CoverBSC6900 UMTS V900R012C00SPC110Parameter ReferenceHuawei
Technologies Co., Ltd. provides customers with comprehensive
technical support and service. For any assistance, please contact
our local office or company headquarters.Huawei Technologies Co.,
Ltd.Address:Huawei Industrial BaseBantian, LonggangShenzhen
518129People's Republic of
ChinaWebsite:http://www.huawei.comEmail:[email protected]
Huawei Technologies Co., Ltd. 2010. All rights reserved.No part of
this document may be reproduced or transmitted in any form or by
any means without prior written consent of Huawei Technologies Co.,
Ltd.Trademarks and Permissionsand other Huawei trademarks are
trademarks of Huawei Technologies Co., Ltd.All other trademarks and
trade names mentioned in this document are the property of their
respective holders.
[email protected]://www.huawei.com
About This DocumentPurposeThis document provides information
about the BSC6900 parameters, including the meaning, value, and
usage of the parameters.Intended AudienceNetwork plannersField
engineersSystem engineersShift operatorsOrganizationEach parameter
is described in the following aspects.DescriptionRemarksMOModel
object name for NBIParameter IDSimple string for identifying a
parameterNBI Parameter NameNBI parameter nameParameter NameFull
name of the parameterNENEs on which the parameter is setMML
CommandCommands for setting the parameterMeaningFunctions,
functioning ways, and protocols of the parameterIsKeyIsKey of MO
for NBIMandatoryMandatory attribute of the parameter in each
command for NBIFeature IDRelevant feature IDFeature NameFeatures
using the parameterValue TypeParameter value typeGUI Value
RangeParameter value range displayed on the GUIActual Value
RangeActual parameter value range corresponding to the GUI Value
Range. For example, the GUI Value Range is 0, and the corresponding
Actual Value Range is OFF.UnitParameter value unitDefault
ValueInitial value provided by the systemRecommended ValueValues
recommended in different scenariosImpactParameter impact scope,
that is, objects specified when the parameter is setParameter
RelationshipRelationship between this parameter and other
parameters. For example, to use this parameter, you need to set
related switches and parameters.AccessWhether this parameter is
read/write or read onlyService Interrupted After
ModificationWhether modifying the parameter value may interrupt the
existing servicesInterruption ScopePossible interruption scope in
the case that modifying the parameter value may interrupt the
existing servicesInterruption Duration (min)Possible interruption
duration in the case that modifying the parameter value may
interrupt the existing servicesCautionCautions to be taken during
the modificationValidation of ModificationRequirements on how to
validate the modification of the parameter. For example, you may
need to reset the device to validate the modification.Impact on
Radio Network PerformanceImpact of the radio parameter on the
network performanceIntroduced in VersionVersion in which this
parameter is introducedAttributeWhether this parameter is a radio
parameter, a transport parameter, or an equipment parameterChange
HistoryThis section provides information on the changes between
V900R012C00SPC110 and V900R012C00SPC100.None.
Parameter List_1STTMML CommandParameter Namen v qun
lMeaningMOParameter IDNBI Parameter NameNEIsKeyMandatoryFeature
IDFeature NameValue TypeGUI Value RangeActual Value
RangeUnitDefault ValueRecommended ValueImpactParameter
RelationshipAccessService Interrupted After
ModificationInterruption ScopeInterruption
Duration(Min)CautionValidation of ModificationImpact on Radio
Network PerformanceIntroduced in VersionAttribute1ADD
AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Bearing subrack No.MNG
LISubrack number of bearing the AAL2
pathAAL2PATHCARRYFCARRYFBSC6900NOYESWRFD-05030104Dynamic AAL2
Connections in Iub/IuCS/Iur InterfaceInterval
Type0~110~11NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in "ADD
AAL2PATH" is set to UNI, IMA, FRAATM, NCOPT, or ATM LGCPORT, this
parameter is valid.Read & WriteYAAL2 pathLess than 5
minutesNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment2ADD
AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Bearing slot No.MNG
LINumber of the slot bearing the AAL2
linkAAL2PATHCARRYSNCARRYSNBSC6900NOYESWRFD-05030104Dynamic AAL2
Connections in Iub/IuCS/Iur InterfaceInterval Type0~5,8~270~5,
8~27NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in "ADD
AAL2PATH" is set to UNI, IMA, FRAATM, NCOPT, or ATM LGCPORT, this
parameter is valid.Read & WriteYAAL2 pathLess than 5
minutesNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Transport3ADD
AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Bearing UNI link No.MNG
LINumber of the UNI link that carries the PATH. The field is value
only when the " bearer type " parameter is set to UNI. The bearing
UNI link must be configured
already.AAL2PATHCARRYUNILNKNCARRYUNILNKNBSC6900NOYESWRFD-05030104Dynamic
AAL2 Connections in Iub/IuCS/Iur InterfaceInterval
Type0~3350~335NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in
"ADD AAL2PATH" is set to UNI, this parameter is valid.Read &
WriteYAAL2 pathLess than 5 minutesThe UNI link must be
available.The parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Transport4ADD
AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Bearing IMA group No.MNG
LINumber of the IMA group that carries the PATH. The field is value
only when the " bearer type " parameter is set to IMA. The bearing
IMA group must be configured
already.AAL2PATHCARRYIMAGRPNCARRYIMAGRPNBSC6900NOYESWRFD-05030104Dynamic
AAL2 Connections in Iub/IuCS/Iur InterfaceInterval
Type0~1670~167NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in
"ADD AAL2PATH" is set to IMA, this parameter is valid.Read &
WriteYAAL2 pathLess than 5 minutesThe IMA group must be
available.The parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Transport5ADD
AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Bearing FRAATM link
No.MNG LINumber of the FRA ATM link that carries the PATH. This
field is valid only when the " bearer type " parameter is set to
FRAATM. The bearing FRAATM link must be configured
already.AAL2PATHCARRYFRAATMLNKNCARRYFRAATMLNKNBSC6900NOYESWRFD-05030104Dynamic
AAL2 Connections in Iub/IuCS/Iur InterfaceInterval
Type0~310~31NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in "ADD
AAL2PATH" is set to FRAATM, this parameter is valid.Read &
WriteYAAL2 pathLess than 5 minutesThe FRAATM link must be
available.The parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Transport6ADD
AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Bearing NCOPT port No.MNG
LINumber of the NCOPT port that carries the path. This field is
valid only when the " bearer type " parameter is set to
NCOPT.AAL2PATHCARRYNCOPTNCARRYNCOPTNBSC6900NOYESWRFD-05030104Dynamic
AAL2 Connections in Iub/IuCS/Iur InterfaceInterval
Type0~70~7NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in "ADD
AAL2PATH" is set to NCOPT, this parameter is valid.Read &
WriteYAAL2 pathLess than 5 minutesThe port must be available.The
parameter modification has no impact on the equipment.NoneVersions
earlier than BSC6900 V900R011Transport7ADD AAL2PATH(Mandatory)MOD
AAL2PATH(Mandatory)Bearing ATM logic port No.MNG LIATM logic port
No. bearing the PATH. This field is valid only when the " bearer
type " parameter is set to ATM logic port. The bearing ATM logic
port must be configured. The value mapping between interface boards
and ATM logic ports are as follows: AEUa: 0~127; AOUa: 0~255;
UOIa_ATM: 0~383; AOUc: 0~499; UOIc: 0~499. The ATM logic port must
be the leaf ATM logic port (the last level ATM logic
port).AAL2PATHCARRYVPNCARRYVPNBSC6900NOYESWRFD-05030104Dynamic AAL2
Connections in Iub/IuCS/Iur InterfaceInterval
Type0~4990~499NoneNoneNoneAAL2 pathWhen the value of "CARRYT" in
"ADD AAL2PATH" is set to ATM LGCPORT, this parameter is valid.Read
& WriteYAAL2 pathLess than 5 minutesThe ATM logic port after
the modification must be available.The parameter modification has
no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Transport8ADD AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)Add
To Rscgrp FlagMNG LIWhether to add the AAL2 path to the resource
groupAAL2PATHRSCGRPFLAGRSCGRPFLAGBSC6900NOYESWRFD-050301ATM
Transmission Introduction PackageEnumeration TypeNO(NO),
YES(YES)NO, YESNoneNoneNoneAAL2 pathWhen the value of "CARRYT" in
"ADD AAL2PATH" is set to UNI, IMA, FRAATM, or NCOPT, this parameter
is valid.Read & WriteN (No impact on the UE in idle mode)Not
involvedNot involvedNoneThe parameter modification has no impact on
the equipment.NoneVersions earlier than BSC6900
V900R011Transport9ADD AAL2PATH(Mandatory)MOD
AAL2PATH(Mandatory)Rscgrp No.MNG LIResource group number of the
PATHAAL2PATHRSCGRPNRSCGRPNBSC6900NOYESWRFD-050301ATM Transmission
Introduction PackageInterval Type0~20470~2047NoneNoneNoneAAL2
pathWhen the value of "ADDTORSCGRP" in "ADD AAL2PATH" is set to
YES, this parameter is valid.Read & WriteN (No impact on the UE
in idle mode)Not involvedNot involvedThe resource group must
exist.The parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Transport10ADD
AAL2PATH(Mandatory)MOD AAL2PATH(Mandatory)RMV
AAL2PATH(Mandatory)Adjacent Node IDMNG LIUniquely identifies an
adjacent nodeAAL2PATHANIANIBSC6900YESYESWRFD-05030104Dynamic AAL2
Connections in Iub/IuCS/Iur InterfaceInterval
Type0~45990~4599NoneNoneNoneAdjacent nodeNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport11ADD AAL2PATH(Mandatory)MOD
AAL2PATH(Mandatory)RMV AAL2PATH(Mandatory)AAL2 path IDMNG LIID of
one AAL2 path between two AAL2 nodes. The PATHID of the same AAL2
path configured between two AAL2 nodes must be the same. The value
should not be equal to
0.AAL2PATHPATHIDPATHIDBSC6900YESYESWRFD-05030104Dynamic AAL2
Connections in Iub/IuCS/Iur InterfaceInterval
Type1~42949672951~4294967295NoneNoneNoneAAL2 pathNoneRead &
WriteNot involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport12ADD AAL2PATH(Mandatory)MOD
AAL2PATH(Optional)Bearing typeMNG LILower layer link type of
bearing the Path.UNI: see"ADD UNILNK";IMA: see"ADD IMALNK";FRAATM:
see"ADD FRALNK";NCOPT: see"LST OPT";ATMLOGICPORT: see"ADD
ATMLOGICPORT";NULL: used when
testing.AAL2PATHCARRYTCARRYTBSC6900NOYESWRFD-05030104Dynamic AAL2
Connections in Iub/IuCS/Iur InterfaceEnumeration TypeUNI(UNI Link),
IMA(IMA Group), FRAATM(FRAATM Link), NCOPT(Optical Port),
ATMLOGICPORT(ATM Logical Port), NULL(NULL)UNI, IMA, FRAATM, NCOPT,
ATMLOGICPORT, NULLNoneNoneNoneAAL2 PathWhen the value of
"RscMngMode" in "ADD NODEB" of the resource corresponding NodeB is
set to EXCLUSIVE, the AAL2 Path must carry on ATM LGCPORT or
RSCGRPRead & WriteYAAL2 pathLess than 5 minutesNoneThe
parameter modification has no impact on the equipment.NoneVersions
earlier than BSC6900 V900R011Transport13ADD AAL2PATH(Mandatory)MOD
AAL2PATH(Optional)Bearing VPIMNG LIVPI of the AAL2 path out
BSC6900AAL2PATHVPIVPIBSC6900NOYESWRFD-050301ATM Transmission
Introduction PackageInterval Type0~40950~4095NoneNoneNoneAAL2
PathWhen the value of "CARRYT" in "ADD AAL2PATH" is set to UNI,
IMA, FRAATM, NCOPT, or ATMLOGICPORT, this parameter is valid.Read
& WriteYAAL2 pathLess than 5 minutesThe configuration data must
be the same as that of the peer system.The parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Transport14ADD AAL2PATH(Mandatory)MOD
AAL2PATH(Optional)Bearing VCIMNG LIVCI of the AAL2 path out
BSC6900AAL2PATHVCIVCIBSC6900NOYESWRFD-050301ATM Transmission
Introduction PackageInterval Type32~6553532~65535NoneNoneNoneAAL2
PathWhen the value of "CARRYT" in "ADD AAL2PATH" is set to UNI,
IMA, FRAATM, NCOPT, or ATMLOGICPORT, this parameter is valid.Read
& WriteYAAL2 pathLess than 5 minutesThe configuration data must
be the same as that of the peer system.The parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Transport15ADD AAL2PATH(Mandatory)MOD AAL2PATH(Optional)TX
traffic record indexMNG LITX traffic record index of the AAL2 Path
on the out BSC6900 port (ATM layer PVC traffic). The traffic index
is configured in the ATM traffic table (see "LST
ATMTRF").AAL2PATHTXTRFXTXTRFXBSC6900NOYESWRFD-05030107CBR, rt-VBR,
nrt-VBR, UBR ATM QoS ClassesInterval
Type100~1999100~1999NoneNoneNoneAAL2 PathWhen the value of "CARRYT"
in "ADD AAL2PATH" is set to UNI, IMA, FRAATM, NCOPT, or
ATMLOGICPORT, this parameter is valid.Read & WriteYAAL2
pathLess than 5 minutesNoneThe parameter modification has no impact
on the equipment.NoneVersions earlier than BSC6900
V900R011Transport16ADD AAL2PATH(Mandatory)MOD AAL2PATH(Optional)RX
traffic record indexMNG LIRX traffic record index of the AAL2 Path
on the out BSC6900 port (ATM layer PVC traffic). The traffic index
is configured in the ATM traffic table (see "LST
ATMTRF").AAL2PATHRXTRFXRXTRFXBSC6900NOYESWRFD-05030107CBR, rt-VBR,
nrt-VBR, UBR ATM QoS ClassesInterval
Type100~1999100~1999NoneNoneNoneAAL2 pathWhen the value of "CARRYT"
in "ADD AAL2PATH" is set to UNI, IMA, FRAATM, NCOPT, or
ATMLOGICPORT, this parameter is valid.Read & WriteYAAL2
pathLess than 5 minutesNoneThe parameter modification has no impact
on the equipment.NoneVersions earlier than BSC6900
V900R011Transport17ADD AAL2PATH(Mandatory)MOD
AAL2PATH(Optional)AAL2 Path TypeMNG LIService type of carried over
the PATH. For R99, only the R99 service can be carried. For HSPA,
only the HSPA service can be carried. For SHARE, R99 and HSPA
services can be carried at the same
time.AAL2PATHAAL2PATHTAAL2PATHTBSC6900NOYESWRFD-05030104Dynamic
AAL2 Connections in Iub/IuCS/Iur InterfaceEnumeration TypeR99(R99),
HSPA(HSPA), SHARE(SHARE)R99, HSPA, SHARENoneNoneNoneAAL2
pathNoneRead & WriteN (No impact on the UE in idle mode)Not
involvedNot involvedNoneThe parameter modification has no impact on
the equipment.NoneVersions earlier than BSC6900
V900R011Transport18ADD AAL2PATH(Optional)MOD AAL2PATH(Optional)AAL2
path ownershipMNG LIThe ownership of the AAL2 path is local or
peerAAL2PATHOWNERSHIPOWNERSHIPBSC6900NONOWRFD-05030104Dynamic AAL2
Connections in Iub/IuCS/Iur InterfaceEnumeration TypePEER(PEER),
LOCAL(LOCAL)PEER, LOCALNoneLOCALLOCALAAL2 pathNoneRead &
WriteNot involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport19ADD AAL2PATH(Optional)MOD AAL2PATH(Optional)TRM
load threshold indexMNG LITRM load threshold index. The TRM load
threshold must be
configured.AAL2PATHTRMLOADTHINDEXTRMLOADTHINDEXBSC6900NONOWRFD-050406ATM
QoS Introduction on Hub NodeB (Overbooking on Hub Node B
Transmission)Interval Type0~1990~199None00BSC6900NoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedThe TRM load threshold must be configured already.The
parameter modification has no impact on the equipment.NoneVersions
earlier than BSC6900 V900R011Transport20ADD AAL2PATH(Optional)MOD
AAL2PATH(Optional)Timer_CU timerMNG LITimer_CU timer. The parameter
affects the AAL2 transport efficiency and transport
delay.AAL2PATHTIMERCUTIMERCUBSC6900NONOWRFD-050301ATM Transmission
Introduction PackageInterval Type1~641~64, step:0.05ms1010AAL2
pathNoneRead & WriteYAAL2 pathLess than 5 minutesNoneThe
parameter modification has no impact on the equipment.NoneVersions
earlier than BSC6900 V900R011Transport21ADD
AAL2RT(Mandatory)Destination ATM addressMNG LIATM address of the
destination node of the AAL2 route. The value is entered in the
hexadecimal format, with the length ranging from 2 bytes to 21
bytes (including the 1-byte H' prefix). It is recommended that the
initial byte of the ATM address uses H'45 (indicating E.164
address) or H'39 (indicating the DCC address) or H'47 (indicating
the ICD address). The ATM address starting with H'45 close to seven
and half bytes of the H'45 must be in the BCD code (15-bit digit).
The following is the DSP. When the DSP is all-zero, it is E.164e,
for example, 0x45000971500202001F0000000000000000000000. When the
DSP is not all zero, it is E.164A. The ATM address is allocated
uniquely in the ATM network. The H'45 format is
recommended.AAL2RTNSAPNSAPBSC6900NOYESWRFD-050301ATM Transmission
Introduction PackageAny TypeNoneNoneNoneNoneNoneBSC6900NoneRead
& WriteNot involvedNot involvedNot involvedThe parameter cannot
be modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport22ADD AAL2RT(Mandatory)Adjacent Node IDMNG
LIUniquely identifies an adjacent
nodeAAL2RTANIANIBSC6900NOYESWRFD-05030104Dynamic AAL2 Connections
in Iub/IuCS/Iur InterfaceInterval
Type0~45990~4599NoneNoneNoneAdjacent nodeNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport23ADD AAL2RT(Optional)MOD
AAL2RT(Mandatory)Destination ATM address ownershipMNG LIWhether to
indicate that the " destination ATM node " is the same as the ATM
node specified by the " adjacent node ID
".AAL2RTOWNERSHIPOWNERSHIPBSC6900NONOWRFD-050301ATM Transmission
Introduction PackageEnumeration
TypeNO(ATM_ADDRESS_DOES_NOT_BELONG_TO_THIS_ADJACENT_NODE),
YES(ATM_ADDRESS_BELONGS_TO_THIS_ADJACENT_NODE)NO,
YESNoneYESYESBSC6900NoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedModified according to practical
networking.The parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Transport24ADD
AAL2RT(Optional)MOD AAL2RT(Mandatory)RMV AAL2RT(Mandatory)Route
indexMNG LIRoute logical
numberAAL2RTRTXRTXBSC6900YESNOWRFD-050301ATM Transmission
Introduction PackageInterval
Type0~42949672950~4294967295NoneNoneNoneBSC6900NoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Transport25ADD
ADJMAP(Mandatory)MOD ADJMAP(Mandatory)RMV ADJMAP(Mandatory)Adjacent
Node IDMNG LIUniquely identifies an adjacent
nodeADJMAPANIANIBSC6900YESYESWRFD-05030104Dynamic AAL2 Connections
in Iub/IuCS/Iur InterfaceInterval
Type0~45990~4599NoneNoneNoneAdjacent nodeNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport26ADD ADJMAP(Mandatory)MOD ADJMAP(Mandatory)RMV
ADJMAP(Mandatory)Interface TypeMNG LIType of the adjacent
nodeADJMAPITFTITFTBSC6900NOYESNoneNoneEnumeration TypeIUB(Iub
Interface), IUR(Iur Interface), IUCS(Iu-CS Interface), IUPS(Iu-PS
Interface)IUB, IUR, IUCS, IUPSNoneNoneNoneBSC6900NoneRead &
WriteNot involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport27ADD ADJMAP(Mandatory)MOD ADJMAP(Mandatory)RMV
ADJMAP(Mandatory)Resource Management ModeMNG LIResource management
mode. When the interface type is IUB, the value can be set to SHARE
or EXCLUSIVE. When the interface type is IUR, IUCS, or IUPS, the
value can be set to SHARE
only.ADJMAPCNMNGMODECNMNGMODEBSC6900YESYESWRFD-021305RAN Sharing
Phase 2Enumeration TypeSHARE(SHARE), EXCLUSIVE(EXCLUSIVE)SHARE,
EXCLUSIVENoneNoneNoneAdjacent nodeNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport28ADD ADJMAP(Mandatory)MOD ADJMAP(Mandatory)RMV
ADJMAP(Mandatory)CN Operator indexMNG LIOperator index of the
resource groupADJMAPCNOPINDEXCNOPINDEXBSC6900YESYESWRFD-021305RAN
Sharing Phase 2Interval Type0~30~3NoneNoneNoneTransmission resource
groupWhen "RSCMNGMODE" in "ADD RSCGRP" is set to EXCLUSIVE, this
parameter is valid.Read & WriteNot involvedNot involvedNot
involvedThe parameter cannot be modified.Not involvedNoneVersions
earlier than BSC6900 V900R011Equipment29ADD ADJMAP(Mandatory)MOD
ADJMAP(Optional)Transport Type of the adjacent node and interface
typeMNG LITransport type of the adjacent node and interface
typeADJMAPTRANSTTRANSTBSC6900NOYESWRFD-021305RAN Sharing Phase
2Enumeration TypeATM(ATM), IP(IP), ATM_IP(ATM and IP),
HYBRID_IP(HYBRID IP)ATM, IP, ATM_IP,
HYBRID_IPNoneNoneNoneBSC6900When the value of "ITFT" in "ADD
TRMMAP" is set to IUB, IUR, IUCS, this parameter is valid.Read
& WriteNot involvedNot involvedNot involvedThe parameter cannot
be modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport30ADD ADJMAP(Mandatory)MOD ADJMAP(Optional)Gold
user TRMMAP indexMNG LIGold user TRMMAP index used by the current
adjacent nodeADJMAPTMIGLDTMIGLDBSC6900NOYESWRFD-021305RAN Sharing
Phase 2Interval Type0~1630~163NoneNoneNoneAdjacent nodeThe TRMMAP
index is configured by setting the value of "TMI" in "ADD
TRMMAP".Read & WriteN (No impact on the UE in idle mode)Not
involvedNot involvedThe TRMMAP must be configured.The parameter
modification has no impact on the equipment.NoneVersions earlier
than BSC6900 V900R011Transport31ADD ADJMAP(Mandatory)MOD
ADJMAP(Optional)Silver user TRMMAP indexMNG LISilver user TRMMAP
index used by the current adjacent
nodeADJMAPTMISLVTMISLVBSC6900NOYESWRFD-021305RAN Sharing Phase
2Interval Type0~1630~163NoneNoneNoneAdjacent nodeThe TRMMAP index
is configured by setting the value of "TMI" in "ADD TRMMAP".Read
& WriteN (No impact on the UE in idle mode)Not involvedNot
involvedThe TRMMAP must be configured.The parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Transport32ADD ADJMAP(Mandatory)MOD ADJMAP(Optional)Bronze
user TRMMAP indexMNG LIBronze user TRMMAP index used by the current
adjacent nodeADJMAPTMIBRZTMIBRZBSC6900NOYESWRFD-021305RAN Sharing
Phase 2Interval Type0~1630~163NoneNoneNoneAdjacent nodeThe TRMMAP
index is configured by setting the value of "TMI" in "ADD
TRMMAP".Read & WriteN (No impact on the UE in idle mode)Not
involvedNot involvedThe TRMMAP must be configured.The parameter
modification has no impact on the equipment.NoneVersions earlier
than BSC6900 V900R011Transport33ADD ADJMAP(Mandatory)MOD
ADJMAP(Optional)Factor table indexMNG LIActivation factor table
indexADJMAPFTIFTIBSC6900NOYESWRFD-050406ATM QoS Introduction on Hub
NodeB (Overbooking on Hub Node B Transmission)Interval
Type0~330~33NoneNoneNoneAdjacent nodeThe factor table index is
configured by setting the value of "FTI" in "ADD FACTORTABLE".Read
& WriteN (No impact on the UE in idle mode)Not involvedNot
involvedThe FACTORTABLE must be configured.The parameter
modification has no impact on the equipment.NoneVersions earlier
than BSC6900 V900R011Transport34ADD ADJMAP(Mandatory)MOD
ADJMAP(Optional)Gold user Load EQ indexMNG LIGold user load EQ
index used by the current adjacent
nodeADJMAPLEIGLDLEIGLDBSC6900NOYESWRFD-021305RAN Sharing Phase
2Interval Type0~630~63NoneNoneNoneAdjacent nodeThe load EQ table
index is configured by setting the value of "LEI" in "ADD
LOADEQ".Read & WriteN (No impact on the UE in idle mode)Not
involvedNot involvedThe load EQ table is configured already.The
parameter modification has no impact on the equipment.NoneVersions
earlier than BSC6900 V900R011Transport35ADD ADJMAP(Mandatory)MOD
ADJMAP(Optional)Silver user Load EQ indexMNG LISilver user load EQ
index used by the current adjacent
nodeADJMAPLEISLVLEISLVBSC6900NOYESWRFD-021305RAN Sharing Phase
2Interval Type0~630~63NoneNoneNoneAdjacent nodeThe load EQ table
index is configured by setting the value of "LEI" in "ADD
LOADEQ".Read & WriteN (No impact on the UE in idle mode)Not
involvedNot involvedThe load EQ table is configured already.The
parameter modification has no impact on the equipment.NoneVersions
earlier than BSC6900 V900R011Transport36ADD ADJMAP(Mandatory)MOD
ADJMAP(Optional)Bronze user Load EQ indexMNG LIBronze user load EQ
index used by the current adjacent
nodeADJMAPLEIBRZLEIBRZBSC6900NOYESWRFD-021305RAN Sharing Phase
2Interval Type0~630~63NoneNoneNoneAdjacent nodeThe load EQ table
index is configured by setting the value of "LEI" in "ADD
LOADEQ".Read & WriteN (No impact on the UE in idle mode)Not
involvedNot involvedThe load EQ table is configured already.The
parameter modification has no impact on the equipment.NoneVersions
earlier than BSC6900 V900R011Transport37ADD ADJNODE(Mandatory)NodeB
IDMNG LIID of the adjacent node to be added. The parameter is valid
when Adjacent node type is set to
IUB.ADJNODENODEBIDNODEBIDBSC6900NOYESWRFD-05030104Dynamic AAL2
Connections in Iub/IuCS/Iur InterfaceInterval
Type0~655350~65535NoneNoneNoneAdjacent nodeWhen the value of
"NODET" in "ADD ADJNODE" is set to IUB, this parameter is
valid.Read & WriteNot involvedNot involvedNot involvedThe
parameter cannot be modified.Not involvedNoneVersions earlier than
BSC6900 V900R011Transport38ADD ADJNODE(Mandatory)SGSN FLAGMNG
LIThis parameter is valid when the node type is set to IUPS. If the
parameter is set to No, it indicates the GGSN. The dpx needs not to
be configured.ADJNODESGSNFLGSGSNFLGBSC6900NOYESWRFD-020111One
TunnelEnumeration TypeNO(GGSN), YES(SGSN)NO,
YESNoneNoneNoneAdjacent nodeWhen the value of "NODET" in "ADD
ADJNODE" is set to IUPS, this parameter is valid.Read &
WriteNot involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport39ADD ADJNODE(Mandatory)DPX IndexMNG LIThis
parameter is valid when the node type is set to IUR, IUCS, IUPS, or
NNI_AAL2SWITCH.ADJNODEDPXDPXBSC6900NOYESWRFD-0101013GPP
SpecificationsInterval Type0~1860~186NoneNoneNoneAdjacent nodeWhen
the value of "NODET" in "ADD ADJNODE" is set to IUR, IUCS, or
NNI_AAL2SWITCH, or the value of "NODET" in "ADD ADJNODE" is set to
IUPS and "SGSNFLG" in "ADD ADJNODE" is set to YES, this parameter
is valid.Read & WriteNot involvedNot involvedNot involvedThe
parameter cannot be modified.Not involvedNoneVersions earlier than
BSC6900 V900R011Transport40ADD ADJNODE(Mandatory)Upper AniMNG
LIWhether to indicate it is the upper level adjacent node when "Is
Root Node" is set to
No.ADJNODEUPPERANIUPPERANIBSC6900NOYESWRFD-05030104Dynamic AAL2
Connections in Iub/IuCS/Iur InterfaceInterval
Type0~45990~4599NoneNoneNoneAdjacent nodeWhen the value of
"IsROOTNODE" in "ADD ADJNODE" is set to NO, this parameter is
valid.Read & WriteNot involvedNot involvedNot involvedThe
parameter cannot be modified.Not involvedNoneVersions earlier than
BSC6900 V900R011Transport41ADD ADJNODE(Mandatory)MOD
ADJNODE(Mandatory)RMV ADJNODE(Mandatory)Adjacent Node IDMNG
LIUniquely identifies an adjacent
nodeADJNODEANIANIBSC6900YESYESWRFD-05030104Dynamic AAL2 Connections
in Iub/IuCS/Iur InterfaceInterval
Type0~45990~4599NoneNoneNoneAdjacent nodeNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport42ADD ADJNODE(Mandatory)MOD
ADJNODE(Optional)Adjacent Node NameMNG LIName of the adjacent
nodeADJNODENAMENAMEBSC6900NOYESNoneNoneString TypeNone1~31
charactersNoneNoneNoneNoneNoneRead & WriteN (No impact on the
UE in idle mode)Not involvedNot involvedNoneThe parameter
modification has no impact on the equipment.NoneVersions earlier
than BSC6900 V900R011Transport43ADD ADJNODE(Mandatory)MOD
ADJNODE(Optional)Adjacent Node TypeMNG LIType of the adjacent
nodeADJNODENODETNODETBSC6900NOYESWRFD-05030104Dynamic AAL2
Connections in Iub/IuCS/Iur InterfaceEnumeration TypeIUB(Iub
Interface), IUR(Iur Interface), IUCS(Iu-CS Interface), IUPS(Iu-PS
Interface), UNI_AAL2SWITCH(the adjacent node of the ATM switch on
the Iub interface), NNI_AAL2SWITCH(the adjacent node of ATM switch
on Iur or Iu-CS interface)IUB, IUR, IUCS, IUPS, UNI_AAL2SWITCH,
NNI_AAL2SWITCHNoneNoneNoneAdjacent nodeNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport44ADD ADJNODE(Mandatory)MOD
ADJNODE(Optional)Transport TypeMNG LITransport
typeADJNODETRANSTTRANSTBSC6900NOYESWRFD-05030104Dynamic AAL2
Connections in Iub/IuCS/Iur InterfaceEnumeration TypeATM(ATM),
IP(IP), ATM_IP(ATM and IP), HYBRID_IP(HYBRID IP)ATM, IP, ATM_IP,
HYBRID_IPNoneNoneNoneAdjacent nodeWhen the value of "NODET" in "ADD
ADJNODE" is set to IUB, IUR, IUCS, or IUPS, this parameter is
valid.Read & WriteNot involvedNot involvedNot involvedThe
parameter cannot be modified.Not involvedNoneVersions earlier than
BSC6900 V900R011Transport45ADD ADJNODE(Mandatory)MOD
ADJNODE(Optional)Is Root NodeMNG LIWhether to indicate it is the
root node when the transport type is ATM or
ATM_IPADJNODEIsROOTNODEISROOTNODEBSC6900NOYESWRFD-05030104Dynamic
AAL2 Connections in Iub/IuCS/Iur InterfaceEnumeration TypeNO(Not
Root Node), YES(Root Node)NO, YESNoneNoneNoneAdjacent nodeWhen the
value of "NODET" in "ADD ADJNODE" is set to IUB, IUR, or IUCS, and
the value of "TRANST" in "ADD ADJNODE" is set to ATM or ATM_IP,
this parameter is valid.Read & WriteNot involvedNot involvedNot
involvedThe parameter cannot be modified.Not involvedNoneVersions
earlier than BSC6900 V900R011Transport46ADD ADJNODE(Mandatory)MOD
ADJNODE(Optional)Subrack No.MNG LINumber of the
subrackADJNODESRNSRNBSC6900NOYESNoneNoneInterval
Type0~110~11NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot
involvedNot involvedThe parameter cannot be modified.Not
involvedNoneVersions earlier than BSC6900 V900R011Transport47ADD
ADJNODE(Mandatory)MOD ADJNODE(Optional)Slot No.MNG LIThis parameter
is valid when the node type is set to UNI_AAL2SWITCH. It is the
slot number of the SAAL link of the AAL2 signaling bearing the
adjacent node.ADJNODESNSNBSC6900NOYESNoneNoneInterval
Type0,2,4,8,10,12,14,16,18,20,22,24,260, 2, 4, 8, 10, 12, 14, 16,
18, 20, 22, 24, 26NoneNoneNoneAdjacent nodeWhen the value of
"NODET" in "ADD ADJNODE" is set to IUB, and the value of
"IsROOTNODE" in "ADD ADJNODE" is set to YES, or the value of
"NODET" in "ADD ADJNODE" is set to UNI_AAL2SWITCH, this parameter
is valid.Read & WriteNot involvedNot involvedNot involvedThe
parameter cannot be modified.Not involvedNoneVersions earlier than
BSC6900 V900R011Transport48ADD ADJNODE(Mandatory)MOD
ADJNODE(Optional)SAAL link No.MNG LISAAL link number of the XPU
board. This number identifies an SAAL link
uniquely.ADJNODESAALLNKNSAALLNKNBSC6900NOYESWRFD-050301ATM
Transmission Introduction PackageInterval
Type0~13990~1399NoneNoneNoneSAAL linkNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport49ADD ADJNODE(Optional)MOD ADJNODE(Optional)Qaal2
Protocol VersionMNG LIFunction set of the adjacent node supported
by local BSC6900. When the parameter is set to CS1, it indicates
that the local BSC6900 is interconnected to the adjacent node by
using the CS1 protocol version. When the parameter is set to CS2,
it indicates that the local BSC6900 is interconnected to the
adjacent node by using the CS2 protocol version. The CS2 protocol
version is backward compatible with the CS1. By default, the
parameter is set to CS2. When the peer is not compatible with the
local CS2 messages (the peer does not process the compatible domain
according to protocol requirements), the protocol version is set to
CS1.ADJNODEQAAL2VERQAAL2VERBSC6900NONOWRFD-05030104Dynamic AAL2
Connections in Iub/IuCS/Iur InterfaceEnumeration TypeCS1(CS1
Version), CS2(CS2 Version)CS1, CS2NoneCS2CS2Adjacent nodeWhen the
value of "NODET" in "ADD ADJNODE" is set to IUB, IUR, or IUCS, and
the value of "IsROOTNODE" in "ADD ADJNODE" is set to YES, or the
value of "NODET" in "ADD ADJNODE" is set to UNI_AAL2SWITCH or
NNI_AAL2SWITCH, this parameter is valid.Read & WriteN (No
impact on the UE in idle mode)Not involvedNot involvedWhen the
parameter is set to CS1, it indicates that the local RNC is
interconnected to the adjacent node by using the CS1 protocol
version. When the parameter is set to CS2, it indicates that the
local RNC is interconnected to the adjacent node by using the CS2
protocol version. The CS2 protocol version is backward compatible
with the CS1. By default, the parameter is set to CS2. When the
peer is not compatible with the local CS2 messages (the peer does
not process the compatible domain according to protocol
requirements), the protocol version is set to CS1.The parameter
modification has no impact on the equipment.NoneVersions earlier
than BSC6900 V900R011Transport50ADD ATMLOGICPORT(Mandatory)The
bearing type of the logic portMNG LIBearer type of the logical
portATMLOGICPORTCARRYTCARRYTBSC6900NOYESNoneNoneEnumeration
TypeIMA, UNI, FRA, NCOPT, ATMLOGICPORTIMA, UNI, FRA, NCOPT,
ATMLOGICPORTNoneNoneNoneATM logical portNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport51ADD ATMLOGICPORT(Mandatory)MOD
ATMLOGICPORT(Mandatory)Type of the logic portMNG LIType of logical
portATMLOGICPORTLPNTYPELPNTYPEBSC6900NOYESNoneNoneEnumeration
TypeHub(Hub), Leaf(Leaf)Hub, LeafNoneNoneNoneATM logical
portNoneRead & WriteNot involvedNot involvedNot involvedThe
parameter cannot be modified.Not involvedNoneVersions earlier than
BSC6900 V900R011Transport52ADD ATMLOGICPORT(Mandatory)MOD
ATMLOGICPORT(Optional)Forward bandwidth [kbps]MNG LIBackward
bandwidth of the logical
portATMLOGICPORTTXBWTXBWBSC6900NOYESNoneNoneInterval
Type512~149000512~149000kbit/sNoneNoneATM logical portNoneRead
& WriteNot involvedNot involvedNot involvedThe parameter cannot
be modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport53ADD ATMLOGICPORT(Mandatory)MOD
ATMLOGICPORT(Optional)Backward bandwidth [kbps]MNG LIBackward
bandwidth of the logical
portATMLOGICPORTRXBWRXBWBSC6900NOYESNoneNoneInterval
Type512~149000512~149000kbit/sNoneNoneATM logical portNoneRead
& WriteNot involvedNot involvedNot involvedThe parameter cannot
be modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport54ADD ATMLOGICPORT(Mandatory)RMV
ATMLOGICPORT(Mandatory)MOD ATMLOGICPORT(Mandatory)Subrack No.MNG
LINumber of the
subrackATMLOGICPORTSRNSRNBSC6900YESYESMRFD-210301Configuration
ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment55ADD
ATMLOGICPORT(Mandatory)RMV ATMLOGICPORT(Mandatory)MOD
ATMLOGICPORT(Mandatory)Slot No.MNG LIIndicates the slot number for
running this commandATMLOGICPORTSNSNBSC6900YESYESNoneNoneInterval
Type0~5,8~270~5, 8~27NoneNoneNoneBSC6900NoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Equipment56ADD ATMLOGICPORT(Optional)The logic port
numberMNG LILogical port
numberATMLOGICPORTLPNLPNBSC6900YESNONoneNoneInterval
Type0~499,512~7670~499, 512~767NoneNoneNoneNoneNoneRead &
WriteNot involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport57ADD ATMLOGICPORT(Optional)IMA group No.MNG LIIMA
group number of the logical
portATMLOGICPORTCARRYIMAGRPNCARRYIMAGRPNBSC6900NONONoneNoneInterval
Type0~1670~167NoneNoneNoneATM logical portNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport58ADD ATMLOGICPORT(Optional)Bearing UNI link
No.MNG LIUNI link
numberATMLOGICPORTCARRYUNILNKNCARRYUNILNKNBSC6900NONONoneNoneInterval
Type0~3350~335NoneNoneNoneATM logical portNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport59ADD ATMLOGICPORT(Optional)FRAATM link No.MNG
LIFractional ATM link number of the logical
portATMLOGICPORTCARRYFRAATMLNKNCARRYFRAATMLNKNBSC6900NONONoneNoneInterval
Type0~310~31NoneNoneNoneATM logical portNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport60ADD ATMLOGICPORT(Optional)Optical port No.MNG
LIOptical interface number of the logical
portATMLOGICPORTCARRYPNCARRYPNBSC6900NONONoneNoneInterval
Type0~70~7NoneNoneNoneATM logical portNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport61ADD ATMLOGICPORT(Optional)The Upper Logic port
NumberMNG LIUpper number of the logical
portATMLOGICPORTUPPERVPUPPERVPBSC6900NONONoneNoneInterval
Type128~447,512~767128~191(AEUa), 256~383(AOUa), 384~447(UOIa_ATM),
512~767(AOUc), 512~767(UOIc)NoneNoneNoneNoneNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport62ADD ATMLOGICPORT(Optional)Resource management
modeMNG LIResource management mode of logical
portATMLOGICPORTRSCMNGMODERSCMNGMODEBSC6900NONONoneNoneEnumeration
TypeSHARE, EXCLUSIVESHARE, EXCLUSIVENoneNoneNoneATM logical
portNoneRead & WriteNot involvedNot involvedNot involvedThe
parameter cannot be modified.Not involvedNoneVersions earlier than
BSC6900 V900R011Transport63ADD ATMLOGICPORT(Optional)CN operator
indexMNG LIIndex of the
operatorATMLOGICPORTCNOPINDEXCNOPINDEXBSC6900NONONoneNoneInterval
Type0~30~3NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot
involvedNot involvedThe parameter cannot be modified.Not
involvedNoneVersions earlier than BSC6900 V900R011Equipment64ADD
ATMLOGICPORT(Optional)Flow control parameter indexMNG LIFlow
control parameter
indexATMLOGICPORTFCINDEXFCINDEXBSC6900NONONoneNoneInterval
Type0~19990~1999None11ATM logical portNoneRead & WriteN (No
impact on the UE in idle mode)Not involvedNot involvedFlow control
function can be affected if this parameter is modified.The
parameter modification has no impact on the equipment.NoneVersions
earlier than BSC6900 V900R011Transport65ADD
ATMLOGICPORT(Optional)TRM load threshold indexMNG LITRM load
threshold
indexATMLOGICPORTTRMLOADTHINDEXTRMLOADTHINDEXBSC6900NONONoneNoneInterval
Type0~1990~199None00NoneNoneRead & WriteN (No impact on the UE
in idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Transport66ADD ATMLOGICPORT(Optional)MOD
ATMLOGICPORT(Optional)Board typeMNG LIBoard
typeATMLOGICPORTBTBTBSC6900NONONoneNoneEnumeration TypeAEUa, AOUa,
UOIa, AOUc, UOIcAEUa, AOUa, UOIa, AOUc,
UOIcNoneNoneNoneNoneNoneRead & WriteNot involvedNot involvedNot
involvedThe parameter cannot be modified.Not involvedNoneVersions
earlier than BSC6900 V900R011Transport67ADD
ATMLOGICPORT(Optional)MOD ATMLOGICPORT(Optional)Flow control
switchMNG LILogical port flow control
switchATMLOGICPORTFLOWCTRLSWITCHFLOWCTRLSWITCHBSC6900NONONoneNoneEnumeration
TypeOFF(OFF), ON(ON)OFF, ONNoneONONATM logical portNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedflow control function can be affected if this parameter is
modified.The parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Transport68ADD
ATMTRF(Mandatory)Service typeMNG LIService type in the
ATMATMTRFSTSTBSC6900NOYESNoneNoneEnumeration TypeUBR, CBR, RTVBR,
NRTVBR, UBR_PLUSUBR, CBR, RTVBR, NRTVBR, UBR_PLUSNoneNoneIt is
recommended that the service type of signaling link be CBR, the
real-time service be CBR or RTVBR, the non-real-time service be
NRTVBR, and the OAM data link be UBR_PLUS.PVCNoneRead &
WriteNot involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport69ADD ATMTRF(Mandatory)RMV ATMTRF(Mandatory)MOD
ATMTRF(Mandatory)Traffic indexMNG LITraffic
indexATMTRFTRFXTRFXBSC6900YESYESNoneNoneInterval
Type100~1999100~1999NoneNoneNoneNoneNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport70ADD ATMTRF(Optional)Rate unitMNG LIRate
unitATMTRFUTUTBSC6900NONONoneNoneEnumeration TypeCELL/S,
KBIT/SCELL/S, KBIT/SNoneNoneNonePVCNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport71ADD ATMTRF(Optional)Peak cell rateMNG LIPeak
rate of the ATM trafficATMTRFPCRPCRBSC6900NONONoneNoneInterval
Type30~35320730~353207NoneNoneNonePVCNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport72ADD ATMTRF(Optional)Sustainable cell rateMNG
LIAverage rate of the ATM
trafficATMTRFSCRSCRBSC6900NONONoneNoneInterval
Type30~11792430~117924NoneNoneNonePVCNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport73ADD ATMTRF(Optional)Minimum cell rateMNG
LIMinimum guarantee rate of the ATM
trafficATMTRFMCRMCRBSC6900NONONoneNoneInterval
Type30~7075430~70754NoneNoneNonePVCNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport74ADD ATMTRF(Optional)Max burst sizeMNG LIMaximum
burst size (MBS)ATMTRFMBSMBSBSC6900NONONoneNoneInterval
Type3~100003~10000byteNone1000PVCNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport75ADD ATMTRF(Optional)Cell delay variation
toleranceMNG LITolerable delay
jitterATMTRFCDVTCDVTBSC6900NONONoneNoneInterval
Type1024~2120001024~212000100ns10241024PVCNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport76ADD ATMTRF(Optional)MOD ATMTRF(Mandatory)Traffic
use descriptionMNG LIPurpose description of the ATM traffic
recordATMTRFREMARKREMARKBSC6900NONONoneNoneString TypeNone1~250
charactersNoneNoneNoneNoneNoneRead & WriteN (No impact on the
UE in idle mode)Not involvedNot involvedNoneThe parameter
modification has no impact on the equipment.NoneVersions earlier
than BSC6900 V900R011Transport77ADD BRD(Mandatory)Board ClassMNG
LIClasses of boards classified according to function
modulesBRDBRDCLASSBRDCLASSBSC6900NOYESMRFD-210301Configuration
ManagementConfiguration ManagementEnumeration TypeINT, DPU, XPU,
OMU, SAUINT, DPU, XPU, OMU, SAUNoneNoneNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment78ADD
BRD(Mandatory)BackupMNG LIWhether to back up the data of the
boardBRDREDREDBSC6900NOYESMRFD-210301Configuration
ManagementEnumeration TypeYES(YES), NO(NO)YES,
NONoneNoneNoneBoardNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment79ADD BRD(Mandatory)RMV BRD(Mandatory)MOD
BRD(Mandatory)Subrack No.MNG LINumber of the
subrackBRDSRNSRNBSC6900NOYESMRFD-210301Configuration
ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment80ADD
BRD(Mandatory)RMV BRD(Mandatory)MOD BRD(Mandatory)Slot No.MNG
LINumber of the slotBRDSNSNBSC6900NOYESMRFD-210301Configuration
ManagementInterval Type0~270~27NoneNoneNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment81ADD
BRD(Optional)Board TypeMNG LIType of the
boardBRDBRDTYPEBRDTYPEBSC6900NONOMRFD-210301Configuration
ManagementEnumeration TypePEUa, AEUa, FG2a, GOUa, AOUa, POUa, UOIa,
AOUc, POUc, UOIc, FG2c, GOUc, SPUa, SPUb, DPUb, DPUe, OMUa, OMUb,
SAUaPEUa, AEUa, FG2a, GOUa, AOUa, POUa, UOIa, AOUc, POUc, UOIc,
FG2c, GOUc, SPUa, SPUb, DPUb, DPUe, OMUa, OMUb,
SAUaNoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment82ADD BRD(Optional)Logical function typeMNG
LILogical function type of the boardOAM:Operation And Maintenance
ProcessUCP:All the UCP subsystems are configured as CPUS to act as
the control plane processing subsystems for UMTS RNCRUCP:Subsystem
0 of RUCP is configured as the MPU subsystem to act as the resource
management subsystem. The other seven subsystems are configured as
CPUS to act as the control plane processing subsystems for UMTS
RNCUUP:UMTS RNC User plane ProcessATM:AEUa/ATM ATM over E1/T1/J1
interface,AOUa/ATM ATM over channelized Optical STM-1/OC-3
interface,AOUc/ATM ATM over channelized Optical STM-1/OC-3
interface,UOIa/ATM ATM over Unchannelized Optical STM-1/OC-3
interface,UOIc/ATM ATM over Unchannelized Optical STM-1/OC-3
interfaceIP:GOUc/IP IP over GE Optical interface,GOUa/IP IP over GE
Optical interface,PEUa/IP IP over E1/T1/J1 interface,FG2c/IP IP
over FE/GE interface,FG2a/IP IP over FE/GE interface,POUc/IP IP
over channelized Optical STM-1/OC-3 interface,POUa/IP IP over
channelized Optical STM-1/OC-3 interface,UOIa/IP IP over
Unchannelized Optical STM-1/OC-3 interfaceSAU:System Aware
UintBRDLGCAPPTYPELGCAPPTYPEBSC6900NONOMRFD-210301Configuration
ManagementEnumeration TypeOAM, UCP, RUCP, UUP, ATM, IP, SAUOAM,
UCP, RUCP, UUP, ATM, IP, SAUNoneNoneNoneNoneNoneRead & WriteN
(No impact on the UE in idle mode)Not involvedNot involvedNoneThe
parameter modification has no impact on the equipment.NoneVersions
earlier than BSC6900 V900R011Equipment83ADD BRD(Optional)MPU
Subrack No.MNG LINumber of the subrack where the MPU subsystem is
locatedBRDMPUSUBRACKMPUSUBRACKBSC6900NONOMRFD-210301Configuration
ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment84ADD
BRD(Optional)MPU Slot No.MNG LINumber of the slot where the MPU
subsystem is
locatedBRDMPUSLOTMPUSLOTBSC6900NONOMRFD-210301Configuration
ManagementInterval Type0~270~27NoneNoneNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment85ADD
BRD(Optional)Support FRAMNG LIWhether to support the FRA (E1/T1
frame relay interface
board)BRDISSUPPORTFRAISSUPPORTFRABSC6900NONOMRFD-210301Configuration
ManagementEnumeration TypeNO(NO), YES(YES)NO,
YESNoneNoneNoneNoneNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment86ADD CAB(Mandatory)RMV CAB(Mandatory)Cabinet
No.MNG LINumber of the
cabinetCABCNCNBSC6900NOYESMRFD-210301Configuration
ManagementInterval Type1~31~3NoneNoneNoneNoneNoneRead &
WriteNot involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Equipment87ADD CCG(Mandatory)RMV CCG(Mandatory)Command
GroupMNG LICustomized command group to be
processedCCGCGCGBSC6900NOYESMRFD-210305Security
ManagementEnumeration TypeG_15, G_16, G_17, G_18, G_19, G_20, G_21,
G_22, G_23, G_24, G_25, G_26, G_27, G_28, G_29, G_30, G_31G_15,
G_16, G_17, G_18, G_19, G_20, G_21, G_22, G_23, G_24, G_25, G_26,
G_27, G_28, G_29, G_30, G_31NoneNoneNoneBSC6900NoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment88ADD
CCG(Mandatory)RMV CCG(Mandatory)Command NameMNG LIYou can select
one or more commands.CCGCMDCMDBSC6900NOYESMRFD-210305Security
ManagementString TypeNone0~128
charactersNoneNoneNoneBSC6900NoneRead & WriteN (No impact on
the UE in idle mode)Not involvedNot involvedNoneThe parameter
modification has no impact on the equipment.NoneVersions earlier
than BSC6900 V900R011Equipment89ADD CFMMA(Mandatory)MD IndexMNG
LIIdentifies a maintenance
domainCFMMAMDIDXMDIDXBSC6900YESYESWRFD-050425Ethernet OAMInterval
Type0~70~7NoneNoneNoneBoardNoneRead & WriteNot involvedNot
involvedNot involvedThe parameter cannot be modified.Not
involvedNoneVersions earlier than BSC6900 V900R011Transport90ADD
CFMMA(Mandatory)VLAN IDMNG LIVLAN of the MA in the
MDCFMMAVLANIDVLANIDBSC6900NOYESWRFD-050425Ethernet OAMInterval
Type2~40942~4094NoneNoneNoneEthernet portNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport91ADD CFMMA(Mandatory)MA NameMNG LIName of the
MACFMMAMANAMEMANAMEBSC6900NOYESNoneNoneString TypeNone1~20
charactersNoneNoneNoneEthernet portNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport92ADD CFMMA(Mandatory)RMV CFMMA(Mandatory)Subrack
No.MNG LINumber of the
subrackCFMMASRNSRNBSC6900YESYESMRFD-210301Configuration
ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment93ADD
CFMMA(Mandatory)RMV CFMMA(Mandatory)Slot No.MNG LIIndicates the
slot number for running this
commandCFMMASNSNBSC6900YESYESNoneNoneInterval Type0~5,8~270~5,
8~27NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot
involvedNot involvedThe parameter cannot be modified.Not
involvedNoneVersions earlier than BSC6900 V900R011Equipment94ADD
CFMMA(Mandatory)RMV CFMMA(Mandatory)MA IndexMNG LIIdentifies a
maintenance group.Maintenance group: maintenance alliance (MA),
which is a component of the maintenance domain (MD). Maintenance
domain is an Ethernet or a component of an Ethernet in which the
connectivity failure management is performed. The maintenance
domain is uniformly managed by one ISP. One MD can be divided into
one or more maintenance
group.CFMMAMAIDXMAIDXBSC6900NOYESWRFD-050425Ethernet OAMInterval
Type0~4990~499NoneNoneNoneBoardNoneRead & WriteNot involvedNot
involvedNot involvedThe parameter cannot be modified.Not
involvedNoneVersions earlier than BSC6900 V900R011Transport95ADD
CFMMA(Optional)CCM Send PridMNG LITransmission period of the CCM
packet in the
MACFMMACCMINTERVALCCMINTERVALBSC6900NONOWRFD-050425Ethernet
OAMEnumeration Type10, 100, 100010, 100, 1000ms10001000Ethernet
portNoneRead & WriteNot involvedNot involvedNot involvedThe
parameter cannot be modified.Not involvedNoneVersions earlier than
BSC6900 V900R011Transport96ADD CFMMD(Mandatory)Subrack No.MNG LIThe
subrack number for running this
commandCFMMDSRNSRNBSC6900YESYESNoneNoneInterval
Type0~110~11NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot
involvedNot involvedThe parameter cannot be modified.Not
involvedNoneVersions earlier than BSC6900 V900R011Equipment97ADD
CFMMD(Mandatory)MD NameMNG LIname of the
MDCFMMDMDNameMDNAMEBSC6900NOYESNoneNoneString TypeNone1~20
charactersNoneNoneNoneEthernet portNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport98ADD CFMMD(Mandatory)RMV CFMMD(Mandatory)Slot
No.MNG LIIndicates the slot number for running this
commandCFMMDSNSNBSC6900YESYESNoneNoneInterval Type0~5,8~270~5,
8~27NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot
involvedNot involvedThe parameter cannot be modified.Not
involvedNoneVersions earlier than BSC6900 V900R011Equipment99ADD
CFMMD(Mandatory)RMV CFMMD(Mandatory)MD IndexMNG LIIdentifies a
maintenance domainCFMMDMDIDXMDIDXBSC6900YESYESWRFD-050425Ethernet
OAMInterval Type0~70~7NoneNoneNoneBoardNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport100ADD CFMMD(Optional)MD LevelMNG LIClass of the
maintenance domainCFMMDLevelLEVELBSC6900NONOWRFD-050425Ethernet
OAMInterval Type0~70~7None00Ethernet portNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport101ADD CFMMEP(Mandatory)MEP TypeMNG LIThe type of
the maintenance point added to the maintenance group. LocalMep
indicates a local maintenance point and RemoteMep indicates a
remote maintenance
point.CFMMEPMEPTYPEMEPTYPEBSC6900YESYESWRFD-050425Ethernet
OAMEnumeration TypeLocalMep(LocalMep),
RemoteMep(RemoteMep)LocalMep, RemoteMepNoneNoneNoneEthernet
portNoneRead & WriteN (No impact on the UE in idle mode)Not
involvedNot involvedNoneThe parameter modification has no impact on
the equipment.NoneVersions earlier than BSC6900
V900R011Transport102ADD CFMMEP(Mandatory)Port TypeMNG LIIndicates
the type of the physical port used by the local maintenance point
in the maintenance group. FE indicates the FE port and TRUNK
indicates the aggregation
group.CFMMEPPORTTYPEPORTTYPEBSC6900NOYESWRFD-050425Ethernet
OAMEnumeration TypeETHER, TRUNKETHER, TRUNKNoneNoneNoneEthernet
portNoneRead & WriteNot involvedNot involvedNot involvedThe
parameter cannot be modified.Not involvedNoneVersions earlier than
BSC6900 V900R011Transport103ADD CFMMEP(Mandatory)Port No.MNG
LIEthernet portCFMMEPPNPNBSC6900NOYESNoneNoneInterval
Type0~110~7(FG2a), 0~1(GOUa), 0~11(FG2c),
0~3(GOUc)NoneNoneNoneEthernet portIf port 0 or port 4 of the FG2a
board is set to the GE port, the port number can only be 0 or 4.
Otherwise, the port number ranges from 0 to 7. If only port 0 is
set to the GE port, ports 1-3 are unavailable. If port 4 is set to
the GE port, ports 5-7 are unavailable.Read & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport104ADD CFMMEP(Mandatory)Trunk No.MNG LITRUNK group
numberCFMMEPTRUNKNTRUNKNBSC6900NOYESWRFD-050425Ethernet OAMInterval
Type0~110~11NoneNoneNoneEthernet portNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport105ADD CFMMEP(Mandatory)RMV
CFMMEP(Mandatory)Subrack No.MNG LINumber of the
subrackCFMMEPSRNSRNBSC6900YESYESMRFD-210301Configuration
ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment106ADD
CFMMEP(Mandatory)RMV CFMMEP(Mandatory)MA IndexMNG LIIdentifies a
maintenance group.Maintenance group: maintenance alliance (MA),
which is a component of the maintenance domain (MD). Maintenance
domain is an Ethernet or a component of an Ethernet in which the
connectivity failure management is performed. The maintenance
domain is uniformly managed by one ISP. One MD can be divided into
one or more maintenance
group.CFMMEPMAIDXMAIDXBSC6900YESYESWRFD-050425Ethernet OAMInterval
Type0~4990~499NoneNoneNoneBoardNoneRead & WriteNot involvedNot
involvedNot involvedThe parameter cannot be modified.Not
involvedNoneVersions earlier than BSC6900 V900R011Transport107ADD
CFMMEP(Mandatory)RMV CFMMEP(Mandatory)MEP IDMNG LIIdentifies a
maintenance point in the maintenance allianceA maintenance point is
an edge node of the
MA.CFMMEPMEPIDMEPIDBSC6900YESYESWRFD-050425Ethernet OAMInterval
Type1~10001~1000NoneNoneNoneEthernet portNoneRead & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport108ADD CFMMEP(Mandatory)RMV CFMMEP(Mandatory)Slot
No.MNG LIIndicates the slot number for running this
commandCFMMEPSNSNBSC6900NOYESNoneNoneInterval Type0~5,8~270~5,
8~27NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot
involvedNot involvedThe parameter cannot be modified.Not
involvedNoneVersions earlier than BSC6900 V900R011Equipment109ADD
CLKSRC(Mandatory)Clock source typeMNG LIType of the clock
source.CLKSRCSRCTSRCTBSC6900NOYESMRFD-210502BSC/RNC
ClockEnumeration TypeBITS1-2MHZ(2MHZ Building Integrated Timing
Supply system 1), BITS2-2MHZ(2MHZ Building Integrated Timing Supply
system 2), BITS1-2MBPS(2MBPS Building Integrated Timing Supply
system 1), BITS2-2MBPS(2MBPS Building Integrated Timing Supply
system 2), 8KHZ(8KHZ), GPS(Globe Positioning System),
LINE1_8KHZ(8KHZ line1), LINE2_8KHZ(8KHZ line2), BITS1-T1BPS(T1BPS
Building Integrated Timing Supply system 1), BITS2-T1BPS(T1BPS
Building Integrated Timing Supply system 2)BITS1-2MHZ, BITS2-2MHZ,
BITS1-2MBPS, BITS2-2MBPS, GPS, 8KHZ, LINE1_8KHZ, LINE2_8KHZ,
BITS1-T1BPS, BITS2-T1BPSNoneNoneNoneNoneNoneRead & WriteN (No
impact on the UE in idle mode)Not involvedNot involvedClock sources
and priorities are in one-to-one mapping. Each backplane board 8K
clock has only one clock source.The parameter modification has no
impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment110ADD CLKSRC(Mandatory)RMV CLKSRC(Mandatory)Clock
source priorityMNG LIPriority of the clock
source.CLKSRCSRCGRDSRCGRDBSC6900NOYESMRFD-210502BSC/RNC
ClockInterval Type1~41~4NoneNoneNoneNoneNoneRead & WriteN (No
impact on the UE in idle mode)Not involvedNot involvedClock sources
and priorities are in one-to-one mapping.The parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment111ADD DEVIP(Mandatory)Subrack No.MNG LINumber of
the subrackDEVIPSRNSRNBSC6900NOYESMRFD-210301Configuration
ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment112ADD
DEVIP(Mandatory)Slot No.MNG LIIndicates the slot number for running
this commandDEVIPSNSNBSC6900NOYESNoneNoneInterval Type0~5,8~270~5,
8~27NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot
involvedNot involvedThe parameter cannot be modified.Not
involvedNoneVersions earlier than BSC6900 V900R011Equipment113ADD
DEVIP(Mandatory)Device IP Address TypeMNG LIDevice IP Address
TypeDEVIPDEVTYPEDEVTYPEBSC6900NOYESNoneNoneEnumeration
TypeLOGIC_IP(Logical IP Address), IPOA_CLIENT_IP(IPOA Client IP
Address)LOGIC_IP, IPOA_CLIENT_IPNoneNoneNoneBSC6900NoneRead &
WriteNot involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneBSC6900 V900R011Equipment114ADD
DEVIP(Mandatory)Subnet maskMNG LISubnet mask of the
boardDEVIPMASKMASKBSC6900NOYESNoneNoneIP Address
TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead &
WriteNot involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport115ADD DEVIP(Mandatory)RMV DEVIP(Mandatory)IP
addressMNG LIIP address of the
boardDEVIPIPADDRIPADDRBSC6900YESYESMRFD-211502IP-Based 2G/3G
Co-Transmission on MBSC SideIP Address
TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead &
WriteNot involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport116ADD DEVIP(Optional)MTU[Byte]MNG LIMaximum
transmission unitDEVIPMTUMTUBSC6900NONONoneNoneInterval
Type776~1696776~1696byte16961696BSC6900NoneRead &
WriteYBSC6900If the MTU configuration fails to meet the requirement
of the network, the services will be adversely affected.The
interconnection may be affected if this parameter is modified.The
parameter modification has no impact on the equipment.NoneBSC6900
V900R011Transport117ADD DHCPRLY(Mandatory)Gateway IP address of a
DHCP relayMNG LIThis parameter specifies the gateway IP address of
a DHCP
relay.DHCPRLYDHCPRLYGATEWAYIPDHCPRLYGATEWAYIPBSC6900NOYESNoneNoneIP
Address TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead
& WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneBSC6900 V900R011Transport118ADD DHCPRLY(Mandatory)RMV
DHCPRLY(Mandatory)ID of a DHCP relayMNG LIThis parameter specifies
the ID of a DHCP
relay.DHCPRLYDHCPRLYIDDHCPRLYIDBSC6900NOYESNoneNoneInterval
Type0~630~63NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot
involvedNot involvedThe parameter cannot be modified.Not
involvedNoneBSC6900 V900R011Equipment119ADD EMSIP(Mandatory)EMS IP
AddressMNG LIIP address of the NE management
systemEMSIPEMSIPEMSIPBSC6900YESYESNoneNoneIP Address
TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment120ADD
EMSIP(Mandatory)Subnet maskMNG LISubnet mask of the
boardEMSIPMASKMASKBSC6900NOYESNoneNoneIP Address
TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead &
WriteNot involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport121ADD EMSIP(Optional)OMU External Network Virtual
IPMNG LIExternal virtual IP address of the
OMUEMSIPOMUIPOMUIPBSC6900NONONoneNoneIP Address
TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment122ADD
EMSIP(Optional)OMU External Network MaskMNG LISubnet mask of the
OMU in the external networkEMSIPOMUMASKOMUMASKBSC6900NONONoneNoneIP
Address TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead
& WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment123ADD
EMU(Mandatory)RMV EMU(Mandatory)MOD EMU(Mandatory)Subrack No.MNG
LINumber of the
subrackEMUSRNSRNBSC6900NOYESMRFD-210301Configuration
ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment124ADD
EMU(Optional)MOD EMU(Optional)Enable Alarm Reporting for 48V
PowerMNG LI48V voltage alarm
switchEMUVOL48_MASKVOL48_MASKBSC6900NONOMRFD-210304Faulty
ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE,
OPENNoneOPENNoneNoneNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment125ADD EMU(Optional)MOD EMU(Optional)Enable Alarm
Reporting for 24V PowerMNG LI24V voltage alarm
switchEMUVOL24_MASKVOL24_MASKBSC6900NONOMRFD-210304Faulty
ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE,
OPENNoneOPENNoneNoneNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment126ADD EMU(Optional)MOD EMU(Optional)Enable
Temperature Alarm ReportingMNG LITemperature alarm
switchEMUTEMP_MASKTEMP_MASKBSC6900NONOMRFD-210304Faulty
ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE,
OPENNoneOPENNoneNoneNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment127ADD EMU(Optional)MOD EMU(Optional)Enable
Humidity Alarm ReportingMNG LIHumidity alarm
switchEMUHUM_MASKHUM_MASKBSC6900NONOMRFD-210304Faulty
ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE,
OPENNoneOPENNoneBoardNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment128ADD EMU(Optional)MOD EMU(Optional)Enable Water
Alarm ReportingMNG LIWater sensor alarm
switchEMUWATER_MASKWATER_MASKBSC6900NONOMRFD-210304Faulty
ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE,
OPENNoneOPENNoneNoneNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment129ADD EMU(Optional)MOD EMU(Optional)Enable Smoke
Alarm ReportingMNG LISmog alarm
switchEMUSMOKE_MASKSMOKE_MASKBSC6900NONOMRFD-210304Faulty
ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE,
OPENNoneOPENNoneNoneNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment130ADD EMU(Optional)MOD EMU(Optional)Infrared
alarm switchMNG LIInfrared alarm
switchEMUINFRA_RED_MASKINFRA_RED_MASKBSC6900NONOMRFD-210304Faulty
ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE,
OPENNoneOPENNoneBoardNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment131ADD EMU(Optional)MOD EMU(Optional)Enable Door
Status Alarm ReportingMNG LIDoor status alarm
switchEMUDOOR_ENGINE_MASKDOOR_ENGINE_MASKBSC6900NONOMRFD-210304Faulty
ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE,
OPENNoneOPENNoneNoneNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment132ADD EMU(Optional)MOD EMU(Optional)Sensor Type
of External Analog 1MNG LISensor type of extended analog signal
1EMUEX_ANO1_TYPEEX_ANO1_TYPEBSC6900NONOMRFD-210301Configuration
ManagementEnumeration TypeVOLTAGE(Voltage),
CURRENT(Current)VOLTAGE, CURRENTNoneCURRENTNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment133ADD
EMU(Optional)MOD EMU(Optional)Sensor Type of External Analog 2MNG
LISensor type of extended analog signal
2EMUEX_ANO2_TYPEEX_ANO2_TYPEBSC6900NONOMRFD-210301Configuration
ManagementEnumeration TypeVOLTAGE(Voltage),
CURRENT(Current)VOLTAGE, CURRENTNoneCURRENTNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment134ADD
EMU(Optional)MOD EMU(Optional)Sensor Type of External Analog 3MNG
LISensor type of extended analog signal
3EMUEX_ANO3_TYPEEX_ANO3_TYPEBSC6900NONOMRFD-210301Configuration
ManagementEnumeration TypeVOLTAGE(Voltage),
CURRENT(Current)VOLTAGE, CURRENTNoneCURRENTNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment135ADD
EMU(Optional)MOD EMU(Optional)Sensor Type of External Analog 4MNG
LISensor type of extended analog signal
4EMUEX_ANO4_TYPEEX_ANO4_TYPEBSC6900NONOMRFD-210301Configuration
ManagementEnumeration TypeVOLTAGE(Voltage),
CURRENT(Current)VOLTAGE, CURRENTNoneCURRENTNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment136ADD
EMU(Optional)MOD EMU(Optional)Upper Limit of Alarm for 48V PowerMNG
LIUpper limit for triggering a 48V voltage sensor
alarmEMUVOL48_THD_HIGHVOL48_THD_HIGHBSC6900NONOMRFD-210304Faulty
ManagementString TypeNone1~9 charactersV57NoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment137ADD
EMU(Optional)MOD EMU(Optional)Lower Limit of Alarm for 48V PowerMNG
LILower limit for triggering a 48V voltage sensor
alarmEMUVOL48_THD_LOWVOL48_THD_LOWBSC6900NONOMRFD-210304Faulty
ManagementString TypeNone1~9 charactersV42NoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment138ADD
EMU(Optional)MOD EMU(Optional)Upper Limit of Alarm for 24V PowerMNG
LIUpper limit for triggering a 24 V voltage sensor
alarmEMUVOL24_THD_HIGHVOL24_THD_HIGHBSC6900NONOMRFD-210304Faulty
ManagementString TypeNone1~9 charactersV28NoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment139ADD
EMU(Optional)MOD EMU(Optional)Lower Limit of Alarm for 24V PowerMNG
LILower limit for triggering a 24 V voltage sensor
alarmEMUVOL24_THD_LOWVOL24_THD_LOWBSC6900NONOMRFD-210304Faulty
ManagementString TypeNone1~9 charactersV20NoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment140ADD
EMU(Optional)MOD EMU(Optional)Upper Limit of Temperature AlarmMNG
LIUpper limit of
temperatureEMUTEMP_THD_HIGHTEMP_THD_HIGHBSC6900NONOMRFD-210304Faulty
ManagementString TypeNone1~9 charactersdegree
Celsius45NoneNoneNoneRead & WriteN (No impact on the UE in idle
mode)Not involvedNot involvedNoneThe parameter modification has no
impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment141ADD EMU(Optional)MOD EMU(Optional)Lower Limit
of Temperature AlarmMNG LILower limit of
temperatureEMUTEMP_THD_LOWTEMP_THD_LOWBSC6900NONOMRFD-210304Faulty
ManagementString TypeNone1~9 charactersdegree
Celsius0NoneNoneNoneRead & WriteN (No impact on the UE in idle
mode)Not involvedNot involvedNoneThe parameter modification has no
impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment142ADD EMU(Optional)MOD EMU(Optional)Upper Limit
of Humidity AlarmMNG LIUpper limit of humidity. When the humidity
exceeds the upper limit, a humidity alarm is
reported.EMUHUM_THD_HIGHHUM_THD_HIGHBSC6900NONOMRFD-210304Faulty
ManagementString TypeNone1~9 charactersper cent80NoneBoardNoneRead
& WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment143ADD
EMU(Optional)MOD EMU(Optional)Lower Limit of Humidity AlarmMNG
LILower limit of humidity. When the humidity is lower than the
lower limit, a humidity alarm is
reported.EMUHUM_THD_LOWHUM_THD_LOWBSC6900NONOMRFD-210304Faulty
ManagementString TypeNone1~9 charactersper cent10NoneBoardNoneRead
& WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment144ADD
EMU(Optional)MOD EMU(Optional)Upper Limit of Signal Output of
External Analog 1MNG LIUpper limit of extended output analog signal
1. If "Sensor Type of External Analog 1" is set to VOLTAGE, the
unit of this parameter is V; if "Sensor Type of External Analog 1"
is set to CURRENT, the unit of this parameter is
A.EMUEX_ANO1_SIG_MAXEX_ANO1_SIG_MAXBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A0.02NoneNoneIf "Sensor
Type of External Analog 1" is set to VOLTAGE, the unit of "Upper
Limit of Signal Output of External Analog 1" is V; if "Sensor Type
of External Analog 1" is set to CURRENT, the unit of "Upper Limit
of Signal Output of External Analog 1" is A.Read & WriteN (No
impact on the UE in idle mode)Not involvedNot involvedNoneThe
parameter modification has no impact on the equipment.NoneVersions
earlier than BSC6900 V900R011Equipment145ADD EMU(Optional)MOD
EMU(Optional)Lower Limit of Signal Output of External Analog 1MNG
LILower limit of extended output analog signal 1. If "Sensor Type
of External Analog 1" is set to VOLTAGE, the unit of this parameter
is V; if "Sensor Type of External Analog 1" is set to CURRENT, the
unit of this parameter is
A.EMUEX_ANO1_SIG_MINEX_ANO1_SIG_MINBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A0.004NoneNoneIf
"Sensor Type of External Analog 1" is set to VOLTAGE, the unit of
"Lower Limit of Signal Output of External Analog 1" is V; if
"Sensor Type of External Analog 1" is set to CURRENT, the unit of
"Lower Limit of Signal Output of External Analog 1" is A.Read &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment146ADD
EMU(Optional)MOD EMU(Optional)Upper Limit of Measurement Range of
External Analog 1MNG LIMaximum measurement range of extended analog
signal 1. If "Sensor Type of External Analog 1" is set to VOLTAGE,
the unit of this parameter is V; if "Sensor Type of External Analog
1" is set to CURRENT, the unit of this parameter is
A.EMUEX_ANO1_VAL_MAXEX_ANO1_VAL_MAXBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A100NoneNoneIf "Sensor
Type of External Analog 1" is set to VOLTAGE, the unit of "Upper
Limit of Measurement Range of External Analog 1" is V; if "Sensor
Type of External Analog 1" is set to CURRENT, the unit of "Upper
Limit of Measurement Range of External Analog 1" is A.Read &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment147ADD
EMU(Optional)MOD EMU(Optional)Lower Limit of Measurement Range of
External Analog 1MNG LIMinimum measurement range of extended analog
signal 1. If "Sensor Type of External Analog 1" is set to VOLTAGE,
the unit of this parameter is V; if "Sensor Type of External Analog
1" is set to CURRENT, the unit of this parameter is
A.EMUEX_ANO1_VAL_MINEX_ANO1_VAL_MINBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A0NoneNoneIf "Sensor
Type of External Analog 1" is set to VOLTAGE, the unit of "Lower
Limit of Measurement Range of External Analog 1" is V; if "Sensor
Type of External Analog 1" is set to CURRENT, the unit of "Lower
Limit of Measurement Range of External Analog 1" is A.Read &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment148ADD
EMU(Optional)MOD EMU(Optional)Upper Limit of Signal Output of
External Analog 2MNG LIUpper limit of extended output analog signal
2. If "Sensor Type of External Analog 2" is set to VOLTAGE, the
unit of this parameter is V; if "Sensor Type of External Analog 2"
is set to CURRENT, the unit of this parameter is
A.EMUEX_ANO2_SIG_MAXEX_ANO2_SIG_MAXBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A0.02NoneNoneIf "Sensor
Type of External Analog 2" is set to VOLTAGE, the unit of "Upper
Limit of Signal Output of External Analog 2" is V; if "Sensor Type
of External Analog 2" is set to CURRENT, the unit of "Upper Limit
of Signal Output of External Analog 2" is A.Read & WriteN (No
impact on the UE in idle mode)Not involvedNot involvedNoneThe
parameter modification has no impact on the equipment.NoneVersions
earlier than BSC6900 V900R011Equipment149ADD EMU(Optional)MOD
EMU(Optional)Lower Limit of Signal Output of External Analog 2MNG
LILower limit of extended output analog signal 2. If "Sensor Type
of External Analog 2" is set to VOLTAGE, the unit of this parameter
is V; if "Sensor Type of External Analog 2" is set to CURRENT, the
unit of this parameter is
A.EMUEX_ANO2_SIG_MINEX_ANO2_SIG_MINBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A0.004NoneNoneIf
"Sensor Type of External Analog 2" is set to VOLTAGE, the unit of
"Lower Limit of Signal Output of External Analog 2" is V; if
"Sensor Type of External Analog 2" is set to CURRENT, the unit of
"Lower Limit of Signal Output of External Analog 2" is A.Read &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment150ADD
EMU(Optional)MOD EMU(Optional)Upper Limit of Measurement Range of
External Analog 2MNG LIMaximum measurement range of extended analog
signal 2. If "Sensor Type of External Analog 2" is set to VOLTAGE,
the unit of this parameter is V; if "Sensor Type of External Analog
2" is set to CURRENT, the unit of this parameter is
A.EMUEX_ANO2_VAL_MAXEX_ANO2_VAL_MAXBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A100NoneNoneIf "Sensor
Type of External Analog 2" is set to VOLTAGE, the unit of "Upper
Limit of Measurement Range of External Analog 2" is V; if "Sensor
Type of External Analog 2" is set to CURRENT, the unit of "Upper
Limit of Measurement Range of External Analog 2" is A.Read &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment151ADD
EMU(Optional)MOD EMU(Optional)Lower Limit of Measurement Range of
External Analog 2MNG LIMinimum measurement range of extended analog
signal 2. If "Sensor Type of External Analog 2" is set to VOLTAGE,
the unit of this parameter is V; if "Sensor Type of External Analog
2" is set to CURRENT, the unit of this parameter is
A.EMUEX_ANO2_VAL_MINEX_ANO2_VAL_MINBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A0NoneNoneIf "Sensor
Type of External Analog 2" is set to VOLTAGE, the unit of "Lower
Limit of Measurement Range of External Analog 2" is V; if "Sensor
Type of External Analog 2" is set to CURRENT, the unit of "Lower
Limit of Measurement Range of External Analog 2" is A.Read &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment152ADD
EMU(Optional)MOD EMU(Optional)Upper Limit of Signal Output of
External Analog 3MNG LIUpper limit of extended output analog signal
3. If "Sensor Type of External Analog 3" is set to VOLTAGE, the
unit of this parameter is V; if "Sensor Type of External Analog 3"
is set to CURRENT, the unit of this parameter is
A.EMUEX_ANO3_SIG_MAXEX_ANO3_SIG_MAXBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A0.02NoneNoneIf "Sensor
Type of External Analog 3" is set to VOLTAGE, the unit of "Upper
Limit of Signal Output of External Analog 3" is V; if "Sensor Type
of External Analog 3" is set to CURRENT, the unit of "Upper Limit
of Signal Output of External Analog 3" is A.Read & WriteN (No
impact on the UE in idle mode)Not involvedNot involvedNoneThe
parameter modification has no impact on the equipment.NoneVersions
earlier than BSC6900 V900R011Equipment153ADD EMU(Optional)MOD
EMU(Optional)Lower Limit of Signal Output of External Analog 3MNG
LILower limit of extended output analog signal 3. If "Sensor Type
of External Analog 3" is set to VOLTAGE, the unit of this parameter
is V; if "Sensor Type of External Analog 3" is set to CURRENT, the
unit of this parameter is
A.EMUEX_ANO3_SIG_MINEX_ANO3_SIG_MINBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A0.004NoneNoneIf
"Sensor Type of External Analog 3" is set to VOLTAGE, the unit of
"Lower Limit of Signal Output of External Analog 3" is V; if
"Sensor Type of External Analog 3" is set to CURRENT, the unit of
"Lower Limit of Signal Output of External Analog 3" is A.Read &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment154ADD
EMU(Optional)MOD EMU(Optional)Upper Limit of Measurement Range of
External Analog 3MNG LIMaximum measurement range of extended analog
signal 3. If "Sensor Type of External Analog 3" is set to VOLTAGE,
the unit of this parameter is V; if "Sensor Type of External Analog
3" is set to CURRENT, the unit of this parameter is
A.EMUEX_ANO3_VAL_MAXEX_ANO3_VAL_MAXBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A100NoneNoneIf "Sensor
Type of External Analog 3" is set to VOLTAGE, the unit of "Upper
Limit of Measurement Range of External Analog 3" is V; if "Sensor
Type of External Analog 3" is set to CURRENT, the unit of "Upper
Limit of Measurement Range of External Analog 3" is A.Read &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment155ADD
EMU(Optional)MOD EMU(Optional)Lower Limit of Measurement Range of
External Analog 3MNG LIMinimum measurement range of extended analog
signal 3. If "Sensor Type of External Analog 3" is set to VOLTAGE,
the unit of this parameter is V; if "Sensor Type of External Analog
3" is set to CURRENT, the unit of this parameter is
A.EMUEX_ANO3_VAL_MINEX_ANO3_VAL_MINBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A0NoneNoneIf "Sensor
Type of External Analog 3" is set to VOLTAGE, the unit of "Lower
Limit of Measurement Range of External Analog 3" is V; if "Sensor
Type of External Analog 3" is set to CURRENT, the unit of "Lower
Limit of Measurement Range of External Analog 3" is A.Read &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment156ADD
EMU(Optional)MOD EMU(Optional)Upper Limit of Signal Output of
External Analog 4MNG LIUpper limit of extended output analog signal
4. If "Sensor Type of External Analog 4" is set to VOLTAGE, the
unit of this parameter is V; if "Sensor Type of External Analog 4"
is set to CURRENT, the unit of this parameter is
A.EMUEX_ANO4_SIG_MAXEX_ANO4_SIG_MAXBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A0.02NoneNoneIf "Sensor
Type of External Analog 4" is set to VOLTAGE, the unit of "Upper
Limit of Signal Output of External Analog 4" is V; if "Sensor Type
of External Analog 4" is set to CURRENT, the unit of "Upper Limit
of Signal Output of External Analog 4" is A.Read & WriteN (No
impact on the UE in idle mode)Not involvedNot involvedNoneThe
parameter modification has no impact on the equipment.NoneVersions
earlier than BSC6900 V900R011Equipment157ADD EMU(Optional)MOD
EMU(Optional)Lower Limit of Signal Output of External Analog 4MNG
LILower limit of extended output analog signal 4. If "Sensor Type
of External Analog 4" is set to VOLTAGE, the unit of this parameter
is V; if "Sensor Type of External Analog 4" is set to CURRENT, the
unit of this parameter is
A.EMUEX_ANO4_SIG_MINEX_ANO4_SIG_MINBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A0.004NoneNoneIf
"Sensor Type of External Analog 4" is set to VOLTAGE, the unit of
"Lower Limit of Signal Output of External Analog 4" is V; if
"Sensor Type of External Analog 4" is set to CURRENT, the unit of
"Lower Limit of Signal Output of External Analog 4" is A.Read &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment158ADD
EMU(Optional)MOD EMU(Optional)Upper Limit of Measurement Range of
External Analog 4MNG LIMaximum measurement range of extended analog
signal 4. If "Sensor Type of External Analog 4" is set to VOLTAGE,
the unit of this parameter is V; if "Sensor Type of External Analog
4" is set to CURRENT, the unit of this parameter is
A.EMUEX_ANO4_VAL_MAXEX_ANO4_VAL_MAXBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A100NoneNoneIf "Sensor
Type of External Analog 4" is set to VOLTAGE, the unit of "Upper
Limit of Measurement Range of External Analog 4" is V; if "Sensor
Type of External Analog 4" is set to CURRENT, the unit of "Upper
Limit of Measurement Range of External Analog 4" is A.Read &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment159ADD
EMU(Optional)MOD EMU(Optional)Lower Limit of Measurement Range of
External Analog 4MNG LIMinimum measurement range of extended analog
signal 4. If "Sensor Type of External Analog 4" is set to VOLTAGE,
the unit of this parameter is V; if "Sensor Type of External Analog
4" is set to CURRENT, the unit of this parameter is
A.EMUEX_ANO4_VAL_MINEX_ANO4_VAL_MINBSC6900NONOMRFD-210301Configuration
ManagementString TypeNone1~9 charactersV or A0NoneNoneIf "Sensor
Type of External Analog 4" is set to VOLTAGE, the unit of "Lower
Limit of Measurement Range of External Analog 4" is V; if "Sensor
Type of External Analog 4" is set to CURRENT, the unit of "Lower
Limit of Measurement Range of External Analog 4" is A.Read &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment160ADD
EMU(Optional)MOD EMU(Optional)Switch for Relay 1MNG LIRelay switch
1EMUPOWER_RELAY1POWER_RELAY1BSC6900NONOMRFD-210301Configuration
ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE,
OPENNoneCLOSENoneNoneNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment161ADD EMU(Optional)MOD EMU(Optional)Switch for
Relay 2MNG LIRelay switch
2EMUPOWER_RELAY2POWER_RELAY2BSC6900NONOMRFD-210301Configuration
ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE,
OPENNoneCLOSENoneNoneNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment162ADD EMU(Optional)MOD EMU(Optional)Switch for
Relay 3MNG LIRelay switch
3EMUPOWER_RELAY3POWER_RELAY3BSC6900NONOMRFD-210301Configuration
ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE,
OPENNoneCLOSENoneNoneNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment163ADD EMU(Optional)MOD EMU(Optional)Switch for
Relay 4MNG LIRelay switch
4EMUPOWER_RELAY4POWER_RELAY4BSC6900NONOMRFD-210301Configuration
ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE,
OPENNoneCLOSENoneNoneNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment164ADD EMU(Optional)MOD EMU(Optional)Switch for
Relay 5MNG LIRelay switch
5EMUPOWER_RELAY5POWER_RELAY5BSC6900NONOMRFD-210301Configuration
ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE,
OPENNoneCLOSENoneNoneNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment165ADD EMU(Optional)MOD EMU(Optional)Switch for
Relay 6MNG LIRelay switch
6EMUPOWER_RELAY6POWER_RELAY6BSC6900NONOMRFD-210301Configuration
ManagementEnumeration TypeCLOSE(Close), OPEN(Open)CLOSE,
OPENNoneCLOSENoneNoneNoneRead & WriteN (No impact on the UE in
idle mode)Not involvedNot involvedNoneThe parameter modification
has no impact on the equipment.NoneVersions earlier than BSC6900
V900R011Equipment166ADD ETHIP(Mandatory)Subnet maskMNG LISubnet
mask of the boardETHIPMASKMASKBSC6900NOYESNoneNoneIP Address
TypeNone0.0.0.0~255.255.255.255NoneNoneNoneBSC6900NoneRead &
WriteNot involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport167ADD ETHIP(Mandatory)MOD ETHIP(Mandatory)RMV
ETHIP(Mandatory)Subrack No.MNG LINumber of the
subrackETHIPSRNSRNBSC6900YESYESMRFD-210301Configuration
ManagementInterval Type0~110~11NoneNoneNoneNoneNoneRead &
WriteN (No impact on the UE in idle mode)Not involvedNot
involvedNoneThe parameter modification has no impact on the
equipment.NoneVersions earlier than BSC6900 V900R011Equipment168ADD
ETHIP(Mandatory)MOD ETHIP(Mandatory)RMV ETHIP(Mandatory)Slot No.MNG
LIIndicates the slot number for running this
commandETHIPSNSNBSC6900YESYESNoneNoneInterval Type0~5,8~270~5,
8~27NoneNoneNoneBSC6900NoneRead & WriteNot involvedNot
involvedNot involvedThe parameter cannot be modified.Not
involvedNoneVersions earlier than BSC6900 V900R011Equipment169ADD
ETHIP(Mandatory)MOD ETHIP(Mandatory)RMV ETHIP(Mandatory)Port No.MNG
LIEthernet portETHIPPNPNBSC6900YESYESNoneNoneInterval
Type0~110~7(FG2a), 0~1(GOUa), 0~11(FG2c),
0~3(GOUc)NoneNoneNoneEthernet portIf port 0 or port 4 of the FG2a
board is set to the GE port, the port number can only be 0 or 4.
Otherwise, the port number ranges from 0 to 7. If only port 0 is
set to the GE port, ports 1-3 are unavailable. If port 4 is set to
the GE port, ports 5-7 are unavailable.Read & WriteNot
involvedNot involvedNot involvedThe parameter cannot be
modified.Not involvedNoneVersions earlier than BSC6900
V900R011Transport170ADD ETHIP(Mandatory