your family will feel like you are somewhere else. This home has been extended to now enjoy 3 bedrooms, study (or possible 4th bedroom), 2 living rooms, big well-appointed kitchen, modernised bathroom and you can relax and dine outside in one of 2 entertainment areas. Workshop. carport, air-conditioning, freshly painted, new carpet…. there is not a thing that needs to be done when you move in. INVESTORS if you are looking at adding to your portfolio, properties like this are in high demand and would lease for $360 - $375 per week.

Koonawarra, 9 Kurrawa Crescent3 BED 1 BATH 1 CAR

VIEW Saturday 1-1:30pm

PRICE $315,000 - $330,000

CONTACT Tracey McDonald 0404 033 533 [email protected]

Surprise Package

This trendy home, set on an elevated lot affords great views of the surrounding area and is fit for summer entertaining. Fire up the BBQ under the covered entertainment area and after lunch come on inside and enjoy the fully renovated home. A private dinner party more your thing? Then check out the amazing open plan, modern kitchen and dining area, it really is the heart of this home. With a large backyard and low maintenance gardens this home has been built for enjoying life at home in your great Australian sand castle. If you don’t want to miss this one then call to arrange a private inspection before Saturday’s open house.

Dapto, 64 Laver Road 3 BED 1 BATH 1 CAR

VIEW Saturday 12-12:30pm

PRICE $365,000

CONTACT Jeremy Tillman 0418 244 601 [email protected]

Entertainers Delight

A truly epic home is right here for the taking. Include the extended family under one roof with the unique layout of this stunning home. Featuring open plan living areas on the lower level that extend out from the gourmet kitchen and through to the alfresco dining. Sit and enjoy the inground pool or entertain friends with a BBQ on those hot summer nights. Travel upstairs and enjoy either 4 large bedrooms or two separate accommodations both with their own living area and bathrooms to die for. This home has to be seen to be fully appreciated and we welcome your inspection. See our online tour at www.prddapto.com.au.

Haywards Bay, 16 Bayview Avenue 5 BED 4 BATH 2 CAR

VIEW Saturday 2 - 2:30pm

PRICE $655,000 -$685,000

CONTACT Jeremy Tillman 0418 244 601 [email protected]

Live The Life You Deserve

NEW LISTING

Page 44: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

4261 0333www.prddapto.com.au Sell Smarter

Here is a great opportunity to get your foot on the property ladder with a stunning home in a quiet street. All you need and want is here for the taking. Renovated to a high standard your focus will be on how to spend your time entertaining your family and friends in the private backyard. Inspections are a must and will not disappoint. Come home and enjoy all this fine property has to offer.

Koonawarra, 8 Balarang Place3 BED 1 BATH 1 CAR

VIEW Saturday 11-11:30am

PRICE $300,000 - $320,000

CONTACT Jeremy Tillman 0418 244 601 [email protected]

Best in show

Looking to enter the market but tired of seeing run down & neglected properties? Then take a look at this home. A unique style with high ceilings in the living room this home has a lot of character. Great 2nd living area so the kids can have their own space, fire place & air-conditioning for comfort all year round & dine off the back deck in summer. This home also backs onto a reserve so the kids have an extended playground to play in. Great street, next to a great school. Are you after an investment property? Well you are in luck! We already have an A grade tenant in this home paying $340pw. So if it is your first home or an investment property that you are after, then this is the home for you.

Dapto, 88 Parkside Drive3 BED 1 BATH 1 CAR

VIEW Saturday 10-10.30am

PRICE $310,000 - $340,000

CONTACT Tracey McDonald 0404 033 533 [email protected]

Hidden Beauty

Looking for the wow factor? We have it! This home has recently undergone renovations & a massive face lift making this the perfect home to entertain family & friends. Cook up a storm for guests in the spectacular kitchen and entertain them either inside in the huge air-conditioned family room or outside under the massive 13 x 4 metre entertainment area. Your guests will be blown away by the stylish bathroom with his and her sink and create your own private retreat out the back with a good sized level yard for you to do what you like. With a remote control double garage this home truly does represent great buying. Located in a beautiful wide street close to the local shops, you would be crazy not to insepct

Horsley, 38 Ritchie Cres3 BED 1 BATH 2 CAR

VIEW Saturday 11:45-12:15pm PRICE $390,000 - $410,000

CONTACT Tracey McDonald 0404 033 533 [email protected]

Stunning Entertainer

Do you want something new? then check this out! Situated in beautiful and leafy Penrose Estate this home is set back off the street, with no rear neighbours and offers all the luxuries of buying new without the price tag. Recently renovated the buyers of this home will get brand new carpet, freshly painted walls and roof tiles, new blinds, new bathroom, modern kitchen, brand new deck over looking a private and level backyard and a new garage. Have you seen many fully renovated properties for sale recently under $350k........ No?...... then I suggest you arrange to inspect this property now, as a property fully renovated like this home won’t take long to sell.

Dapto, 27 Melalueca Ave3 BED 1 BATH 1 CARImpressively renovated

VIEW Saturday 10:45-11:15am

PRICE $320,000 - $350,000

CONTACT Tracey McDonald 0404 033 533 [email protected]

Page 45: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

4261 0333www.prddapto.com.au Sell Smarter

Brownsville, 2/13 Prince Edward DriveA great opportunity is here for the taking, get your foot on the property ladder & enjoy all that this unit has to offer. Featuring 2 good sized bedrooms, a new kitchen plus a good sized living area. Inspect today.

Why over extend yourself

2 BED 1 BATH 1 CAR

VIEW By AppointmentPRICE $175,000 - $195,000CONTACT Jeremy Tillman 0418 424 474 [email protected]

Horsley, 7 Yeldah DriveOne look is all you will need to realise this is a great home, well designed & located in a quiet area of this highly sought suburb. Featuring 3 bedrooms, 2 living areas, very well appointed kitchen & bathroom and double garage with internal access. double garage with internal access. All located on a level block with a pleasant sunny pergola and private back yard.

Great Home - Perfect Location

VIEW Saturday 10 - 10:30amPRICE $387,000CONTACT Greg Pollard 0408 424 474 [email protected]

3 BED 1 BATH 2 CAR

Dapto, 12 Unara Road Stroll on level ground to all that Dapto Mall has to offer or mosey to the Train Station. This home is well appointed & has been renovated throughout. Featuring high ceilings & a large back yard with covered entertaining area gives a great sense of space & the new kitchen and modernised bathroom completes a home that won’t disappoint. Inspect today

CBD Convenience

VIEW Saturday 2:30 - 3:00pmPRICE $325,000 - $355,000CONTACT Jeremy Tillman 0418 424 474 [email protected]

3 BED 1 BATH 1 CAR

Horsley, 311 Mallon AvenueLarge level 995m2 block, with 43m frontage, ideal for building with caravan or boat in mind. Fabulous location in prestigious “Brooks Reach” Estate with a stunning escarpment backdrop. Family or retirement living at its best. Agent onsite each Saturday 12:30-1:30pm.

One Of A Kind

VIEW Saturday 12:30 - 1:30pmPRICE $340,000CONTACT Geoff Birchall 0439 737 327 [email protected]

LAND LAND LAND

VIEW Saturday 1 - 1:30pm PRICE $595,000

CONTACT Greg Pollard 0408 424 474 [email protected]

Haywards Bay, 19 Riverside Drive5 BED 2.5 BATH 2 CAR

Rare opportunity to purchase this stunning former Clarendon Show Home that has been designed, built & completed to a very high standard. Featuring unique floor plan spilt over 3 levels including large formal & casual entertaining areas, alfresco dining, seperate downstairs rumpus, 4 bedrooms, master with ensuite, private study and large double garage with internal access. With only the best of fittings throughout including ducted air conditioning plus fully lanscaped yards & gardens really complete this superior home

Superior in every way

Dapto, 5 Avonlea Street This most appealing home has been extensively renovated and refurbished throughout. Great spacious design with sep entry, large lounge, bright modern kitchen, well appointed bathroom, 3 good size bedrooms plus a cosy sunroom at the rear. Located on a fantastic level block with carport and garage.

Sure to Impress

3 BED 1 BATH 2 CAR

Albion Park Rail, 47 Kaylaur CresRecently refurbished this conveniently located property has loads of appeal. Featuring brand new kitchen, polished timber floors through the main living areas, family room, 3 bedrooms, modernized bathroom, large internal laundry, covered front & rear patios & huge double garage.

Comfort & Convenience

VIEW Saturday 12 - 12:30pmPRICE $329,950CONTACT Greg Pollard 0408 424 474 [email protected]

3 BED 1 BATH 3 CAR

VIEW Saturday 11 - 11:30amPRICE $329,000CONTACT Greg Pollard 0408 424 474 [email protected]

A stunning and fully renovated home consisting of 4 bedrooms and 2 bathrooms is here for you. You will be amazed at the high level of fixtures and fittings, the high ceilings and the attention to detail offered. Open plan spaces offer a modern style of living and a separate bedroom with ensuite offer a great place to house the teenagers or extended family. A truly stunning home in every way, inspect today.

Berkeley, 31 Nolan Street4 BED 2 BATH 2 CAR

VIEW Saturday 10 -10:30am PRICE $390,000 - $420,000

CONTACT Jeremy Tillman 0418 244 601 [email protected]

Perfection In Every Way

Looking to invest or need room for the extended family then this may just be the property for you. A world of opportunities are available to the buyer including the sale of the entire property as one single lot. Both are currently rented to long term stable tenants. Each property consists of a generous 3 bedroom home with ensuite bathrooms, BIW’s and spacious living areas. The rear courtyard is ample for the gardener or entertainer alike. Both properties come equiped with a single lock up garage and are conveniently located to all amenities.

Barrack Heights, 45 McGregor Ave6 BED 4 BATH 2 CAR

VIEW By Appointment

PRICE Price on Application

CONTACT Jeremy Tillman 0418 244 601 [email protected]

Double Wamey - Investment Opportunity

NEW LISTING

NEW LISTING

NEW LISTING

Page 46: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

2

3

• This amazing villa features high ceilings, air-conditioning, big rooms and beautifully landscaped grounds• Three generous sized bedrooms all with built-in wardrobes• Three way ensuite bathroom and powder room with second toilet• Modern kitchen with stainless steel appliances and dishwasher• Modern finishes throughout

REDUCED

13 Darragh Drive FigtreeOPEN HOUSE SATURDAY 10.00 - 10.30am

Carla Veljanoski 0431 086 264

FIGTREE O/Above $420,000

• Spacious lounge area, separate dining area and large internal laundry• Immaculate gardens, undercover courtyard and single remote drive through garage with internal access• Low maintenance yard• Rare villa with no strata fees

3 1 1

• Excellent 3 bedroom home with built in wardrobes in 2 bedrooms including study area in the large walk in robe

• Open plan modern kitchen, timber floor throughout and air-conditioning

• Self-contained flat downstairs suitable for teenage retreat

• Enclosed carport with drive through access to the back yard

• Located close to shops, schools and a short stroll to the lake foreshore

79 Nottingham Street

NEW

3 1 1

BERKELEY $319,000

Carla Veljanoski0431 086 264

OPEN HOUSE SATURDAY 11.00 - 11.30am • From the large grand entrance foyer through to the formal lounge/dining to the open plan granite bench top kitchen this property features -

• 4 large bedrooms plus a study• 3 bathrooms with spa plus ensuite• Built-in wardrobes in all bedrooms• Indoor sauna & spacious theatre room• Games room with snooker table and wet bar• Large covered entertainment area • 3 car garage with internal access as well as parking for

another four cars within the secure gated area

133 New Mt Pleasant Road

REDUCED

4 4 3

MT PLEASANT $1,200,000

Carla Veljanoski0431 086 264

INSPECT BY APPOINTMENT

Page 47: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

• Internally this home offers 2 large living areas, large eat in kitchen, modern bathroom with separate w/c, 4 large bedrooms all with built in wardrobes

• Perfectly positioned north facing backyard with inground saltwater pool, huge pergola to enjoy those summer afternoon BBQ’s

• Over sized double garage with one side converted to a teenagers retreat, or return to a large double garage

• This home is located within walking distance to the lake foreshore, schools, bus stops and other amenities

332 Flagstaff Road 4 1 2

BERKELEY $399,000

Carla Veljanoski 0431 086 264

INSPECT BY APPOINTMENT • This 4 bedroom, 2 living area, northwest facing home is located approx. 30 metres from Lake Illawarra

• The interior has been freshly painted and comes with ducted air-conditioning

• Has a large balcony overlooking the backyard and a generous sized double garage/work shed (approx. 8x8m)

• Plenty of options on this property, you can just live-in, extend, or go up a level for uninterrupted water views or knock down and rebuild, the rest is up to your imagination

176 Lakeview Parade

OPEN

4 1 2

PRIMBEE Offers Above $430,000

Paul Spinelli0415 112 702

OPEN HOUSE SATURDAY 11.00 - 11.45am

2

• This 2 bedroom brick and cement rendered home is located in a sought after street with sweeping panoramic ocean and lake views• Convert downstairs into a studio, home office, teenagers retreat or just for extra storage• Solar hot water system, security shutters and near new tiled roof are all added extras to this property• Walking distance to Westfield shops, sports fields and a short drive to lake foreshores and Port ´s Surfing beaches• Renovator’s delight!

54 Bland Street Port Kembla

OPEN HOUSE SATURDAY 10.00 - 10.45am

Paul Spinelli 0415 112 702

2 1 1

OPEN PORT KEMBLA $339,000

2

• This two storey brick and tiled residence on a level large block is situated in one of Lake Heights most popular streets• Offering 3 bedrooms with an additional sunroom, spacious living area and double lock up garage with extra storage room • New carpets and paint • Lovely views of Lake Illawarra• Close to transport, shops and hospital• Only moments to Lake Illawarra with walking tracks, fishing and play grounds only minutes away

262 Northcliffe Drive Lake Heights

OPEN HOUSE SATURDAY 12.00 - 12.45pm

Carla Veljanoski 0431 086 264

3 1 2

OPEN LAKE HEIGHTS Offers Above $399,000

• Spacious 3 bedroom relocatable home featuring 2 sun rooms, 2 verandahs, separate toilet, a lock up garage as well as an extra car space and is located in the sought after suburb of Figtree

• Only an 8 minute walk to Figtree Westfield Shopping Centre, minutes walk to public transport, primary and high schools

Paul Spinelli 0415 112 702

FIGTREE O/A $240,0003 1 1

• Neatly renovated two bedroom top floor unit with car space

• Good sized balcony / patio • Open plan living and dining • Spacious bedrooms• Close to shops, transport, beach and pools• First home owner buy

Carla Veljanoski 0431 086 264

BELLAMBI O/A $250,0002 1 1

Page 48: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Two level unit conveniently located close to shops, transport, restaurants and all other amenities. This property features private court yard, security parking for 2 cars, open living plan, large bedrooms with BIW’s. Access to roof top swimming pool and relaxing gardens. This property will suit a smart investor looking for a healthy long term return. Make an appointment to inspect today.Inspect:2nd March 11:15am - 11:45amAdam Sali or Hamish Brown0419 461187

WollongongUnit 6 2-12 Young StreetOffers Above $400,000Contemporary Living

CITY

LIFES

TYLE

* Suit Dual Occupancy (STCA) Or Large Home

* Forward sloping parcel of land.

* 720 square metres.

* High side of the street, in an established area.

Inspect:By AppointmentHamish Brown0419 461187

Unanderra22 Bruce RoadOffers Above $179,000Ready To Build

BLANK

CANVAS

This property in the established suburb of Unanderra situated on a large block offers the young family a affordable entry into the property market. Featuring brick veneer construction, 3 bedrooms garage underneath close to schools with An easy drive to Unanderra, Figtree & Wollongong shopping areas. This property requires a little TLC but is a great buy at this price Inspect for yourself.Inspect:By appointmentHamish Brown0419 461187

Unanderra48 Bruce StreetOffers Above $375,000Affordable Family Living

GREAT

OPORTUNITY

This magnificent property offers the potential buyer a relaxed lifestyle with beautiful views of Lake Illawarra. Close to all amenities including major shopping centres, schools and public transport. This fully renovated home has absolutely nothing to spend. Make an appoint to inspect immediately or contact us to request a full copy of the building and pest reports.Inspect:2nd March 10:30am - 11:00amHamish Brown0419 461187

Lake Heights364 Northcliffe DriveOffers Above $389,000Live by the Lake

GREAT

OPPORTUNITY

Master Properties presents this modest 3 bedroom brick veneer home featuring lake views. If features a neat kitchen, dedicated dinning area and a spacious lounge area. Laundry, storage area and an extra bathroom down stairs. This property also has a detached lock up garage. Purchase it and enjoy the panoramic lake views

Inspect:2nd March 9:45am - 10:15amHamish Brown0419 461187

Lake Heights39 Hassan StreetOffers Above $350,000Lake Views

OPEN

HOUSE

A short 10 minute walk to the Warrawong CBD. Recently renovated throughout with brand new floating floors 2 bathrooms, 4 bedrooms with high ceilings, 2 sun rooms, lounge with sun trap & working open fire place, double garage with attached workshop. Excellent rental returns make it a very attractive purchase for the astute investor. Make an appointment to inspect today.Inspect:2nd March 9:00am - 9:30amHamish Brown0419 461187

Warrawong24 Third Avenue North$349,000Renovated Delight

JUST

LISTE

D

6/60-62 Cliff Road, North Wollongong $1,590,000

• Acquire a sub-penthouse lifestyle within the Rockpool• Open plan lounge & dining amongst ocean backdrop• Central designed kitchen with stone tops & s/s appli.• Sophisticated bathrooms with quality, fixtures & fittings• Entertainers balcony with breathtaking harbour views

3 2.5 2.5

BY APPOINTMENT

5/55 The Boulevarde, Oak Flats $609,000

• Brand new contemporary villa located on waters front• Enviable llifestyle, panoramic lake & escarpment views• Spacious living & dining area flowing to private deck area• Gourmet kitchen, stylish appointments, remote DLUG• Security gated boutique complex of 5, premium living

3 2 2

OPEN SAT 11.00-11.30AM

1 Dovers Drive, Port Kembla $530,000

• Perfect for the family seeking that beach lifestyle• Dominating high & capturing picturesque views• Bright & sunny interiors with endless panorama• Solid with great potential plus second TV/sunroom• Moments to surf beach, pool, schools & Westfield

3 1 1.5

OPEN SAT 11.00-11.30AM

24/1 Sparta Avenue, Warilla $309,000

• Easy access to the common pool area & garden• Short walk to beach, transport and shops• Open plan living/dining, great size• Internal laundry, separate bathroom & toilet• Great buy and keep as an investment

2 1 1

OPEN SAT 10.00-10.30AM

19 Market Street, Wollongong $149,000

• High-quality investment, suits individual or portfolio• Fully furnished studio apartment, leased to Adina• Enviable occupancy rate regardless of occupancy• Modern complex built in 2007 with pool/gym/sauna• Moments to CBD, beaches, restaurants & WEC

S 1

BY APPOINTMENT

7/26 Market Street, Wollongong $389,000

• Sunrise Apartments, live in the heart of the city • Open plan lounge, dining and modern kitchen• Two large bedrooms, both with BIW’s• Security building with secure parking• Sunny south west aspect and close to everything

2 1 1

OPEN SAT 10.00-10.30AM

22/80-84 New Dapto Road, Wollongong $399,500

• Impressive top floor apartment, quality finishes & fixtures• Wake up or entertain with breath-taking mountain views• Spacious open floor plan, full security building w/ parking• A statement in style & sophistication, convenient location• Fantastic investment, excellent for deprecation

2 1 1

OPEN SAT 11.00-11.30AM

60/60-62 Harbour Street, Wollongong Offers Above $669,000

• Executive apartment in the Ocean View Apartments• Sun-drenched & North facing, large open plan design• Stylish & sleek kitchen & bathroom + double LUG• Large balcony with breathtaking ocean views• Short strol to shops, CBD, cafes & city beaches

3 2 2

OPEN SAT 11.00-11.30AM

43/59-67 Corrimal Street, Wollongong $675,000

• Stroll to the ocean pool, harbour, beaches, CBD & cafes• Open lounge & dining flowing to spacious balcony• Stylish kitchen, s/s appli., granite tops, neutral colours• Ducted reverse cycle a/c + restort style pool & gym• Ensuite to main, 2nd deluxe bthrm, security lift & DLUG

3 2 2

OPEN SAT 11.45-12.15PM

48 28 February 2013

Beautifully presented is this stunning 3 bedroom home with attention to detail to the highest degree. This property features ultra modern kitchen with stone top and stainless appliances, two modern bathrooms polished timber floors, high ceilings, spacious living, with an extra large double garage with storage, outside features manicured and easy maintenance garden, large outdoor entertaining area.This lovely home is only minutes to the lake, shopping, freeways, great for the first home buyer or investor.

Inspect: Saturday 2nd March at 1100am - 1130amRob Franceschini 0434 970 439

Berkeley 14 Osprey Drive $429,000Just Like New

NEW LI

STING

OPEN H

OUSE

Beautifully presented 3 bedroom home. Featuring 2 bathrooms fully renovated through out with high ceilings. Both kitchen and main bathroom have been renovated in the modern style with the lounge room featuring polished timber floors and a spacious back patio area. An inspection will impress

Inspect: Saturday 2nd March at 1100am - 1130amWilliam Milenkovski 0410 418 680

Cringila 41 Newscastle Street Offers above $299,000Attention First Home Buyers

OPEN

HOUSE

Beautifully presented is this 5b/r brick veneer home. This home offers spacious living spilling outside onto a huge covered entertainment area, great for a family get together or summer BBQ. This property has a modern kitchen and appliances, two separate bathrooms plus a rumpus.

Inspect: Saturday 2nd March at 1000am - 1030amWilliam Milenkovski 0410 418 680

Warrawong 6 Second Avenue $520,000King Of The Castle

OPEN

HOUSE

Page 49: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

11 Church Street, Balgownie $299,000• A rare sweetie at a great price• Located close to Balgownie Village• Incredible value for the size & location• Great opportunity to enhance or upgrade• Delightful north-facing garden

2 1 2

OPEN SAT 11.00-11.30AM

3 Terrell Place, Balgownie $685,000• Quiet cul-de-sac street, very private, split level design • Warm and inviting interiors, loads of room to relax• Self-contained flat, generous garages, so much to see• Surrounded by quality gardens, plenty of street appeal• Properties like this do not last, be quick not to miss this

5 3 2

OPEN SAT 3.00-3.45PM

77 Compton Street, Dapto $329,000• This 3 bedroom home has more than meets the eye• Good sized bedrooms with built-in wardrobes• Two living areas, renovated bathroom & kitchen• Good flat yard with large double garage & tool shed• Only a short drive to shops, transport & schools

3 1 2

OPEN SAT 1.15-1.45PM

12/31-33 Princes Highway, Fairy Meadow $379,000• Ideally located in the heart of Fairy Meadow • Light filled open living leading onto balcony• Modern kitchen & bathroom, ensuite to main• Security complex, lift access, secure parking• Level walk to shops, café´s, transport, parks

2 2 1

OPEN SAT 1.00-1.30PM

51-59 Princes Highway, Fairy Meadow $419,000• Excellent opportunity for 1st home buyers or investors• Modern open plan living & dining areas with balcony• Good size bedrooms with BIW’s, internal laundry• S/steel appliances, linen, lift access, security parking• Short walk to shops, parks, restaurants and transport

2 1 1

BY APPOINTMENT

64 Bellevue Road, Figtree $395,000• Well proportioned for the growning family• Stylish kitchen & bathrooms with quality appliances• Central location to shops, schools & transport• Huge backyard with ent. deck suitable for all• Room for everyone, modernished throughout

5 2

OPEN SAT 12.15-1.00PM

7 Galway Court, Horsley $445,000• One level home, light & bright open plan deisgn• 3 car garage & plenty of off street parking• End of a peaceful cul-de-sac on a generous block• BIW’s, main bedroom with ensuite & parent retreat• So much property for so little... Inspect now

4 2 3

OPEN SAT 1.30-2.15PM

27 Dallas Street, Keiraville $689,000• Walk to UOW, Botanicial Gardens & Keiraville Village• Modern gas & stone kitchen, open plan & solar power• Polished wooden floors to living areas, BIW’s to all b/rs• Spacious covered veranda overlooking pool & garden• SLUG plus double carport & off street parking, free bus

5 2 3

OPEN SAT & SUN 11.15-11.45AM

35 Eastern Street, Gwynneville $585,000• Open plan living with spotted pine timber floors• Great for development (STCA) 1,051sqm block• Private & sunny garden area great for entertaining• Modern & neutral colour scheme, air-conditioning • Large lock-up garage with storage. Must see!

3 2 2

OPEN SAT 1.30-2.00PM

2/50-54 Corrimal Street, North Wollongong $539,000• Enjoy the vibrant location & low-maintenance living• Spacious contemporary open plan living & dining area• Modern kitchen with granite tops & s/s appliances• Large terrace balcony, previous leased at $540pw• Short walk to beaches, alfresco dining & city shopping

3 2 1

OPEN SAT 12.30-1.00PM

52 Sunninghill Circuit, Mount Ousley $509,000• Solid dual level family home, northern aspect • Open living plan with balcony, separate dining• Neat kitchen and bathroom, 2nd wc & shower• Rumpus room with kitchenette, 1.5 car garage• Large level yard, storage, high demand location

4 2 2

BY APPOINTMENT

11/11-15 Church Street, North Wollongong $739,000• Contemporary living with beach lifestyle & location• Surround sound with open plan living & dining area• Gourmet kitchen with European appliances & stone tops• Sunny balcony with strong north/eastern ocean views• Minutes walk to popular cafes, beaches & Stuart Park

3 2 2

BY APPOINTMENT

8/7 Pleasant Avenue, North Wollongong $225,000• Nth facing, fully renovated with new kitchen & bathroom• Good-size open living area, full kitchen & large bedroom• 2nd floor unit, small block, close to beach & cafe lifestyle• Ideal investment/1st home buyer, sought-after location• Be quick to secure a slice of Nth Wollongong Real Estate

1 1 1

BY APPOINTMENT

6 Parkman Place, Mount Keira $699,000• North facing, private & secluded large family home• Open plan gourmet kitchen with adjoining sunroom• Multiple living rooms flowing to outdoor deck & c/yard• Teenage retreat, study downstairs & in-ground pool• Minutes to Private Schools, University, parks & transport

4-5 3 3

OPEN SAT & SUN 2.15-2.45PM

20/7 Edward Street, North Wollongong $979,000• Luxury living, relaxed dining with ocean & escarp views• Nth facing, gas kit w Miele appli & stone bench tops• Spac b/rs w BIW, main b/r w WIW, flow to balconies• Pool & BBQ area, sec. bldg, sep laundry,DLUG ,a/c• Mins to beach, harbour, restaurants, Cliff Rd, CBD

3 2 2

OPEN SAT & SUN 1.15-1.45PM

53 Taronga Avenue, Mount St Thomas $375,000• Inviting & charming home filled with natural light• Spacious interiors, neutral tones to make your own• Kitchen area with adjoining dining opening to yard• Tandem garage, external laundry, versatile layout• Ideally suited to 1st home buyer, handy location

2 1 2

OPEN SAT 11.45-12.15PM

44 Ocean Street, Mount St Thomas $395,000• Refurbished with a perfect blend of new & old charm• Solid home with a quality galley styled timber kitchen• Plenty of size throughout the living area & bedroms• Initingly private, yet suprisingly peaceful location• Ready for immediate enjoyment with a sunny aspect

3 1 1

OPEN SAT 12.00-12.30PM

42 McAndrew Crescent, Mangerton $629,000• Private brick home + study, master with ensuite & WIW • Separate self-cont. granny flat downstairs, many options• 2 kitchens, 3 dining areas, 2 living areas & 3 bathrooms• Covered patio with BBQ, flows from informal living area• Minutes to private/public schools, transport & CBD

6 3 1.5

OPEN SAT & SUN 12.15-12.45PM

Page 50: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

353 Crown Street Wollongong 4228 7878 Lou Niceski 0414 287 093, Danny Peterson 0421 764 496

elderswollongong.com

••••

•••••

•••••

•••••

•••

•••

••

••

••

••

••••••

••••

••••

••••••

••••••

•••

•••••

•••

••

Page 51: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

GWYNNEVILLE� $549,500

Page 52: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

52 28 February 2013

2

3

4

Page 53: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Domain

112 Central RoadUnanderra

domainfirstnational.com.au 4271 7444

INSPECT 12:00-12:30PM

4 1 1Picture Perfect.This beautiful well-appointed family home is situated in a quiet cul-de-sac street & a short stroll to schools, shops, transport & Lake Illawarra. Featuring open plan living with a updated kitchen, 4 b/r’s with mirrored BIW’s to 2, renovated bathroom with separate w/c. Good size laundry leading out to the wonderful undercover entertainment area looking over manicured lawns & sitting on approx. 777 sqm. Stenciled driveway leading to the extra-large garage with heaps of storage. Contact Ali Yagmur 0412 717 444Inspect Saturday, 2 March 12:00-12:30pm

BERKELEY 15 Cornwell Place $329,900

3

OPE

N NEW

INSPECT 1:00-1:30PM

3 1Priced To Sell!!Cheapest home in Port Kembla! This older style 3 bedroom weatherboard home features 3 large bedrooms with high ceilings, a trendy kitchen with a bathroom needing some T.L.C. Arguably the best priced home that is only a short stroll to shops, schools, transport and our beautiful Port Kembla beach. This ugly duckling can be turned into a princess or you may want to put it to rest and start all over again. Sitting on approx. 524 sqm with dual street frontage.Contact Ali Yagmur 0412 717 444Inspect Saturday, 2 March 1:00-1:30pm

PORT KEMBLA 201 Wentworth Street $239,000

3

OPE

N NEW

4 2 1Must Sell / All Offers Considered3 bedroom home plus a fully self-contained studio. The lovely home features 3 bedrooms with mirrored BIW’s to 2 of the 3 spacious b/r’s & a updated bathroom. Large sunny lounge room and modern kitchen with open plan dining & fire place. Leading out to the back yard, with shed, carport & detached fully self contained Studio. Impressive self contained studio, featuring a modern renovated kitchen & bathroom, large open plan lounge & bedroom, potential rental of $170 p/w. Contact Ali Yagmur 0412 717 444Inspect As advertised or by appointment.

BERKELEY 1 Barnes Street OFFERS ABOVE $300,000

3

3 1 1Magnificent OutlookCapture the magnificent lake and escarpment views from the decking or your huge double size lounge room. Featuring 3 good size bedrooms, polished floorboards throughout, a modern kitchen with gas stove and dishwasher and an updated bathroom. Outside features a enclosed undercover decking and BBQ area, second shower and toilet in laundry with ample storage. Landscaped gardens with carport and second off street parking area.Contact Ali Yagmur 0412 717 444Inspect As advertised or by appointment.

BERKELEY 86 Nottingham Street $299,000

33 1Great Investment or First Home!!

Situated close to shops, schools, parks and Lake Illawarra is this lovely home. Featuring 3 spaciousbedrooms, polished floors throughout, updated bathroom and a renovated kitchen leading out to the beautiful new decking and fully enclosed yard with a new colour bond fence. Tiled open plan dining and internal laundry. Large flat level block with potential for a second dwelling subject to council approval. Off street parking and currently tenanted at $300 per week.Contact Ali Yagmur 0412 717 444Inspect As advertised or by appointment.

BERKELEY 5 Bristol Street $259,000

3

4 2 2Beautiful Modern Home6 months young & positioned in a great area of Dapto Heights is this beautiful split level modern design home. Surrounded by other quality homes, it features BIW’s to 3 of the 4 spacious bedrooms with ensuite to main. Large open plan living area and dining area with a separate family room leading out to alfresco area all capturing the picturesque mountain views. Remote 2 car extra large garage with internal access. Why build when this home has it all and more. Contact Ali Yagmur 0412 717 444Inspect As advertised or by appointment.

DAPTO 16A Carlyle Close OFFERS ABOVE $450,000

33 1 1Buy Now, Profit Later.

Ali Yagmur of Domain First National is proud to offer this commercial property in the heart of Port Kembla. Currently a vacant shop with a 2-3 bedrooms residence attached on an expired lease with a dual street frontage making it an ideal redevelopment. Situated opposite Tosti Cellars and within walking distance to all amenities.

Contact Ali Yagmur 0412 717 444Inspect As advertised or by appointment.

PORT KEMBLA 179 Wentworth Street $319,000

36 2 2Calling All Investors!!!

A great opportunity to buy 2 homes on the one title! Located at the front of the property is the original home with 3 bedrooms & polished floorboards currently leased out at $300 p/w. The property at the rear is only a few years young with open plan living, 3 bedrooms, modern kitchen & bathroom. Single garage & internal access. Currently leased out at $360 p/w. Situated within walkingdistance to shops, railway, parks and schools.Contact Ali Yagmur 0412 717 444Inspect As advertised or by appointment.

UNANDERRA 10 & 10A Fraser Street OFFERS ABOVE $500,000

3

Page 54: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

O’ConnorO’Connor

4226 60551/55 Kembla Street Wollongongwww.oconnors.com.au

Page 55: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Coastside

coastsidefn.com.auShop 4/20-26 Addison St, Shellharbour

4295 5033

Set within a boutique complex of three, this sleek low maintenance townhouse balances the needs of convenient family living with contemporary style. Perfectly located close to shops, schools, parks and public transport, enjoy the peacefully quiet surrounds while you sit, back and relax.

OPEN SAT 12.30-1.00PM

3 1 2

Contact Darren Mansell 0413 747 322

OPE

N

HOUSE

UNANDERRA 2/46 Central Ave $359,000

More Than Meets the Eye

Blue Chip Location

This charming home with periodic features and high decorative ceiling gives the feeling of space throughout the home. The large kitchen, lounge/formal dining and period style will delight you. Surrounding the home is a big veranda with an extra room that is currently done out as a hair salon. At the rear of the property is a large in ground pool. The large 699m2 yard can house up to 7 cars off the street.

OPEN SAT 11.30-12.00PM

4 2 2

Contact Maria Field 0411 306 323

OPEN

HOUSENEW

LISTING

MANGERTON 10 Payne St $443,000

This is your chance to step into the property market or increase your existing property portfolio. Now on offer is a very neat and complete 2 bedroom villa. Good sized lounge room with nice sunny windows. Tidy kitchen with breakfast bar. Upstairs main bedroom has its own balcony. And there is also your own carport. Currently tenanted for $290 p/wk. This one is a great little investment.

OPEN SAT 10.30-11.00AM

2 1 1

Contact Darren Mansell 0413 747 322

OPE

N

HOUSE

NEW

LISTING

ALBION PARL RAIL 9/30 Bateman Ave $242,000

Neat Modern Unit

Positioned on a generous 601sqm parcel in a peaceful setting, this completely renovated single level home is ideal for the young family while providing a great start to life. Featuring quality finishings and in a desired location, this is the perfect opportunity to sit back and relax because all the hard work has already been done.

OPEN SAT 12.30-1.00PM

3 1 4

Contact Maria Field 0411 306 323

OPE

N

HOUSE

NEW

PRICE

DAPTO 7 Kapooka AveOFFERS OVER $400,000

All the Hard Work is DoneOffering a blissful lifestyle only a short drive from the town centre, this private oasis, set on 2.3 acres, boasts limitless possibilities. Featuring panoramic rural views, you´ll admire both the simplicity and self sustainability of this stunning architecturally designed modern masterpiece. Offering style, sophisticated indoor/outdoor living, and a second residence, this eco friendly property is unmatched. Agents Interest Declared.

4 3 4+

Contact Maria Field 0411 306 323

YALLAH 27 Larkins Lane $1,198,000

Priceless Outlook

Showcasing an elevated setting, open plan interiors and a versatile floorplan, this modern family home is sure to have something for the whole family. Situated in prestigious Hermitage Estate, it features a large open kitchen and casual living/dining area that overlooks the raised and enclosed entertainment area.

OPEN SAT 1.30-2.00PM4 2 2

Contact: Maria Field 0411 306 323

OPE

N

HOUSE

DAPTO9 Chardonnay Ave $448,000

Perfect Family HavenLocated in a tranquil family-friendly pocket, this striking residence presents an inviting living environment. Neatly presented, it offers a relaxed and low maintenance lifestyle ideal for family living. Within a short walk to schools, parks, shops and public transport this property is the perfect family starter.

OPEN SAT 11.30-12.00PM

3 1

Contact: Darren Mansell 0413 747 322

OPE

N

HOUSE

KOONAWARRA19 Culgoa Cres $279,000

Perfect Family StarterCommanding an elevated position, this eye catching character filled residence will please the senses and ignite the imagination. Offering three good sized bedrooms, neat open kitchen, entertaining courtyard with enchanting gardens and double lock up garage with workshop area.

OPEN SAT 10.30-11.00AM

4 2 2

Contact: Maria Field 0411 306 323

OPE

N

HOUSE

FIGTREE12 Zelang Ave $438,000

Character And CharmNestled in a highly sought after location with escarpment views, a unique opportunity exists to purchase two great homes on one large 1000m2 block of land. Main residence with private in ground solar heated pool. Secondary is ideal for grandparents or to rent out for of $280 - $300 p/w

6 2 3

Contact: Darren Mansell 0413 747 322

CORDEAUX HTS2 Mungurra Hill Rd $799,000-$835,000

Two Homes For One Price

Located moments away from Shellharbour´s cafes and beaches this 2 bedroom unit complete with open plan kitchen/dining/lounge is a must for any first home buyer or couple that want to downsize in a relaxed environment. Potential rental income of $285 per week.

OPEN SAT 2.30-3.00PM2 1 1

Contact: Darren Mansell 0413 747 322

OPE

N

HOUSE

BARRACK HEIGHTS7/4 Blackbutt Way $229,000

All At Your Fingertips!Located only moments from the South Shellharbour beach and within walking distance to picturesque Shellharbour this perfectly flat 751sqm parcel of land offers a wonderful opportunity to build your dream home. Currently the only flat block of land within walking distance to the beach.Contact: Darren Mansell 0413 747 322

SHELLHARBOUR19 Boollwarroo Prd $550,000

Location, Location, Location

This exceptional family residence emanates contemporary luxury and elegance. Providing a choice of formal and casual living areas that spill outdoors to the enclosed entertainment area and a large landscaped backyard, this residence is perfect for the family.

4 2 3

Contact: Maria Field 0411 306 323

SHELL COVE3 Green Cres $644,500

Designer Living

Situated in "The Pines" release of the exclusive Shell Cove estate, this prime parcel of land is surrounded by quality homes and sits right next door to a park complete with a children´s play centre. Handily positioned close to Schools, Community Centre and the new Medical Centre.Contact: Maria Field 0411 306 323

SHELL COVE6 Montague Cres $249,000

Magical Montague

This tastefully decorated ground floor unit has it all and is in close proximity to just about everything. Offering polished floors, brand new kitchen, BIW to main bedroom, internal laundry, off street parking and a massive common backyard. Close to shops, schools, public transport and a stone´s throw to the beach.

2 1

Contact: Matt Hutchinson 0423 507 488

BELLAMBI4/20 Owen Park Rd $269,000

Get In On The Ground Floor

An opportunity presents to purchase the final block available on prestigious Southern Cross Boulevard in Shell Cove. Why not build your dream home right here on this lovely flat block surrounded by quality homes. Only minutes away from Shellharbour Village and the proposed marina.Contact: Maria Field 0411 306 323

SHELL COVE56 Southern Cross Bvd $289,000

Lifestyle, Position And PotentialFall in love with this beautiful family home. Three bedrooms and a fully renovated bathroom. Good size kitchen/dining room and separate lounge. Brand new Colourbond roof and gutters on the house and garage. Flat block and great size backyard for the kids to play. Oversized single garage for your car.

3 1 1

Contact: Darren Mansell 0413 747 322

WARILLA19 Spofforth St $269,900

First Home Buyers DelightNestled in the heart of Port Kembla´s thriving CBD, this fantastic unit is an investement opportunity not to be missed. Featuring 2 large second floor bedrooms and an open plan kitchen/dining area, the first to see this property will buy. Complete with undercover parking and currently rented out at $230 per week.

OPEN SAT 1.30-2.00PM2 1

Contact: Darren Mansell 0413 747 322

OPE

N

HOUSE

NEW

PRICE

PORT KEMBLA2/173 Wentworth St OFFERS OVER $185,000

Owner says SELL!!!

Page 56: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

R&H Wollongong 4229 9600

27/40 McCauley Street, ThirroulUltra Modern Living• Ultra modern 3 bedroom apartment• Spacious open plan living• Stylish kitchen finished with s/s appls & gas cooking• Entertain on the large terraace with mountain views• Relax and enjoy the low maintenance lifestyle • Within walking distance to Thirroul Village, beach cafes, public transport and schooling

3 2 2AUCTION 28/3/12

rhw.com.au

By Appointment

Kayla Watchorn 0424 503 316

Mathew Ivanoff 0419 768 412

View

Agents

56 28 February 2013

1Ideally positioned to schools,shops and transport. This solid 3 bedroom brick veneer and tile home has much to offer and includes:

Ducted air con, large lounge, separate dining area, rear rumpus, sunroom, 2nd shower, spacious laundry and covered outdoor area with rear storage sheds. Complete with double lock up garage with single remote access.

Immaculately Presented

251 Kanahooka Drive, Kanahooka $369,000 3 2 2

1Exceptional villa in quiet block of 4 offering wheelchair access. Bedrooms with built in robes, two large bathrooms with spa in main and spacious lounge.

Bright and sunny rear courtyard and garden complete with double carport. Strata - $519 p/q, Council - $290.40 p/q, Water - $181.51 p/q, Rent - $340p/w.

Plenty to Offer

2/10 Owen Park Road Belambi $349,000 3 2 2

1This bright and sunny 3 bedroom unit is hard to beat for value with built-ins in the main bedroom, separate dining area, huge balcony, modern kitchen and spacious bathroom with separate bath.

This property is located in a quiet location and is currently tenanted and includes an off street parking space. Council $269.32p/q, Water $139.10p/q, Strata $550.00p/q.

Huge Sunny Balcony

5/4 St Lukes Ave, Brownsville $179,900 3 1 1

Page 57: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

R�H Austinmer 4268 1399

74 Mountain Road AustinmerPanoramic Views � AcreageComfy cottage to live in whilst planning the dream home on one of the last 2.89acre properties with panoramic coastal views. 1st time offered in 70 years.

View Saturday 3.00-3.30pmPrice Expressions of InterestAgent John McGuiness 0402 021 527

3 2 1

raineandhorne.com.au/austinmer

Open Satu

rday

R�H Austinmer 4268 1399

3/43 Mountain Road AustinmerWhat a Villa in Austi!´Rarer then hen´s teeth´, retirees & new families; walk to station, shops & beach; immaculately maintained; great features: air cond; courtyard; seaside weekender.

View Saturday 2.30-3.00pmPrice $499,000Agent Lisa de Ruyter 0438 684 014

2 1 1

raineandhorne.com.au/austinmer

Open Satu

rday

R�H Austinmer 4268 1399

55 Armagh Pde ThirroulPeaceful Setting, Ocean ViewsFamily home modern kitchen & distant ocean views. Spa bathrm off downstairs retreat plus storage, good bones & peaceful setting on serene 910sqm block.

View Saturday 12.30-1.00pmPrice $699,000Agent John McGuiness 0402 021 527

4 2 2 1

raineandhorne.com.au/austinmer

New O

pen Satu

rday

91 Panorama Dr, Farmbrough HtsEnjoy the Outlook• Well presented single level brick home• Modern kitchen and bathroom with BIWs• Large nth facing living with amazing views• Undercover outdoor entertaining area• Huge drive through garage with storage

3 1 1

Saturday 11-11.30 + 2-2.30pm

$375,000 - $385,000

Joshua Kersten 0419 991 500Kayla Watchorn 4229 9600

View

Price

Agents

R&H Wollongong 4229 9600

rhw.com.au

217 Nolan Street, BerkeleySubstantial Home for the Family• 4 bedroom brick family home• Neat and tidy kitchen BIWs in all bedrms• Paved outdoor entertaining area• Elevated grass yard, huge 4 car garage • Down stairs rumpus area or 5th bedroom

4 2.5 4

Saturday 1.00 - 1.30pm$395,000Joshua Kersten 0419 991 500Kayla Watchorn 4229 9600

ViewPriceAgent

rhw.com.au

R&H Wollongong 4229 9600

39 Valley Drive, FigtreeDeceivingly Unique

4 2

• Immaculate & well presented home• Modern kitchen adjoins open plan living • Main bedroom with ensuite & WIR• A huge family room & outdoor area • Rear lane access, everything you want!

Raine & Horne’s extensive global database exposes your property to over 1 million qualified buyers. We will effectively and efficiently match your property to qualified buyers, extending your property’s reach and ultimately resulting in a premium sale price.

So if you’re looking to sell your home this autumn, call Raine & Horne Wollongong and let on of our passionate people lead you in the right direction...

• Beachhouse plus granny flat 1 hour sth of sydney• 3 bedrm house 2 bathrooms, Rented for $450 pw• Separate 1 bedroom studio apartment, new bathroom & kitchen, potential rent $195 pw• Lake 5 minutes walk away, fishing & prawning

99 Ocean St, WindangWalk out the Back Gate to the Beach

4 3 1

Saturday 12.00 - 12.30pm

$599,000 - $620,000

Joshua Kersten 0419 991 500Kayla Watchorn 4229 9600

View

Price

Agents

R&H Wollongong 4229 9600

rhw.com.au

Saturday 11-11.30 + 1-1.30pm

$499,000 - $529,000

Joshua Kersten 0419 991 500Kayla Watchorn 4229 9600

View

Price

Agents

R&H Wollongong 4229 9600

rhw.com.au

rhw.com.au

we know where to look...

Joshua Kayla Mathew Alex

28 February 2013 57

R�H Kiama4232 1688

71 Nuninuna Drive, Jamberoo100 ACRES - MORTGAGEE SALE

Scenic Saddleback Mountain location. Vacant land. Building permit. Private and quiet. Mixture of open grazing land and natural forest. Only approx 10 minutes drive to Kiama township and 15 minutes to freeway north to Wollongong and Sydney. Rare opportunity. Not too many available giving you the opportunity to build your own home.

ViewBy Appointment

AuctionThursday 21st March 2013

AgentSteve Pryor0408 423 [email protected]

rh.com.au/Kiama

AUCTION

Page 58: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

AUSTINMER $799,000

Situated high above the rest is this amazing property encompassing 180 degree views of the Pacific Ocean through to the Illawarra escarpment. Watch the sun rise and the whales play from your large lounge room with balcony. Featuring 2 bedrooms, modern kitchen with Caesar stone kitchen and gas cooking, huge bathroom with combined laundry, outdoor private courtyard and undercover parking. A superb location for those who want to downsize, have the perfect weekender or a sound investment.

JUST LISTED

JUST LISTED

BULLI $825,000

Situated in a desirable East Bulli location with less than 230m (approx) walk to beaches and on a level 556m2 approx block within an ultra quiet cul-de-sac. Featuring 4 large beds, upstairs living area & downstairs rumpus, eat in kitchen & 2 bathrooms.

WOMBARRA $925,000

This immaculate property is nestled in the foothills of the escarpment and has privacy and tranquillity in mind. See nothing but trees from every outlook of this home yet you´re only minutes to Wombarra Beach.

THIRROUL $729,000

This four bedroom home is a great way for you and your family to begin a new life in the beautiful Thirroul area. With amazing views, a sparkling in-ground pool and located at the cul-de-sac end of a quiet street, this home is sure to impress.

WOONONA $630,000

Large & modern best describes this property. Offering 4 beds, main with ensuite & WIR, large living area, separate dining off modern kitchen opening out to entertaining area. Dbl garage & landscaped gardens complement this immaculate home.

JUST LISTED

BALGOWNIE $489,990

This well maintained, three bedroom brick home is located on a level block and just minutes from the beautiful Balgownie shops, cafes and Bars. Other features include a neat kitchen & bathroom, floating floors and plenty of room for the family to grow.

BULLI $509,000

Beautiful leafy backdrop and located in a quiet street of Bulli, this home features 3 bedrooms, separate lounge & dining, large kitchen and a beautiful in-ground pool with a bathroom attached. It has the tranquillity you have been looking for.

JUST LISTED

BULLI $445,000

This level block of land is set amongst quality homes and is less than 800m (approx) walk to Bulli Beach. It offers easy access to shops, schools and public transport. Approx 457.6m2 with house plans available upon request.

JUST LISTED

WOONONA $545,000

This beautiful, recently renovated, three bedroom home is all ready to go. With a new kitchen, floating floors, guest accommodation or rumpus, new carpet, fresh paint & a sparkling new bathroom, this home would suit any family or first home buyer.

RUSSELL VALE $579,000

Newly renovated top level has 2 beds, rumpus room for the kids and a new bathroom. Downstairs, the large kitchen, separate lounge and dining, 2 bedrooms second bathroom & a beautiful pool will definitely not disappoint.

CORRIMAL $619,000

An impressive double fronted two level family home on a 746m2 approx block. Open plan living & dining, designer gourmet kitchen & entertaining terrace. 5 beds, main with ensuite & WIR. Rumpus room, Internal laundry & LUG with internal access.

WOONONA $260,000

Don´t miss this opportunity to be in a new home located in a quiet street of Woonona. This location is in one of the best spots of the beautiful Woonona area and on a near level block leaving your imagination free to run wild (Subject to WCC Approval).

JUST LISTED

BULLI $405,000

Recently renovated, this villa has all the hard work done for you. With three bedrooms, built-ins to all, paved court yard perfect for entertaining, new carpet and a stunning new kitchen, this villa would rival any other in the northern suburbs area.

Page 59: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Dougmal Harcourts Albion Park4256 3122 dougmalalbionpark.harcourts.com.au

Rare opportunity... Auction not to be missed! Tucked away in the exciting Tullimbar Village this property consists of 3 double sized B/R´s + open study, master has WIR & ensuite. Two sep living quarters + formal dining, full ducted air, must see kitchen & two well appointed bathrooms, outdoors entertain with covered pergola area overlooking sparkling I/G pool, double garage on remote control + reserve at rear.OPEN HOME: Saturday 2nd March 10.15 - 11.00 amAUCTION: Saturday 2nd March 11.00 am OnsiteVIEW AT: www.dougmalalbionpark.harcourts.com.au

Daniel McConnellM: 0405 454 624E: [email protected] Harcourts Albion Park 4256 3122

Tullimbar 34 Broughton Avenue AuctionRelax Pool Side!!

AUCTIO

N

The South Coast’s most anticipated Auction is finally here! Truly one of a kind acreage 14.7 acres in total with approx 7 acres of cleared land, picture perfect & bristling with wildlife this property is a must see for all parties looking to escape the rat race. Quality 3 B/R homestead, 3 bathrooms, 5 bay machinery shed, cascading waterfalls, above ground power, 3 reliable water sources & newly sealed road access.OPEN HOME: Saturday 2nd March 11.30 - 12.30 pmAUCTION: Saturday 2nd March 12.30 pm OnsiteVIEW AT: www.dougmalalbionpark.harcourts.com.au

Daniel McConnellM: 0405 454 624E: [email protected] Harcourts Albion Park 4256 3122

Yellow Rock 513 Yellow Rock Road AuctionIllawarra’s Best Kept Secret!!

ACREA

GE

The complete family home...Quality brick & tile home tucked away in quiet loop circuit all within short stroll to Albion Park C.B.D. 4 B/R’s, master with ensuite & WIR, air con formal lounge & formal dining, separate lovely light filled family room, large "modern" well appointed kitchen & bathroom + double garage. Outdoors entertain with huge covered high pitched pergola as kids play endlessly around the in-ground pool & tidy grassed yard... Enjoy stress free living at its best! Motivated Vendors - Slashed thousands overnight. Hurry!VIEW AT: www.dougmalalbionpark.harcourts.com.au

Daniel McConnellM: 0405 454 624E: [email protected] Harcourts Albion Park 4256 3122

Albion Park $449,000No Need To Compromise... This One Has It All

Perfectly nestled in one of Albion Park’s finest locations, high set in executive cul-de-sac. 4 B/R’s + huge downstairs home office all with built-ins, oversized master boasts WIR, ensuite & lake views. Open formal lounge, formal dining + family/meals, well appointed kitchen, must see stunning master bathroom with big corner spa bath, oversized double garage + separate carport. Outdoors covered ent area, I/G "indoor" heated pool, tidy level grassed yard & views forever. Truly unique property... outstanding value under $500k!VIEW AT: www.dougmalalbionpark.harcourts.com.au

Daniel McConnellM: 0405 454 624E: [email protected] Harcourts Albion Park 4256 3122

Albion Park $499,900Making A Splash!!

NEW

Perfectly tucked away in sought after cul-de-sac this stunning Beechwood family home is sure to impress all. Fresh, bright & vibrant throughout offering 4 spacious B/R’s, master boasts WIR & ensuite, large formal lounge & formal dining area + beautiful light filled family room with air conditioned rumpus. Quality kitchen & bathroom + rare 3 car garage on remote with single drive through & internal access, covered pergola/jacuzzi area & tidy grassed yard. OPEN HOME: SUNDAY 3rd March 11.30 - 12.00 pmVIEW AT: www.dougmalalbionpark.harcourts.com.au

Daniel McConnellM: 0405 454 624E: [email protected] Harcourts Albion Park 4256 3122

Albion Park 5 Ashton Close $489,900Triple Treat!!

NEW

Quality brick & tile family home ideally set on spacious block in handy location, brand new to the market & not to be missed. This ex show home offers loads of extras including 4 bedrooms, master with ensuite, multiple separate living quarters filled with lovely natural light, well appointed kitchen & large master bathroom. Keep comfortable all year round with full ducted air conditioning throughout + double garage, open entertainment area & spacious level grassed yard.OPEN HOME: SUNDAY 3rd March 10.30 - 11.00 amVIEW AT: www.dougmalalbionpark.harcourts.com.au

Daniel McConnellM: 0405 454 624E: [email protected] Harcourts Albion Park 4256 3122

Albion Park 5 Daintree Drive $439,900Family Value!!

OPEN

SUNDAY

Ideal investment opportunity... Must see "free standing" villa in extremely handy location, literally metres to Albion Park C.B.D. Large open flowing floor plan incl formal lounge & dining area, spacious bedroom with BIW, tidy well appointed kitchen & bathroom + oversized lock-up garage with internal access. Outdoors enjoy low maintenance courtyard & off street parking. All set in lovely complex yet tucked away completely free standing with its very own drive way.OPEN HOME: SUNDAY 3rd March 12.30 - 1.00 pmVIEW AT: www.dougmalalbionpark.harcourts.com.au

Daniel McConnellM: 0405 454 624E: [email protected] Harcourts Albion Park 4256 3122

Albion Park 1/72-74 Terry Street $259,900Size Will Pleasantly Surprise!!

OPEN

SUNDAY

Spectacular "Torrens Titled" duplex only 12 months young all while perfectly tucked away in quiet cul-de-sac capturing jaw dropping views. Impressive even to the most fastidious of buyers. Not your average duplex, 3 large B/R’s + study , must see air con open plan living, huge covered balcony, 2 quality bathrooms, deluxe polyurethane kitchen & double garage with internal access. Outdoors enjoy this luxurious duplex with tidy level grassed yard, 2 sep entertainment areas & views forever. Best of the best, size, quality & condition!!VIEW AT: www.dougmalalbionpark.harcourts.com.au

Daniel McConnellM: 0405 454 624E: [email protected] Harcourts Albion Park 4256 3122

Albion Park $469,900A Stand Out In Today’s Market!!

Dougmal Harcourts Wollongong4229 8255 dougmalwollongong.harcourts.com.au

• Open plan design with combined living/dining area & sleek seamless kitchen.• Three huge bedrooms all with custom made built-in wardrobes. Main with ensuite• Ample outdoor living with wrap around balconies on both top and bottom levels• Full bathroom finished in fresh decor with quality fittings including double vanity• Secure, under building double lock up garage plus store room adjacent.• Access to swimming pool & beautiful mountain & city views complete the picture.

OPEN HOME: Saturday 2nd March11-11.30am2 -2.30pm

WEB ID#: harcourts.com.au/nwg4794

3 3 2

Adrian D´AmicoM: 0402 224 559E: [email protected] Harcourts Wollongong 4229 8255

Wollongong 58/3-15 Belmore Street Offers above $699,000Two level Penthouse apartment in ultra-convenient location

VIEW AT: dougmalwollongong.harcourts.com.au

• Recently renovated 3 bedroom home all with built in robes• Polished Timber flooring, modern kitchen & large open plan living • Covered deck perfect for outdoor entertaining, as well as yard • Walk to Cedars Christian college, Farmborough Road Public as well

as Unanderra CBD & child friendly parks.• Land Size 720sqm, great starter or investment.

OPEN HOME: Saturday 2nd March 12.45 - 1.15pmVIEW AT: harcourts.com.au/nwg4769

Adrian D´AmicoM: 0402 224 559E: [email protected] Harcourts Wollongong 4229 8255

Farmborough Heights 75 Waples Road Offers above $319,000The Price is Right

A not to be missed opportunity, arguably the most inexpensive block on the market in this area. Take advantage of the New Home Owners Grant offers $15,000 to eligible buyers building their own home. In addition, you may be eligible for stamp duty concessions & rebates of up to $20,000! Looking for land for sale in the exclusive Keiraville area? Cosgrove Gardens is a choice like no other. Its exclusivity, land sizes and location ensures you’ll find a home to meet your budget & lifestyle needs. This rare, three lot subdivision offers a location you’ll never want to leave.

Adrian D´AmicoM: 0402 224 559E: [email protected] Harcourts Wollongong 4229 8255

Keiraville Lot 1 Cosgrove Avenue Starting from $245,900Cosgrove Gardens

Situated within walking distance to Wollongong Train station, Shops & Wollongong Hospital, this home unit has two large bedrooms, open lounge & dining area & original kitchen. Bathroom with bath, shower & toilet & Shared laundry downstairs Huge capital growth or a solid income stream as an investment, currently rented @ $170 per week with enormous scope for improvement. Constructed with full brick and recently repainted internally. Ideal for the first homebuyer or investor. OPEN HOME: Saturday 2nd March, 11.45am -12.15pmVIEW AT: dougmalwollongong.harcourts.com.au

Adrian D´AmicoM: 0402 224 559E: [email protected] Harcourts Wollongong 4229 8255

Coniston 2/13 Pine Street $215,000 -$255,000Affordable, Convenient & Great Potential!

Top floor 2 bedroom unit, modern renovated kitchen, remodelled bathroom, own laundry and under building parking. Good clean unit with a delightful aspect. As for location a level walk to Crown Street, Wollongong harbour & beach. On today´s market, rarely available in this position and in this price range.

OPEN HOME: Saturday 2nd March, 10 -10.30amVIEW AT: dougmalwollongong.harcourts.com.au

Greg ChadwickM: 0408 422 644E: [email protected] Harcourts Wollongong 4229 8255

Wollongong 24/48 Smith Street $310,000Right in the heart of Wollongong

Page 60: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Dougmal Harcourts Kiama4232 1322dougmalkiama.harcourts.com.au

Occupying an impressive 2,141m2 of land with an elevated aspect, this original character filled home offered for the first time in over 25 years, boasts a warm, welcome ambience, light filled living areas highlighted by ocean and rural outlooks.

OPEN HOME: Saturday 2 March12.00-12.30pm

AUCTION: Saturday 16 March 2013WEB ID#: NKM4523VIEW AT: dougmalkiama.harcourts.com.au

5 2 2

Andy WhartonM: 0412 638 708E: [email protected] Harcourts Kiama 4232 1322

Kiama Heights 29a South Kiama Drive AUCTIONPrivate & Peaceful

• Large open plan kitchen dining room • Formal and casual living spaces• Both bathrooms recently renovated• Main bedroom has walk through robe and full ensuite

OPEN

Sleek and Stylish, this Torrens Title townhouse has a fantastic central location. A generous open plan living area flows onto an alfresco deck offering relaxed low maintenance living. • Generous bedrooms with built-in robes

OPEN HOME: Saturday 2 March10.30-11.00am

AUCTION: Saturday 23 MarchWEB ID#: NKM4539VIEW AT: dougmalkiama.harcourts.com.au

3 2 2

Andy WhartonM: 0412 638 708E: [email protected] Harcourts Kiama 4232 1322

Kiama 152 Terralong Street AUCTIONCenter Stage

• Double garage with auto door and internal access• Entertainers kitchen• Spacious enclosed garden

NEW LIS

TING

OPEN H

OUSE

Page 61: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Dougmal Harcourts Kiama4232 1322dougmalkiama.harcourts.com.au

NEW LIS

TING

OPEN H

OUSE

Desirably positioned in a leafy cul-de-sac, this private dual level residence is instantly appealing and features a variety of indoor and outdoor areas perfect for entertaining.• Spacious open plan living area• Alfresco entertaining deck overlooks the in-ground pool• New granite kitchen has gas cooking and dishwasher• Situated on a 664.1m2

OPEN HOME: Saturday 2 March1:00 - 1:30pm

WEB ID#: NKM4526

4 2 2

Andy WhartonM: 0412 638 708E: [email protected] Harcourts Kiama 4232 1322

Kiama Downs 5 Elliott Place $630,000Resort style living

VIEW AT: dougmalkiama.harcourts.com.au

NEW

LIST

ING!

Contemporary in style and set in generous and picturesque back yard this hard to resist property offers a level living mix of open plan design with a family friendly layout.• Spacious lounge & dining area combined with casual family areas• Separate study could allow for home/work situation

OPEN HOME: By AppointmentWEB ID#: NKM4544

4 2 2

Susan SpenceM: 0412 271 091E: [email protected] Harcourts Kiama 4232 1322

Kiama 10 Danube Street $765,000Just add your family!

VIEW AT: dougmalkiama.harcourts.com.au

OPEN

Commanding an enviable position overlooking the dramatic southern coastline and built to capture aspect and views this eye-catching property leaves nothing to be desired.• Parents retreat with separate living & ensuite bathroom• 2nd bedroom with walk-in robe & sitting area• Modern, well appointed kitchen accessing outdoor entertaining & pool

OPEN HOME: Saturday 2 March1.30-2.00pm

WEB ID#: NKM4493

3 2 2

Susan SpenceM: 0412 271 091E: [email protected] Harcourts Kiama 4232 1322

Kiama Downs 38 Eureka Avenue $1,150,000Surf watch

VIEW AT: dougmalkiama.harcourts.com.au

OPEN

NEW LI

STIN

G!

2 1 2

Andy WhartonM: 0412 638 708E: [email protected] Harcourts Kiama 4232 1322

Just minutes walking distance to Surf Beach and Kiama´s café society, this contemporary single level villa in an established complex. • Spacious living area• Rear deck & landscaped garden• Built-in wardrobes

OPEN HOME: Saturday 2 March2.00-2.30pm

WEB ID#: NKM4533

Kiama 14/130 Shoalhaven Street $365,000Great design & well located

VIEW AT: dougmalkiama.harcourts.com.au

NEW LI

STIN

G!

2 2

Susan SpenceM: 0412 271 091E: [email protected] Harcourts Kiama 4232 1322

Peacefully tucked away in a boutique block of 6, this top floor apartment offers an appealing easycare lifestyle or investment opportunity in a tightly-held enclave.Its central position is just metres to Kiama´s village shopping precinct, restaurants, cafés and easy walking distance to our famous blowhole, Harbour and Surf beach.• Security parking• Spacious entertaining deck

OPEN HOME: By AppointmentWEB ID#: NKM4537

Kiama 6/75 Shoalhaven Street $479,000Top Spot!

VIEW AT: dougmalkiama.harcourts.com.au

Page 62: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Dougmal Harcourts Northern Suburbs4284 8833www.dougmalwoonona.harcourts.com.au

AUCTIO

N THIS

SATU

RDAY

Get ready to renovate this three bedroom clad home with a pressed tin roof formal lounge and separate dining area, eat in kitchen, modern bathroom, tandem lock up garage, terraced garden with space for the kids plus a large vegetable patch. This property is only a short distance from the Corrimal shops and represents a great opportunity for the right buyer.

OPEN HOME: Saturdays11.00am-11.30am

AUCTION: Saturday 02/03/13 11.30amOn Site

3 1 2

Rod FinlayM: 0411 385 833E: [email protected] Harcourts Northern Suburbs 4284 8833

Corrimal 55 Underwood Street AUCTIONA Great Opportunity

VIEW AT: www.dougmalwoonona.harcourts.com.au

OPEN

3 1 1

Colin RobertsM: 0412 188 171E: [email protected] Harcourts Northern Suburbs 4284 8833

• Two storey brick veneer tile family home.• 3 bedrooms built in robes, plus study.• 2 separate living room.• Original kitchen and bathroom.• Single lock up garage with drive thru access.• Great level block, walk to shops, CBD.

OPEN HOME: Saturday 2/3/131.00pm-1.30pm

Corrimal 32 Thurston Crescent Expression of InterestGreat Home with Potential

VIEW AT: www.dougmalwoonona.harcourts.com.au

OPEN

2 1 1

Colin RobertsM: 0412 188 171E: [email protected] Harcourts Northern Suburbs 4284 8833

Stunning indoor & outdoor living. Gourmet kitchen with 40" Caesar stone bench tops, stainless steel appliances & island bench which over looks the open plan living/dining area. Large bi-folds that leads undercover outdoor alfresco living area. Huge bathroom - freestanding bath, semi-frameless shower, double free standing vanity and tiled to the ceiling. 2 huge bedrooms, polished timber floors throughout, landscaped yard & single lock up garage. Agents interest declared.

OPEN HOME: Saturday 2/3/131.00pm-1.30pm

Mount Ousley 19 Greenslopes Avenue $479,000Stunning - Ultra Modern - Alfresco Living

VIEW AT: www.dougmalwoonona.harcourts.com.au

OPEN

3 1 3

Colin RobertsM: 0412 188 171E: [email protected] Harcourts Northern Suburbs 4284 8833

• Great property with loads of potential for development.• This home has been renovated over time.• Modern laminated kitchen/dining area.• Separate cosy living area. Modern remodelled bathroom.• Polished timber floors throughout, separate study/office area.• 3 huge garages to accommodate all the toys great if you´re a tradie.

OPEN HOME: Saturday 2/3/1312.00pm-12.30pm

Corrimal 5 Robson Road $499,0002 street frontage, well maintained home.

VIEW AT: www.dougmalwoonona.harcourts.com.au

OPEN

Colin RobertsM: 0412 188 171E: [email protected] Harcourts Northern Suburbs 4284 8833

• Move Straight in and enjoy your retirement or care free lifestyle.• Spacious living and dining room.• Separate laminate kitchen.• 2 bedrooms both with built in robes.• Single modern bathroom.• Private courtyard, single garage with remote

OPEN HOME: Saturday 2/3/1310.00am-10.30am

Bellambi 8/74 Cawley Road $289,000Modern Single Level Villa

VIEW AT: www.dougmalwoonona.harcourts.com.au

OPEN

Rod FinlayM: 0411 385 833E: [email protected] Harcourts Northern Suburbs 4284 8833

Free standing two storey townhouse with open plan lounge/ dining and modern kitchen, three large bedrooms with built in robes, a spacious bathroom with shower and bath, two toilets, double garage, ducted air upstairs, second unit down, tank water, easy care garden and much, much more.

OPEN HOME: Saturday 2/3/1312.30pm-1.00pm

Woonona 8/26 Popes Road $450,000Style, Space and Presentation

VIEW AT: www.dougmalwoonona.harcourts.com.au

OPEN

4 2 2

Rod FinlayM: 0411 385 833E: [email protected] Harcourts Northern Suburbs 4284 8833

• 4 bedroom Brick and tile home.• Open plan lounge, dining and kitchen.• Built ins in all bedrooms, master with ensuite.• Second bathroom with shower and bath, vanity on ground floor.• Double garage with internal access, covered entertaining area.

OPEN HOME: Saturday 2/3/131.30pm-2.00pm

Woonona 94A Popes Road $650,000Just Completed- Brand New

VIEW AT: www.dougmalwoonona.harcourts.com.au

Page 63: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Dougmal Harcourts Dapto4261 3211dougmaldapto.harcourts.com.au

OPEN

HOUSE

• Three great sized bedrooms, all with high ceilings, vertical blinds and carpeted. • Recently renovated bathroom, fully tiled with shower over bath and toilet included• Front living area with northern aspect opening onto the tiled dining area and

modern kitchen with electric stove and lots of cupboard storage• At the back, there is a fully fenced, huge yard with large loft included• Large single car garage with a lengthy driveway been able to host many cars

OPEN HOME: Saturday 2 March11.40am - 12.00pm81 Byamee Street, Dapto

WEB ID#: NDP5439

3 1 1

Mitchell James M: 0413 097 710E: [email protected] Harcourts Dapto 4261 3211

Dapto 81 Byamee Street $330,000Location Location Location

VIEW AT: dougmaldapto.harcourts.com.au

OPEN

HOUSE

• All bedrooms with timber floorboards and ceiling fans, main and 2nd with BIWs• Renovated kitchen with stainless steel gas stove and loads of benchspace• Large carpeted living area with reverse cycle air conditioning plus spacious dining

area with timber floors • Single car garage with combined laundry, 2nd shower and toilet and two rooms• Ideal entertaining deck in the rear yard with gas point and garage access

OPEN HOME: Saturday 2 March11.00am - 11.20am5 Kapooka Avenue, Dapto

WEB ID#: NDP5387

3 2 1

Ben JamesM: 0422 244 098E: [email protected] Harcourts Dapto 4261 3211

Dapto 5 Kapooka Avenue $359,000Starting Up or Slowing Down

VIEW AT: dougmaldapto.harcourts.com.au

OPEN

HOUSE

• Without doubt, this two bedroom unit is one of the best you will find in Wollongong• Two great sized bedrooms, both carpeted with mirrored built in robes and timber blinds• Open plan, bright living dining and kitchen area with mountain views and balcony access• Fresh kitchen with electric stove, overhead cupboards and plenty of room to move• Single lock up manual garage plus balcony with fold away clothesline and room for a BBQ• Great unit complex with low strata rates and only minutes travel to North beach, the University

of Wollongong Innovation Campus and Wollongong CBD

OPEN HOME: Saturday 2 March10.00am - 10.20am11/54 Church Street, Wollongong

WEB ID#: NDP5429

2 1 1

Mitchell James M: 0413 097 710E: [email protected] Harcourts Dapto 4261 3211

Wollongong 11/54 Church Street $335,000The One You’ve Been Praying For

VIEW AT: dougmaldapto.harcourts.com.au

• 3 great sized bedrooms, all with floorboards and mirrored BIWs• Open plan living area with new lighting, polished floorboards and

tiled dining off the kitchen which has Ceasar stone benchtops, electric cooking facilities and great access to the huge back deck

• Decent sized rear yard with fantastic entertaining deck and single lock up garage, looking for a family to move in and enjoy!

OPEN HOME: Saturday 2 March2.00pm - 2.20pm

VIEW AT: harcourts.com.au/ndp5433

Ben JamesM: 0422 244 098E: [email protected] Harcourts Dapto 4261 3211

Mt Warrigal 97 Cuthbert Drive $395,000Tip Top from Head to Toe

OPEN

HOUSE

• 3 bedrooms with polished timber floors and 2 with BIWs• Fantastic modern kitchen boasting a large stainless steel 5 burner

gas stove, perfect for the chef of the home, plus dishwasher • Meals area off the kitchen, formal dining room and living with a/c• Fully fenced yard, great covered back deck plus detached games

room and above ground poolOPEN HOME: Saturday 2 March

11.00am - 11.20amVIEW AT: harcourts.com.au/ndp5395

Mitchell James M: 0413 097 710E: [email protected] Harcourts Dapto 4261 3211

Dapto 8 Prince Edward Drive $329,000Here’s a Gem, and so close to Town!

OPEN

HOUSE

• 3 bedrooms, all with new carpet, mirrored BIWs and main with a/c• Open plan living, dining and kitchen area with floating floors and a/c• Brand new modern kitchen with electric cooktop, wall oven and

boasting a great amount of cupboard space and storage• Single detached garage with remote controlled door

OPEN HOME: Saturday 2 March11.40am - 12.00pm

VIEW AT: harcourts.com.au/ndp5379

Ben JamesM: 0422 244 098E: [email protected] Harcourts Dapto 4261 3211

Dapto 36 Parkside Drive $335,000Premium Renovation Complete, the Ultimate Buyer Wanted

OPEN

HOUSE

• 4 bedrooms, main with ensuite and all with BIW, downstairs study• Modern timber kitchen featuring s/s appliances and gas cooktop

and dishwasher, formal lounge and dining area• Family room off kitchen with access to entertaining area• Granny Flat featuring kitchenette, own bathroom, great sized living

area and huge bedroom with air conditioningOPEN HOME: Saturday 2 March

1.00pm - 1.20pmVIEW AT: harcourts.com.au/ndp5373

Michael GarsideM: 0414 490 595 E: [email protected] Harcourts Dapto 4261 3211

Horsley 12 Glengarry Way $510,000 - $550,000Executive Style Family Home

OPEN

HOUSE

Page 64: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

R E A L E S T A T E

Level 1, 65 Market Street, Wollongong

View more properties: www.mcphailrealestate.com

ON SITE AUCTION

12PM - 16 M

ARCH 2013

1 Juanita Avenue TOWRADGIOpen For Inspection : Saturday 11:00am to 11:45am

• A unique beachside location and lifestyle is on offer with this much loved single level home in a quiet peaceful location - just 500 metres from the surf and sand!• Light and airy with 3 spacious bedrooms, it includes high ceilings throughout the separate lounge and dining areas, renovated bathroom and modern kitchen.• Large detached double garage and low maintenance established gardens and grounds. Near level sunny north facing 556 sqm block with all services available.• Convenient located to Wollongong CBD, Wollongong University and Expressway access to Sydney - Jump on the bike track and explore the coastline with the kids! • Offer now or at Auction on site - Saturday 16th March 2013 at 12-00pm.

Contact: David Meikle 0412 422 294

3

1

2

Towradgi Offer Now or at AUCTION

2 Boundary Road WINDANGOpen For Inspection : Saturday 10.15 am till 10.45 am

• - this home features 3 big bedrooms with biws plus study or 4th bedroom • Spacious master suite featuring ensuite and walk in robe• Tremendous open living space with stunning floating floors and tiles throughout• Swish kitchen dining/living areas opening out to the covered entertaining area• Large level block with double garage, as new property thru out- Must Inspect

Contact: Daniel Ellem 0410 868632

Windang $495,000

NEW PRICE

89 Chillawong Circuit BLACKBUTTOpen For Inspection: Satruday 11.15 am till 11.45 am

• Single level and tile home• Open plan living areas- Modern kitchen with dishwasher-Bar and entertaining area• Fully enclosed pool area plus easy care gardens and grounds- Just Relax this summer• Located in a quiet residential area within walking distance to shellharbour square shopping

Contact: Daniel Ellem 0410 868632

4

1

1

Blackbutt $390,000

OPEN DAY

NEW LISTING

45 Montague StreetInspections: By Appointment Only

• Conveniently located in popular North Wollongong Montague Street Light Industrial area.• Level 2441 sqm block - Zoned IN2 Light Industrial - No under ground storage tanks.• High clearance metal clad workshop (750 sqm) - offices (65 qm) -amenitities block (65sqm)• Currently leased with 2 tenancies - Head tenant and Telstra - Gross $115,000 plus GST• 100% Outgoings paid by lessee - Head lease expiry 7/2013 with further 3 year option.

Contact: David Meikle 0412 422 294

North Wollongong $1.3 Million plus GST

OPEN HOUSE

4/46-48 Corrimal Street WOLLONGONGOpen For Inspection : Saturday 12 Noon till 12.30 pm

• - modern three bedroom home unit in small block of 6 • Spacious kitchen, adjacent dining and sunny lounge area & recently carpeted throughout.• Light, bright and airy with wrap around balconies and sliding glass doors• Three generous bedrooms with BIW’s, master with ensuite and access to private balcony• Well maintained gardens and grounds, no lift plus double remote control lock-up garage.

Contact: David Meikle 0412 422 294

3

2

2

Wollongong $519,000

Page 65: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

R E A L E S T A T E

Level 1, 65 Market Street, Wollongong

View more properties: www.mcphailrealestate.com

NEW LISTING

315 Cordeaux RoadOpen For Inspection: Saturday 2:00pm to 2.30pm

• Located in the heart of historic Mt Kembla Village with views north across to Mt Keira.• Charismatic 2 bedroom cottage with timber lined walls & ceilings with polished floorboards.• Plenty of storage, 2 BIW’s, split system AC, modern kitchen, fireplace & gas heating points.• Front and rear bull nose verandahs, landscaped grounds and large paved off-street car

space. Inspect to fully appreciate this delightful new offering!Contact: David Meikle 0412 422 294

2

1

1

Mt Kembla $395,000

ENTIRE FLOOR

9/1 View StreetOpen For Inspection: By Appointment

• Superb 360 degree views of the Illawarra from this spacious whole top floor, 4 bedroom penthouse apartment with large wrap around balcony - all in a quiet picturesque location.

• Generous open plan living areas incorporating quality soft furnishings & fittings, ducted air conditioning, integrated surround sound and stunning poly urethane & granite kitchen.

• Full security building, 4 car garage plus additional workshop and cellar. Top Shelf!Contact: David Meikle 0412 422 294

4

2

4

Wollongong $1,250,000

44 Ash Avenue ALBION PARK RAILOpen For Inspection: By Appointment

• 3 good size bedrooms all featuring BIW’s ( main comfortably accommodates king size bed)• Air conditioned living with polished timber floor boards • Renovated kitchen with natural gas stainless steel appliances• French doors off the kitchen to a massive covered entertaining deck• Level fully fenced front and back yard including 2 large garden sheds at the rear.

Contact: Daniel Ellem 0410 868632

3

1

1

Albion Park Rail Offers Over $325,000

NEW PRICE

4/30 Urunga ParadeOpen For Inspection : By Appointment

• Convenient CBD fringe location and just minutes walk to Wollongong Hospital or train sta-tion from this top floor north facing 2 bedroom unit with large lock-up garage.

• Located in a small bock of only 4, it includes spacious bedrooms, one large BIW, modern kitchen with BOSCH dishwasher, internal laundry, enclosed sunroom and security intercom entry.

Contact: David Meikle 0412 422 294

2

1

1

Wollongong $269,000

NEW LISTING

NEW LISTING!

5/27 Campbell Street WollongongOpen For Inspection: Saturday 1:00pm to 1:30pm

• Quiet off-street location and convenient to both Belmore Basin and Wollongong CBD.• Light and airy 2nd floor east facing 2 bedroom unit with covered balcony. Intercom entry.• Renovated kitchen and bathroom, 2 BIW’s, internal laundry and lock-up garage.• Currently vacant for the owner occupier looking to move straight in - Rental expectations

to around $330 per week for the investor. First time offered!Contact: David Meikle 0412 422 294

2

1

1

Wollongong $329,000

NEW LISTING

2/23 Berkeley Road , GwynnevilleOpen For Inspection : By Appointment

• Fabulous large luxury 3 bedroom townhouse conveniently located within 500 mtrs of Wiseman Park Bowling Club and Gwynneville Shopping Centre

• Open plan living and dining area, stone and steel gourmet kitchen with dishwasher, internal access to double garage, ensuite to master bed, 3 separate W.C’s and sunny north facing courtyard

Contact: Nick Logan 0418 420090

3

2

2

Gwynneville $478,500

Page 66: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Huxley & Partnersr e a l e s t a t e

The Green Team

Ph. (02) 4286 5555 112A Railway Street, Corrimal View all these properties online at www.huxleyrealestate.com.au

Mangerton $265,000 13/1 Mangerton Road • Top fl oor two bedroom spacious unit, modern interior• Internal laundry,wrap around balcony,security building• Close to hospital, shops and transportTony Sloane 0409 299 407

2 1 1

OPEN SAT 12:30-1:30

Corrimal $219,0003/27 Underwood Street• Two bedroom carpeted unit in convenient location• Currently tenanted, great investment opportunity• Short walk through to shops, transport and parks Charles Hegyi 0408 423 051

2 1 1Keiraville $579,000 258 Gipps Road • Great potential - brick & tiled home w separate garage• Level block with two street frontages• Close to Botanical gardens,shops, University & free busTony Sloane 0409 299 407

4 1 2

Corrimal $370,0003/52 Thalassa Avenue• Great location to beach, shops, schools & station• Comfort and low maintenance towhouse • BIWS, balcony to main, courtyard and single garageCharles Hegyi 0408 423 051

3 11.5

Corrimal $289,000 4/16-20 Jones Place • Beautiful totally refurbished large two bedroom unit• Private rear balcony, security foyer, small complex• Quiet block, well off the street, close to local CBDTony Quin 0414 428 401

2 1 1

OPEN SAT 11:00-12:00

Corrimal $345,0006/16-20 Jones Place • Big three bedroom villa style unit in quiet complex• Beautiful new kitchen & bathroom, spacious living• Own carport and ample visitor parking is availableTony Quin 0414 428 401

3 1 1

OPEN SAT 11:00-12:00

Coniston $289,000 3/40 Bridge Street • Fully renovated large two b/r unit, open plan living• Nothing to spend, internal laundry, timber fl oors• City & ocean views, small complex, close to CBDTony Sloane 0409 299 407

2 1 1

OPEN SAT 11:00-12:00

Woonona4 Thomas Hale Avenue• Location, location.. only 420 metres to the surf• Double storey home on beautiful level 600sqm block• Solar energy supply, stunning kitchen, outdoor living Charles Hegyi 0408 423 051

$755,000

• With three living areas, a large back yard and four good sized bedrooms there is room for the whole family!• Easy walk to shops, train station & local school

4 2 2

Towradgi $379,00017/42 Carters Lane• Tranquil garden complex only minutes to beach• Modern open living design opening out to courtyard • Beautiful kitchen with loads of bench space, LU garageCharles Hegyi 0408 423 051

3 1 1

Bulli $620,00029 Beacon Avenue • Beautifully presented “A” frame style home• As new kitchen, open living, sunroom, inground pool• Covered ent./BBQ area, 700sqm block, walk to beachTony Quin 0414 428 401

4 2 2

NEW

Austinmer $1,300,00012 Boyce Avenue• Immaculate home designed around grand staircase • Covered ent. area, landscaped yard, guestroom• Large bedrooms, spacious kitchen, 745sqm block Charles Hegyi 0408 423 051

5 3 2

Woonona32 Mitchell Road• First home buyers looking for a start• Polished fl oors and open fi re place • Large level yard

Charles Hegyi 0408 423 051

$445,000

• Exclosed verandah and seperate storeroom• Country style kitchen eat-in kitchen• Easy access to beaches

3 1

OPEN SAT 11:30-12:00

Woonona34 Mitchell Road• Beautifull single story brick veneer home• Set on a large level garden block • Great investment or for fi rst home buyer

Charles Hegyi 0408 423 051

$495,000

• Polished fl oor boards throughout• Renovated kitchen and bathrooms• Ideally located to schools, shops, beaches and station

3 2Keiraville P.O.A4 Cedar Grove • Big and bold brick home with open plan living areas• Ducted A/C, separate formal dining, rumpus room• Expansive decks overlooking city, ocean & escarpmentTony Sloane 0409 299 407

4 3 2

Corrimal $278,0004/267 Princes Highway• Security modern apartment building with views• BIWS, modern kitchen and bathroom, balcony • Central to Corrimal CBD,walk to shops,station, schoolsCharles Hegyi 0408 423 051

2 11

Fairy Meadow $215,000214-220 Princes Highway • One bedroom unit with granite kitchen & dishwasher• Internal laundry with washing machine & dryer• Popular complex, great rental returns, invest today!Tony Quin 0414 428 401

1 1 1

Fairy Meadow $279,000214-220 Princes Hwy• Two bedroom boutique unit, great rental returns • Int. laundry, s/steel appliances, security parking, lifts • On site building manager & close to all amenities Tony Quin 0414 428 401

2 2 1

Page 67: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

• Sand, surf and rock pool of popular Austinmer beach is literally footsteps away from your front door• Large family home with great entertaining areas and scenic views• Suitable for two families, or live on one level and rent the other as holiday letting accommodation • Close to school, transport, cafes, restaurants and Thirroul shopping centre

• If architectural elegance, space & coastal views are important to you then look no further• Near new, low maintenance 3 storey residence in need of new proud owner• Approximately 500m2 residence area with garaging for 6 cars and home office• Metres from prestigious Austinmer & Thirroul beaches and local village life

Come and view this large family home in the popular Sandon Point estate. A unique design allows for single level living, if desired, with additional levels for guests or extended family.• 4-5 bedrooms, huge rumpus room on separate level• Upstairs 2nd living room or supersized mezzanine style 4th bedroom with balcony overlooking the

ocean• Swimming pool in the rear private garden and outdoor entertaining/BBQ area

AGENT:

• Charming family home on a massive 823sqm level parcel of land

• Two separate garages offering four car accommodation• Convenient location with walk to shops, train station,

schools and restaurants• Potential for dual occupancy (STCA)

• Uniquely charming holiday home in a private rainforest setting. Very private viewing deck with sweeping ocean and escarpment views

• Separate guest accommodation and artist studio downstairs. Potential to generate holiday rental income. Lock up garage and carport, access through private rear lane

• This property would make a great weekender or a holiday letting, with potential to generate rental income when not used. Wombarra provides a perfect lifestyle, with the beach and tidal rock pool

AGENT:

• Birdlife and wildlife literally at your doorstep at this funky red cedar home

• Beautiful and tranquil setting, yet walk to train station and 2 minutes drive to local beaches

• Character family cottage or a holiday home to escape the busy city life

AGENT:

Perched high and spanning two spacious levels, this solid double brick home has potential to accommodate two families comfortably. Easily split into 2 separate houses with great rental income potential. Awesome views!

AGENT:

This lovely villa will appeal to a range of buyers, due to its convenient location and affordability.• Bedrooms with BIW’s, modern kitchen and spacious

living area, single garage with storage and internal access.

• Great investment with a rental income of $320 pw

AGENT:

• Uniquely charming holiday home in a rainforest setting• Very private viewing deck with beautiful rainforest views • 765sqm parcel of land backing onto Wombarra Sculpture

Gardens• Potential to generate holiday rental income

AGENT:

This vacant block of land is located in a popular family street with easy walk to Thirroul´s shops, restaurants, cafes and transport.Additional bonus - DA approved for a family home. Use it as is, modify it, or design your own dream home.Area: 501 sqm

AGENT:

• Two beautiful blocks of land side by side, approx 500sqm each

• Beautiful sandstone features and many established botanical specimens to be retained

• Concept plans and models of homes to complement the sites available, all services connected

AGENT:

Superbly located vacant block of land with plans approved for dual occupancy. Overlooking McCauley Beach and Sandon Point and backing onto a reserve, with easy walk to McCauley Beach and Thirroul village. All amenities, such as shops, restaurants and train station with express train to Sydney are within minutes of level walk. Area: 761m2.

Page 68: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Kylie Williams

68 28 February 2013

Ray White North Beach Wollongong

Figtree 110 O’briens Rd

Beautifully appointed family home

Enjoy stylish family living with this fully renovated

single level home. Set in a location close to

schools, shops & transport. Immaculately

presented featuring two living areas, all beds

with BIR’s, as new bathrooms, covered

entertaining area and a fully fenced yard.

4 A 2 B 1 C

Sale

$539,000-$579,000

View Saturday 11.30-12.15pm

Fady Saad 0422 050 [email protected]

raywhite.com4226 9000

Just

List

ed

Page 69: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Ray White Woonona

Bellambi 77 Pioneer Road

Renovate or Detonate!

First home buyers & developers alert! Great first home for the tradesperson or handyman alike, or simply demolish & construct a duplex (SWCCA) or your dream home.Situated on a near level 685m2 approx. land parcel in close proximity to all conveniences. Make an offer!

2 A 1 B

Sale$335,000

View @ 12-12.45pm Sat 2 March

Troy Johnson 0411 969 [email protected]@raywhite.com4284 8888

Ray White Woonona

Woonona 20 Kareela Road

Do not miss this!

Any astute buyer looking to purchase at Woonona Beach loves to hear these words; "north side of Kareela Road" Offering a suberb large family home, reserve land at rear along with views to the Royal National Park, surf, sand, cycleway, cafe’s, ocean pool, parks, schools & transport at your disposal!

4 A 3 B 2 C

Sale"Expressions of Interest"

View @ 1-1.45pm Sat 2 March

Troy Johnson 0411 969 [email protected]@raywhite.com4284 8888

Ray White Woonona

Wombarra 489A Lawrence Hargrave Drive

Beach Side Living - Reduced!

Split level contemporary home features timber floors, raked ceilings, timber kitchen & open plan living leading to deck with views to ocean. A detached 60m2 (approx) outbuilding affords a double garage, large workshop/utility area and its own shower and toilet. Affordable lifestyle!

3 A 2 B 2 C

Sale$650,000 to $690,000

View @ 10-10.45am Sat 2 March

Rick Taylor 0403 305 [email protected]

4284 8888

Wollongong 8/14 Market Place Supurb location! 2 A 1 B 1 C

Ray White Woonona

Stunning views from your private balcony overlooking gorgeous parkland, this immaculate property is a mere stroll from beaches & Wollongong’s CBD, restaurants, schools etc. Newly refurbished throughout including stunning kitchen, stylish new bathroom & furnishings.

Sale $419,000

View by appointment

Rick Taylor 0403 305 315

[email protected] | 4284 8888

Bellambi 2/221 Rothery Road Looking for an investment! 2 A 1 B 1 C

Ray White Woonona

This property has a great tenant paying $340/wk - lease expires 13/4/13. The immaculate 2 bedroom villa is located in a small complex opposite the bowling club. Other features include spacious living area, 2 good size bedrooms, very neat kitchen and bathroom, single garage with internal access.

Sale offers from $330,000

View by appointment

Troy Johnson 0411 969 656

[email protected] | 4284 8888

Page 70: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Ray White Wollongong

Gwynneville 3 John Street

Big Bold and Beautiful

Positioned close to the Uni precinct & a short level walk to village shops is this well maintained 2 storey family home. Features 2 big living areas, 2 kitchens, views to the city and separate office. The drive through 3 car garage accesses the rear garden and huge detach garage/workshop. Surrounded by quality homes.

4 A 4 B 4 C

AuctionOn-Site Saturday 16th March 2013

View Saturdays 12pm-12.45pm & Wednesday 5.30pm-6pm

Chris Stylis 0419 211 331raywhitewollongong.com4229 8600

Balgownie 17 Terrell Place Land a Bargain!

Ray White Wollongong

• 873m2 Block of Land• Located in one of Balgownie’s most sought after streets• Plan’s available for an executive home. Ready for lodgement to council.

Sale $245,000 to $285,000

View Direct or By Appointment

Ben Baaner 0423218285raywhitewollongong.com | 4229 8600

Fairy Meadow 77 Hopewood Crescent Home! Sweet Home! 5 A 2 B 2 C

Ray White Wollongong

Set on a huge 721m2 block in arguably Fairy Meadow’s most sought after street, this home is suited to the extended family or someone looking for some extra space. The original home is made up of four bedrooms, three with Built-In Wardrobes & a renovated Kitchen & bathroom.

Sale $549,000 Negotiable

View By Appointment

Ben Baaner 0423 218 285raywhitewollongong.com | 4229 8600

Woonona 29 Russell Street For lands sake! 4 A 1 B 1 C

Ray White Wollongong

Unique 1389m2 (approx) lot situated in the heart of Woonona. Improvements include a substantial 4 bedroom family home with lock up garage under. Only a short level stroll to all shops and transport. Ideally suited to the keen gardener or the family wanting space. Possible further develepment ( STC).

Auction On Site Wednesday 20th March 2013at 6pm

View Saturday 11am-11.30am & Wednesday 5.30pm-6pm

Chris Stylis 0419 211 331raywhitewollongong.com | 4229 8600

Lake Illawarra 5 Pur Pur Avenue Ideal spot within 300 metres of Lake Illawarraand Warilla Beach. Features a two streetfrontage on a 310m2 block. Walking todistance to beach, shops & Parks.Auction Saturday 2nd March 4:00pmOn SiteView Saturday 3:30 - 4:00Ben Baaner 0423 218 285raywhitewollongong.com | 4229 8600

Ray White Wollongong

Auctio

n

This

Wee

kend

Cordeaux Heights 7 Kallara Link Positioned in a quiet street, overlooking a bush reserve is this 4 bedroom residence with a grand living room, huge kitchen family area opening onto a covered terrace & rear entry to double garage.Sale $639,000View Sat 12:30 - 1:00pmCraig Buckley 0409 669 [email protected] raywhitewollongong.com | 4229 8600

Ray White Wollongong

Wollongong 2/64 Kenny Street Single level living at its best with this immaculate three bedroom villa, featuring a fantastic open plan living room, chefs kitchen, covered courtyard and No Steps! Positioned a short level stroll to city centre. Ideal city living.Sale $549,000View By ApponinmentNick Vranesevic 0419 447 504raywhite.com | 4229 8600

Ray White Wollongong

Wollongong 5/16 Dempster Street Whisper quiet position is this immaculate 3 bedroom townhouse close to city and Uni. Features spacious living area, a/c, alarm and covered entertaining deck. An inspection is sure to impress!Sale $439,000View Saturday 10.30am - 11amNick Vranesevic 0419 447 504www.raywhitewollongong.com | 4229 8600

Ray White Wollongong

North Wollongong 4/7-9 Corrimal Street Affordable studio apartment only 200 metres to North Wollongong Beach, Novotel and cafes. Ocean views, renovated kitchen, free shuttle bus nearby, handy to laundry facility and more! Enjoy this beachside lifestyle. Rented at $210pwSale $189,000View Saturday 12:00pm - 12:30pmKrista Sugden 0401 050 756raywhitewollongong.com | 4229 8600

Ray White Wollongong

West Wollongong 1/11 Poulter Street Sophisticated 3 brm villa in complex of 2. Living area opening onto private courtyard, generous sized bedrooms, main with ensuite. Modern kitchen with granite bench tops. Double garage with extra storage. Direct access to Uni & freeway.Sale $475,000View Saturday 11:00am - 11:30amKrista Sugden 0401 050 756raywhitewollongong.com | 4229 8600

Ray White Wollongong

Page 71: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Cordeaux Heights 41 Coachwood Drive Sitting On Top of the World 3 A 1 B 2 C

Ray White Unanderra

Positioned on a prime corner block, this single level home stylishly presented & featuring light filled interiors.* Stylish kitchen opens to timber deck* Double lock-up garage with internal access* Walk to schools, shops & express bus

Sale $390,000-$420,000

View Sat 1:00pm - 1:30pm

Lindsay Begley [email protected]/891563 | 4271 4000

Lake Illawarra 99 Reddall Parade One for the Money 2 A 1 B

Ray White Unanderra

Set on a large parcel spanning close to 720 sqm, offers a fantastic lifestyle.* Plenty of untapped potential* Exciting scope to extend or build (STCA)* Hop skip & jump to Lake Illawarra’s foreshore, close to schooling, bike tracks & parks

Sale $315,000 - $345,000

View Sat 2:00pm - 2:30pm

Jennifer Conroy [email protected]/906982 | 4271 4000

Gwynneville 2 Paulsgrove Street * 692sqm block with a 21m frontage * Walking distance to Wollongong UNI* Wollongong Botanical Gardens situated at rear

Auction Sun 3rd March On site @ 11amView Sat 11:00am - 11:30am & Sun 10:30am - 11:00amDavid Greenwood [email protected] | 4271 4000

Ray White Unanderra

Auctio

n

This

Wee

kend

Cordeaux Heights 73 Derribong Drive * 3 Bedroom home quietly positioned on a generous 1258sqm parcel* Combined living/dining with views* Close schools & public transport* Leafy entertaining deck

Sale $430,000 - $465,000View Sat 12:00pm - 12:30pmJennifer Conroy [email protected]/900769 | 4271 4000

Ray White Unanderra

Farmborough Heights 22 Aminya Place * Newly renovated kitchen and bathroom* 3 BR home in quiet tranquil cul-de-sac location* Separate man cave or kids play room

Sale $380,000 View Sat 10:00am - 10:30amDavid Greenwood [email protected]/883343 | 4271 4000

Ray White Unanderra

Warrawong 4 Little Place * Humble home - DECEASED ESTATE* Superb family orientated neighbourhood* Three spacious bedrooms * Air conditioning & low maintenance yard * Lock up garage, only seven years old

Sale $349,000View Sat 1:00pm - 1:30pmTeresa Costa [email protected]/895500 | 4271 4000

Ray White Unanderra

28 February 2013 71

Ray White Thirroul

Austinmer 2 Kennedy Road

Enviable Beachside Living

Prime beachside location just 250 metres from

Austinmer’s main beach.

A 3 bedroom cottage over one level, offers a

desired N/E aspect with widespread ocean and

coastal views from the large wrap around

balcony. Set on a private garden allotment,

convenient to train, schools and cafes.

3 A 1 B 1 C

Auction

Saturday 9th March 11:30am onsite

View Saturday 2nd March 1.00 to 2.00 pm

Tony Dribbus 0433 175 681

[email protected]

Woonona 11/44 Russell Street A modern 3 bedroom Villa conveniently located to all amenities and town centre, additional downstairs room, polished floors, large bathroom. Ideal live in or investment!

Sale $375,000View Saturday 2nd March 10.30am - 11.15amTony Dribbus 0433 175 6814268 5577

Ray White Thirroul

Thirroul 57 Armagh Parade Elevated with commanding widespread ocean views this immaculate two level brick veneer residence features three bedrooms, downstairs rumpus room or 4th bedroom.

Sale $595,000View Saturday 2nd March 12.00 to 1.00 pm Tony Dribbus 0433 175 [email protected]

Ray White Thirroul

Thirroul 50a Pass Avenue Privately nestled with level convenience to Thirroul’s town centre. Tastefully renovated character home over 2 levels with spacious interiors and modern finishes. 4 bedroom or 3 bedroom + study, 2 bathrooms, timber floors, living areas flow onto a private entertaining sun deck.

Sale $675,000View Saturday 2nd March 11.00 to 11.45 am Tony Dribbus 0433 175 681

Ray White Thirroul

West Wollongong 3/24 Fisher Street An exceptional modern and sleek terraced styled townhouse in a boutique complex convenient to all the city’s amenities.Flawless presentation throughout, accommodation includes 3 bedrooms, 2 bathrooms, granite kitchen, and loft/storage area.

Sale $539,000View Saturday 2nd March 10.00 to 10.30 am Tony Dribbus 0433 175 681

Ray White Thirroul

Page 72: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Ray White Unanderra

Mount Pleasant 49 Ramah Avenue

Landmark Address

Unexpectedly spacious & perfect for relaxed family living. Enjoy the stunning design of this classic beauty.* New kitchen with caesar stone benchtops* Excellent outdoor entertaining area* Office/rumpus opening onto low maintenance yard

4 A 3 B 2 C 1 E

AuctionSun 3rd March On site @ 12pm

View Sat 11:00 - 11:30am & 2:00 - 2:30pm & Sun 11:30 - 12:00pm

Michael Moate [email protected]/9083404271 4000

Auctio

n

This

Wee

kend

Ray White Unanderra

Cordeaux Heights 7 Deenyi Close

Home Sweet Home

Quiet cul de sac location for a lifestyle of ultra convenience. Offering an array of light filled areas* All 4 bedrooms have BIWs + generous study* Ducted air conditioning & atrium entry feature* Swimming pool with tropical gardens* Reserve over back fence great for the kids!

4 A 2 B 2 C 1 E

AuctionSun 24th March On site @ 1pm

View Sat 10:00am - 10:30am & 1:00pm - 1:30pm

Lindsay Begley [email protected] 4000

Ray White Unanderra

Figtree 10 Cranford Lane

Designed for Pleasure

Embracing a desirable rear northerly aspect, this family style entertainer enjoys unparalleled luxury.* Indoor/outdoor living showcases the finest of finishes* Spectacular wet bar & games room, flow out onto in ground pool* Wonderful combination of peace & location

4 A 3 B 2 C 1 E

AuctionSun 24th March On site @ 12pm

View Sat 11:00am - 11:30am & 3:00pm - 3:30pm

Michael Moate [email protected]/9294274271 4000

Ray White Unanderra

Lake Illawarra 140 Pur Pur Avenue

Look No Further!

Readymade family home, this residence presents a functional layout spread over easycare grounds* Large bedrooms sizes & additional study area * Many living & entertaining options* Lake views & parkland at rear* Close to schools, Lake Illawarra & beaches

4 A 2 B 2 C 1 E

AuctionSun 24th March On site @ 2pm

View Sat 11:00am - 11:30am & 3:00pm - 3:30pm

Lindsay Begley [email protected] 4000

Page 73: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Ray White Unanderra

Shell Cove 10 Makaha Way

Almost Paradise!

Luxuriously spacious & impeccably finished, this as new home was designed to provide the best in contemporary indoor & outdoor living.* Expansive entertaining areas overlooking in ground pool & water features* Superb chefs kitchen with state of the art appliances

4 A 2 B 3 C 1 E

AuctionSun 3rd March On site @ 2pm

View Sat 10:00 - 10:30am & 2:00 - 2:30pm & Sun 1:30 - 2:00pm

Michael Moate [email protected]/9085074271 4000

Auctio

n

This

Wee

kend

Ray White Unanderra

Dapto 1/65-67 Mount Brown Road

Simply Stunning!

Stylish living in a wonderful large villa, perfect for buyers looking to downsize or a first home.* Stunning kitchen featuring 40mm stone benchtops, stainless steel appliances * Contemporary, open plan & flowing design offers an area for all occasions* Close to Mount Brown Public School

3 A 2 B 2 C

Sale$360,000 - $410,000

View Sat 12:00pm - 12:30pm & 2:00pm - 2:30pm

David Greenwood [email protected]/9066294271 4000

Berkeley 546 Northcliffe Drive Get more for your money 3 A 1 B 3 C

Ray White Unanderra

Boasting a high set position, close to a host of amenities, including local schools, shops & transport* Ideal first home or investment property* High set position * Updated flooring, paint, kitchen & bathroom* Extra large double garage

Sale $275,000 - $305,000

View Sat 1:00pm - 1:30pm

John Kay [email protected] | 4271 4000

Albion Park Rail 7 Shearwater Boulevard Macquarie Shores Estate 3 A 1 B 1 C

Ray White Unanderra

Positioned on a generous 723sqm parcel of land, single level home offers ample proportions to comfortably accommodate a growing family.* Located in Macquarie Shores Estate* Expansive & level rear lawn & garden* Huge outdoor covered entertaining & BBQ area

Sale $360,000 - $410,000

View Sat 12:00pm - 12:30pm

John Kay [email protected]/915261 | 4271 4000

Wollongong 52/59-67 Corrimal Street 3 A 2 B 2 C

Ray White Unanderra

Situated in the luxurious resort style Watermark apartment complex with captivating views* Spacious open plan living & wrap around balcony* Huge 2.5 car 45sqm secure lock up garage* Deluxe gourmet kitchen with granite benchtops* Close to beaches & Wollongong CBD

Sale $879,000

View Sat 10:00am - 10:30am

Teresa Costa [email protected]

raywhite.com | 4271 4000

Cordeaux Heights 31 Kooranga Crescent 4 A 2 B

Ray White Unanderra

Spacious contemporary single level home offering an abundance of natural light* Picturesque private rear yard & entertaining area* Plenty of off street parking for boats, cars & caravans* Great location, walk to shops and city bus transportation

Sale $489,000

View Sat 12:00pm - 12:30pm

Lindsay Begley [email protected]/881281 | 4271 4000

Page 74: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Join us for our Open DaySaturday 16 March 11.00am – 2.30pmIRT Links Seaside is Wollongong’s premier over 55s lifestyle and care

community. Situated in one of our region’s most desirable locations,

IRT Links Seaside off ers an unparalleled lifestyle.

Come along and join us for our open day - here’s the details:

When: Saturday, 16 March

Time: 11.00am - 2.30pm

What’s there to do: enjoy a sausage sizzle on us, take a tour of the

community, meet some of our friendly residents and speak to our

sales consultants.

RSVP: no need! Just turn up.

We have brand new apartments available now for sale:

• Two bedroom apartments starting from $535,000

• Three bedroom apartments starting from $695,000

IRT Links Seaside off ers you community living like no other – enjoy a new

social circle meeting new friends, taking off on adventures or just enjoying

the number of social activities on off er.

You’ll be so glad you made the decision to join us!

Apartment 505 - The Greens $535,000 • Comfortable living with easy access around the apartment• Easy to maintain• Immaculate fi nishes throughout• Views to escarpment and landscaped tropical garden

Apartment 603 - The Greens $703,000• North facing apartment• Under fl oor heating in both bathrooms• Penthouse fi nishes throughout• Balcony access from master bedroom

Apartment 519 - The Sands $600,000• Located on the 5th fl oor• Enjoy the afternoon sun in this comfortable apartment• Views to the mountains and across landscaped coastal gardens

Apartment 618 - The Sands $884,000• Enjoy the morning sun• Penthouse fi nishes throughout• Entry foyer • Under fl oor heating in both bathrooms

T 1800 024 915 (Freecall) E [email protected] W www.irt.org.au

youtube.com/IRTgroup facebook.com/IRTGroup twitter.com/IRTGroup

IRT Links Seaside 1 Ross Street Wollongong

1 1

2 2

1 1

2 2

2 1

3 2

1 1

2 2

We’reOpen!

Page 75: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

I L L A W A R R A HW Y

Y E L LO

W R

OC

K R

D

C A L D E RW

OO

D R

D

A L B I O N PA R KS H O P P I N G

C E N T R E< R O B E R T S O N

S H E L L H A R B O U R >

WO

LL

ON

GO

NG

>

I LL

AW

AR

RA

HW

Y

T O N G A R R A R D

TE

RR

Y S

T

BR

OU

GH

TO

N A

VE

Big level blocks from $240,000

C A

� 4257 0500 148 TONGARRA RD ALBION [email protected]

� 4256 1677 13 BROUGHTON AVE [email protected]

For full details contact selling agents:

Most of these lots overlook a reserve and have beautiful views to the escarpment. You will be within walking distance of Tullimbar Primary School, and the future town centre.

Lots of this size are hard to fi nd, and this is our fi nal stage, so there are no more to come.

If you are looking for the perfect fl at block to build a large family home and still have enough land left over for a good size back yard and even a swimming pool, Ridgeview has seven to choose from.

Inquire now before you miss out. TULLIMBAR

Take advantage

of Current NSW

Government

incentives!

• $15,000 fi rst

home buyer grant and pay

no stamp duty

• $5,000 new home owners grant

• $7,000 Regional

Relocation Grant if you

sell in a metropolitan area

(includes Wollongong LGA)

and buy in Ridgeview

*Conditions apply. Call us to see what you are eligible for.

Lot No.

Land area m2 Price

33 740 $295,000

35 706 $265,000

38 700 $285,000

44 720 $295,000

48 769 $295,000

54 770 $280,000

67 715 $240,000

Page 76: realestateworld.com.au - Illawarra Real Estate Publication, Issue 28th February 2013

Interest rate current as at 25th January 2013. Eligibility criteria, terms and conditions, fees and charges apply. WARNING: This comparison rate is only true for the example given and may not include all fees and charges. Different terms, fees, or other loan amounts might result in a different comparison rate. Illawarra Credit Union is a division of Community Alliance Credit Union Limited, Australian Credit Licence 245 576.

BLD

F485

Experience the difference. Great rates & fast, friendly service

Based on a loan amount of$150,000 over a term of 25 years

5.25%p.a.

fl ying start variable5.70%

p.a.comparison rate

Rate shown includes 1% discount, reverting to our Reward Rate which is 0.55% below the Standard Variable rate after 12 months for the remainder of the term. Available for new home loan business $250,000 or more

with 1% off our already low standard variable home loan rate for 12 months

Call us on 13 22 49

or visit your nearestIllawarra Credit Union branch

www.illawarracu.com.au

CUT HOME LOAN REPAYMENTS

YOUR