Top Banner
Causes and Effects in The Revival of the Religious Sciences Page 1 of 29 PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014. All Rights Reserved. Under the terms of the licence agreement, an individual user may print out a PDF of a single chapter of a monograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy ). Subscriber: University of Chicago; date: 13 March 2014 University Press Scholarship Online Oxford Scholarship Online Al-Ghazali's Philosophical Theology Frank Griffel Print publication date: 2009 Print ISBN-13: 9780195331622 Published to Oxford Scholarship Online: September 2009 DOI: 10.1093/acprof:oso/9780195331622.001.0001 Causes and Effects in The Revival of the Religious Sciences Frank Griffel (Contributor Webpage) DOI:10.1093/acprof:oso/9780195331622.003.0009 Abstract and Keywords In Revival of the Religious Sciences (Ihya’ ‘ulum al-din), a work that was written after the Incoherence (Tahafut), causes and effects play a very important role. Every event in this world is considered caused by another and is also the cause of other events in the future. Yet all these events are “caused” only by the first element of the long causal chains that they are elements of, and that is God. God is the only cause in the universe, and when we talk of his creatures as causes, we do so only by metaphor. Everybody must understand that the usage of “cause” for an object of this world is purely metaphorical. At the same time, we must acknowledge that these causes represent God’s will. This is also true for human actions. The human is only the “vessel” (mahall) of God’s actions. Human actions are triggered by our volition which itself is triggered by our motives. The motives depend on the knowledge that we have and the knowledge of a human goes back to his or her experience and the effects of the active intellect in the heavens. God determines our actions by means of this causal chain. Equally, reward and
29

Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Apr 23, 2018

Download

Documents

truongque
Welcome message from author
This document is posted to help you gain knowledge. Please leave a comment to let me know what you think about it! Share it to your friends and learn new things together.
Transcript
Page 1: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 1 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

UniversityPressScholarshipOnline

OxfordScholarshipOnline

Al-Ghazali'sPhilosophicalTheologyFrankGriffel

Printpublicationdate:2009PrintISBN-13:9780195331622PublishedtoOxfordScholarshipOnline:September2009DOI:10.1093/acprof:oso/9780195331622.001.0001

CausesandEffectsinTheRevivaloftheReligiousSciences

FrankGriffel(ContributorWebpage)

DOI:10.1093/acprof:oso/9780195331622.003.0009

AbstractandKeywords

InRevivaloftheReligiousSciences(Ihya’‘ulumal-din),aworkthatwaswrittenaftertheIncoherence(Tahafut),causesandeffectsplayaveryimportantrole.Everyeventinthisworldisconsideredcausedbyanotherandisalsothecauseofothereventsinthefuture.Yetalltheseeventsare“caused”onlybythefirstelementofthelongcausalchainsthattheyareelementsof,andthatisGod.Godistheonlycauseintheuniverse,andwhenwetalkofhiscreaturesascauses,wedosoonlybymetaphor.Everybodymustunderstandthattheusageof“cause”foranobjectofthisworldispurelymetaphorical.Atthesametime,wemustacknowledgethatthesecausesrepresentGod’swill.Thisisalsotrueforhumanactions.Thehumanisonlythe“vessel”(mahall)ofGod’sactions.Humanactionsaretriggeredbyourvolitionwhichitselfistriggeredbyourmotives.Themotivesdependontheknowledgethatwehaveandtheknowledgeofahumangoesbacktohisorherexperienceandtheeffectsoftheactiveintellectintheheavens.Goddeterminesouractionsbymeansofthiscausalchain.Equally,rewardand

Page 2: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 2 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

punishmentinthisworldandintheafterlifearethecausaleffectsofouractions.Godhasdeterminedthecausallawshowactionsinthisworldarerewardedorpunishedinthenext.AlltheseideasabouthumanactionsareverysimilartothatofAvicennaandshowaverystronginfluenceofphilosophicaltheoriesonhumanactions.LikeAvicenna,al-GhazaliheldthatthisisafullydetermineduniverseinwhichGodcontrolsanddeterminesallevents.

Keywords:humanaction,kasb,determination,inquiringwayfarer,al-salikal-sa’il,tawhid,possibleworlds,bestworld

ThevoluminousRevivaloftheReligiousScience(Iḥyāʾʿulūmal-dīn)isal-Ghazālī’smajorworkonethicalconductintheeverydaylifeofMuslims.Itisdividedintofoursections,eachcontainingtenbooks.Withtheexceptionofthefirsttwobooks,thefirstsectiondiscussesritualpractices(‘ibādāt),thesecond,socialcustoms(‘ādāt),thethird,thosethingsthatleadtoperdition(muhlikāt)andshouldthusbeavoided,andthefourth,thosethatleadtosalvation(munjiyāt)andshouldbesought.InthefortybooksoftheRevival,al-Ghazālīseverelycriticizesthecovetingofworldlymatters,remindinghisreadersthathumanlifeisapathtowardJudgmentDayanditscorrespondingrewardorpunishment.InthefirstbookofhisRevival,al-Ghazālīsaysthatonecannotexpecttoachieveredemptionintheafterlifewithoutafirmknowledgeofthisworld’scausesandeffects.1Throughoutthisbook,however,heshowsnointerestinclarifyingtheontologicalcharacteroftheconnectionbetweenwhatwecallacauseanditseffects.Intheintroduction,hesaysthathewishestoavoiddiscussionsthathavenoconsequencesintermsofhumanactions.2ThisfocusonthepracticalresultsofhumanknowledgeleadstoanattitudeinwhichitsufficestounderstandthatGodistheefficientcauseofallevents,regardlessofwhetherHecausesthemdirectlyorthroughthemediationofsecondarycauses.NowhereinhisRevivaldoesal-GhazālīevensomuchashintthattherearetwocompetingexplanationsforGod’screativeactivity.Sinceinthisbook,hewishestogiveclearanddetailedguidancetohisreadersonhowtoearnaplaceintheafterlife,thereisnotreatmentofcosmology.Consequently,causalconnectionsappearintheRevivalwithoutanyscrutiny,justdiscussedaccordingtohowtheyshouldbetreatedinallpracticalcontexts:asnecessaryconnections.

(p.216) Al-Ghazālīgenerallyseesitasself-evidentthatthecausesthatwewitnessinourdailyaffairsarethemselvesonlytheeffectsofothercauses.Thisistrueforallcausalconnectionsandthusalsotrueforhumanactions.Al-Ghazālī’sstanceonhumanactionsisverysimple:likeallothereventsinthisworld,theyareGod’screation.Thisistruenotonlyofthehumanactitself,butalsoofallcausesthathaveledtoit.Ahumanactispromptedbythehumanvolition(irāda),whichisitselfdeterminedbyoneormoremotives.3Godcreatesthesemotivesaswellasthevolition.Thehumanmotiveisajudgmentthatisprecededanddeterminedbytwoelements:thehuman’sknowledgeandhisorherdesire.4Al-Ghazālīdiscussestheexampleofamanwalkingonthestreetwhorealizesthatawomaniswalkingbehindhim;hewishestoseethewomenanddecidesthattoseeher,hemustturnaround.Themotivetoturnaroundistriggeredbytheknowledgethatthewomanisthereandthedesiretoseeher.Thismotivemay,however,beopposedbyacountermotive(ṣārif),andthusitmaynotleadtothevolition—andthus

Page 3: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 3 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

alsonotleadtotheaction—ofturningthehead.5Humansarenotheldresponsiblefortheirmotives,becausethemotivesdependbothonthehuman’sknowledgeandonhisorherdesires,twothingsgiventothem.Humansareresponsiblefortheirvolition,however,andthusresponsibleforthosemotivesthattheychoose.6Inhislaterwork,TheChoiceEssentials(al-Mustaṣfā),al-Ghazālīclarifiesthatreason(ʿaql)cannotbeconsideredamotive(dāʿin).Loveofoneselfandfearofpainaremotivesforhumanactions,andthesemotivesare“dispatched”(tanbaʿithu)bythesoul(nafs).Reasoncanonlybeaguide(hādin)thatshowshowbesttorealizethesemotives,whichthemselvescanvaryinstrength.7Theexistenceofdifferentmotivesleadstodeliberation(fikr)onthesideofthehumanandmayalsoleadtohesitation(taraddud).Al-Ghazālītreatsthehumanvolitionasacausaleffectofthemotive,withthemotiveasacausaleffectofthehuman’sknowledgecombinedwithhisorherdesires.ThefactthatGodcreatesallelementsinthiscausalchain—thehumanknowledge,thedesire,themotive,thevolition,andthehumanaction—stilldoesnotdiminishanyofthehuman’sresponsibilityforhisorheractions.

TheCreationofHumanActsAl-GhazālīexplainshisviewofhumanactionsafewtimesinhisRevival,albeitnevergivingthetopicthesystematictreatmentthatwouldanswerallthequestionsonthissubjectusuallydiscussedbyAshʿarites.Hismostilluminatingpassagescanbefoundinbooksthirty-one,thirty-two,andthirty-fiveoftheRevival.Thethirty-fifthbookcontainsaparticularlyclearpassageonhowtounderstanddivineunity(tawḥīd).8EarlierAshʿaritetheologianshaddifferentiatedbetweenvoluntaryandinvoluntaryhumanactions.Whensomeonehasatremor,forinstance,hehasnocontrolovercertainofhisactionsandcannotbemaderesponsibleforthem.Thetremorisaninvoluntaryact,acreationofGod,similartootheraspectsoftheoutsideworldthatinvolvenohumanvolition.Thehumanmustperformsuchactions,justasatreeiscompelledtomoveitsbranchesinthewind.

(p.217) AlthoughvoluntaryactionsarealsoGod’screations,astheAshʿaritesstress,theydifferinkeywaysfrominvoluntaryones.Withvoluntaryactions,humansmakeadecisionintheirwill,andtheyareindividuallyresponsiblefortheirchoices.EarlierAshʿaritesexpressthedoublenatureofsuchactionsbysayingthathumansacquiretheseactionswhileGodcreatesthem.Thelinguistictermsthathumans“acquire”or“appropriate”(kasabaoriktisaba)theiractionshavetheirrootsinthelanguageoftheQur’an(Q2:81,2:134,5:38)andprecedeal-Ashʿarī.Theearliestunderstandingoftheseideasmaysimplyhavestressedtheideathathumansareresponsibleforallthattheyperform,regardlessofthecosmologicalexplanationforhowtheseactionsarecreated.9Withal-Ashʿarīandhisfollowers,theunderstandingof“acquisition”becomesmorecomplex.MostoftheAshʿaritetheoriesofhumanactionthatprecedeal-GhazālīassumethatGodgivesa“temporarypower-to-act”(qudramuḥdatha)tothehumanthatallowshimorhertoperformtheactthatheorshehaschosen.ThisimpliesthatalthoughGodcreatestheactionanditsresultsintheoutsideworld,thehumanisregardedastheagent(fāʿil)andthemakeroftheact.10

InhistextbookofAshʿaritetheology,al-Ghazālīupholdsthedoctrinethathumanshavepower(theyareqādir)overtheiractions,orelsetheobligationsofthereligiouslaw

Page 4: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 4 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

wouldbemeaningless.11However,thetraditionalimplicationthathumansaretheagentsoftheiractionsisincompatiblewithal-Ghazālī’scosmologyinwhichthereisonlyoneagentorefficientcause(fāʿil).UnderstandingGod’struenature(tawḥīd)includestherealizationthatthereisnoagentorefficientcause(fāʿil)otherthanGodandthatHeistheonewhocreatesallexistence,sustenance,life,death,wealth,poverty,andallotherthingsthatcanhaveaname.12TheonlytrueagentinthisworldisGod.13Inthethirty-fifthbookofhisRevival,al-Ghazālīimplicitlydismissesthedistinctionbetweenvoluntaryandinvoluntaryactions.Openingandclosingone’seyelids,forinstance,isusuallyconsideredavoluntaryaction.Butonceasharpneedleapproachesthehuman’seye,thehumaniscompelledtoclosehiseyelids:

Evenifhewantedtoleavehiseyelidsopenhecouldn’t,despitethefactthatthecompelledclosingoftheeyelidsisavoluntaryact.Once,however,thepictureoftheneedleisperceivedinhissenseperception,thevolitiontoclose[theeyelids]appearsnecessarilyandthemovementofclosingoccurs.14

Thevoluntaryclosingoftheeyelidsiscompelledbyavolition(irāda),whichitselfiscompelledbyperceivingtheneedleapproachingtheeye.Thisisacausalchaininwhichthehumanknowledgecausesthevolitiontodevelopinacertainway,andthisvolitioncausesthepower-to-act(qudra),whichcausestheaction.InclassicalAshʿarism,thetemporarilycreatedpower-to-actdistinguishesavoluntaryhumanactfromaninvoluntaryone.Hereinal-Ghazālī’sthought,thepower-to-actisamerehumanfaculty,15neithersingledoutfromamongthebasicfacultiesofhumanlifenorcreatedinanywaydifferentfromothersofGod’screation.Thepower-to-actissimplyonelinkinachainofsecondarycauses:“Thevolition(irāda)followstheknowledge,whichjudgesthatathingispleasing(or:agreeable,muwāfiq)toyou.”16Thecausalchainof(p.218)knowledge,volition,power-to-act,andactionappliestoallvoluntaryhumanactions.Involuntaryactionshaveadifferentcausalchain,whichdoesnotincludethehumanpower-to-act,volition,andknowledge.Bothtypesofactions,however,aretheresultofcompulsion(iḍṭirār).

Inmostvoluntaryactions,thereactionofthehumanvolitionisnotasimmediateasinthecaseoftheneedleapproachingtheeye.Aparticularsubclassofvoluntaryactionsincludesthoseactionsthatinvolveahumanchoice(ikhtiyār).Ourpreviousexampleoftheactionofclosingone’seyewhenaneedleapproachesisconsideredavoluntaryactionbutdoesnotinvolveachoice.Thepersonwhoseeyeisapproachedbyaneedlecannotchooseanactionthatisalternativetoclosingtheeyelid.Thehumanwilliscompelledtoclosetheeye.Humanchoice(ikhtiyār)meanstobeabletochoosebetweenalternatives.Thoseactionsthatinvolvechoice,however,donotdifferfundamentallyfromthoseperformedwithoutit.Foral-Ghazālī,choice(ikhtiyār)meansthehumancapacityofselectingwhatappearsmostagreeableormostbeneficial(khayr)tous.Oftenthevolitionhesitates,andtheintellect(ʿaql)findsithardtodecidewhethersomethingisagreeableornot.Insuchacase,wedeliberateuntilwedecidewhichactionsappearstobenefitusmost.Oncetheprocessofdeliberationleadstoaclearknowledgeaboutwhatpromisestobebestforus,knowledge“arouses”(or:“dispatches,”inbaʿatha)thevolitionandthus

Page 5: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 5 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

initiatesthepartofthecausalchainthatleadstoaction.Thejudgmentoftheintellectfollowswhatappearsbesttoit,andinthissense,thehumanactionisdeterminedbywhattheintellectjudgesasbest.Thisjudgmentofteninvolvessenseperception(ḥiss)andourinnersenseofimagination(takhyīl).Allconnectionsinthecausalchainbetweensenseperceptionandhumanactionareconsiderednecessary:

Themotiveofthevolition(dāʿiyatal-irāda)issubservienttothejudgmentoftheintellectandthejudgmentofsenseperception;thepower-to-actissubservienttothemotive,andthemovement[ofthelimb]issubservienttothepower-to-act.Allthisproceedsfromhim[scil.thehuman]byanecessitywithinhim(bi-l-ḍarūrafīhi)withouthimknowingit.Heisonlytheplaceandthechannelforthesethings.Asforthemcomingfromhim?Noandonceagainno!17

Giventhenecessarypredeterminedcharacterofallhumanactions,onemightthinkthathumansareforced(majbūr)todotheactionstheyperform.Yetthatisnotthecase,al-Ghazālīstresses,astheystillhaveachoiceabouthowtoact.Hereheimplicitlyusesal-Fārābī’sdistinctionbetweentwotypesofnecessity.InTheBalancedBook,al-GhazālīaddressesthequestionofwhethersomethingthatisnotcontainedinGod’sforeknowledgecanbecreated.18Viewedbyitself(yunẓaruilādhātihi),everyfuturecontingencyisapossibleevent.Whattheeternaldivinewilldetermines,however,iswhatisnecessary,anditsalternativeswillnothappen.Apossiblefutureeventthatisnotcontainedinthedivineforeknowledgewillneverbeactualized.Suchaneventisconsidered“possiblewithregardtoitself”(mumkinbi-ʿtibārdhātihi)yetatthesametime“impossiblewithregardtosomethingelse”(muḥālbi-ʿtibārghayrihi).19Itisrenderedimpossiblebythedivinewillandforeknowledge.When(p.219) thehumandecideshisaction—andherewereturntothepassageinthethirty-fifthbookoftheRevival—hedecidesbetweenvariousalternativesthatarepossiblewithregardtothemselves.Heisunawarethatallthealternativesthathewilleventuallyrejecthavealreadybeenrenderedimpossiblebythedivinewillandforeknowledge.Sincethedivineforeknowledgecontainsallfactorsthatcausesuchdecisions,itknowswhatappearsmostagreeabletothehumanintellectandthusknowswhichpossibleactionwillbeactualized.

Thehumanisafreeagent(mukhtār)inthesensethatheorsheistheplace(orsubstrate,maḥall)ofthefreechoice(ikhityār).Freechoicemeansthathumanschoosewhatappearsmostbeneficial(khayr)forthem;allhumanactionsaremotivatedbyself-interest.20Indeed,thehumanisforcedbyGodtodecidehisorherownactionsthatarecongruentwithhisorherself-interest.RespondingtooneoftheoldestdisputesofMuslimtheology,al-Ghazālīsaysthatonecansaythathumanslackagencyinthesensethattheyareforcedtomakeachoice(majbūrʿalāl-ikhtiyār).Whereascausalconnectionsintheoutsideworldsuchastheonebetweenfireandcottonarepurecompulsion(jabrmaḥḍ),andtheactionsofGodarepurefreechoice(ikhtiyārmaḥḍ),theactionsofthehumanlieinbetweenthesetwoextremes.Thisiswhyearlierscholarsdecidedtonamethisthirdcategoryneitherfreechoicenorcompulsion.Followingtheterminologyofrevelation,al-Ghazālīsays,theycametocallit“acquisition”(kasb).Thiswordisopposedneithertocompulsionnortofreechoicebut“rather,forthosewhounderstand,itbrings

Page 6: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 6 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

thesetwotogether.”21Al-Ghazālī’snovelinterpretationofthisterm“acquisition”thusdepartsfromearlierAshʿariteteaching.22

Al-Ghazālī’steachingsonhowhumanactsaregeneratedarequitereminiscentofthefalāsifa’steachingsingeneralandofAvicenna’steachingsinparticular.23Avicennadescribeshumanactionastriggeredbyavolition,andthisvolitionis“dispatched”(mubʿatha)eitherbyaconviction(iʿtiqād)thatfollowsfrom“anappetitiveorirascibleimaginativeact”orbyarationalopinionthatfollowsfromanactofcognitivethinkingorfromtheconveyingofanintellectualform.24Theseformscomefromtheactiveintellect.WhateverhappenswithinthehumanmindisjustasegmentinalargercausalchainthatbeginswithGod,passesthroughtheheavenlyrealm,passesthroughthehumanmind,andmanifestsitselfinthematerialworldoutsideourminds.Inthethirty-fifthbookoftheRevival,al-Ghazālīincludesaratherlongparableofan“inquiringwayfarer”(al-sālikal-sāʾil)whoinvestigatesthecauseofacertainwrittentext—awritofamnestygrantedbyaking—andfollowsitscausalchainfromthepaperandtheink,viathehuman,totheheavenlyrealmuntilhereachesGod.Inthisparable,thecausesandeffectsinthematerialworldarecalledthe“worldofdominion”(ʿālamal-mulk),thepartofthechainthathappensinthehumanmindiscalledthe“worldofcompulsion”(ʿālamal-jabarūt),andthepartofthecausalchainthatliesbeyondthehumanintheheavenlyrealmiscalledthe“worldofsovereignty”(ʿālamal-malakūt).25

Al-Ghazālī’stheoryofhumanactsisanoriginalcontributiontoacenturies-olddebateinMuslimtheologyofhowtoreconcileGod’somnipotencewithHisjustice.IfGodcreateshumanactions—bymeansofwhatappearstousas(p.220) causaldetermination—howcanHejudgehumanactionsandbaserewardandpunishmentonthatjudgment?Again,theanswerliesinasimplecausalchain.Inthethirty-secondbookoftheRevival,al-GhazālīshowsdivinerevelationtobeoneofthecausesthatGodemploystoleadhisservantstosalvation.Thepassagestartswhenaninterlocutoraskswhyhumansshouldeverbotherwithindependentactionifallispredetermined,includingtheirfateintheafterlife.Ifeverythingispredeterminedonemightwellrefrainfromdoinganythingandrestinfatalisticinactivity.Al-Ghazālī’sanswerfocusesonstatementsofrevelation,fortheQur’anandtheḥadīthcorpusurgehumanstoact.Bothtextscontaintheimperative“act!”26Thisformulationimpliesthatonewillbepunishedandcensuredforbeingdisobedientunlessoneacts.Theimperativelanguagetriggersacertainconvictioninus,withdivinewordscausing(sabab)ourknowledgethatGodwantsustoact.Thisknowledgeisthecauseofadecisivemotive(dāʿiyajāzima)thatpropelsthosewhobelieveinrevelationtoactandbeobedienttoGod.27Themotiveisthecauseforthevolitionthattriggersthemovementofthelimbs.Thus,divinerevelationbecomesacauseofgooddeedsinahuman.Al-Ghazālīexplainshowrevelationcausestheconviction(iʿtiqād)thatoneispunishedforbaddeedsandhowthatconvictioncausessalvationintheafterlife:

(…)andtheconviction[thatsomehumanswillbepunished]isacauseforthesettinginoffear,andthesettingoffearisacauseforabandoningthepassionsandretreatingfromtheabodeofdelusions.Thisisacauseforarrivingatthevicinityof

Page 7: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 7 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

God,andGodistheonewhocausesthecauses(musabbibal-asbāb)andwhoarrangesthem(murattibuhā).Thesecauseshavebeenmadeeasyforhim,whohasbeenpredestinedineternitytoearnredemption,sothatthroughtheirchaining-togetherthecauseswillleadhimtoparadise.28

God’srevelationisthecauseofthehuman’sfearofpunishmentintheafterlife.Thisfear,inturn,causesthehumantoheedthewordsoftheprophets,whichleadstogoodactionsinthisworldthatthencausesthebeliever’sredemptionintheafterlife.29Thischainisafurtherdevelopmentofal-Juwaynī’snotionthatGodmakesahumanintelligentandremovesobstacles“tomakeGod’spatheasyforhim.”30

Onegenerationafteral-Ghazālī,hisfollowerIbnTūmartillustrateshowGodcauseshumanstobecomebelievers.Hetracesthehuman’sdecisiontobecomeabelieverinGodthroughachainofcausesandeffectstoGod’spropheticalmiracle.InhisCreedoftheCreator’sDivineUnity(tawḥīdal-Bārī),IbnTūmartwritesthataMuslim’sbelief(īmān)andpiety(ikhlās.)isaccompaniedbytheknowledge(ʿilm)ofGod’sexistenceandHisattributes.Thebeliever’sknowledgeresultsfromhissearch(ṭalab)forit.Thissearchforknowledgeistriggeredbyavolition(irāda),andthevolitionistheeffectofdesireandfear.Desireandfeararepromptedbywhatrevelationpromisesregardingrewardandpunishmentintheafterlife(al-waʿdwa-l-waʿīdbi-l-sharʿ).Revelation,inturn,takesitsauthorityfromthetrustworthinessofthe(p.221) Prophet(ṣidqal-rasūl),andtheProphet’strustworthinessisestablishedbythepropheticmiracle(al-muʿjiza).Attheend,thischainofeventsexplaininghumanbeliefarrivesatGodbecause“theevidenceofthemiracleisbyGod’spermission(idhnAllah).”31

IbnTūmart’snarrativemaynotconcurinallitsdetailswithal-Ghazālī’sideaofwhatcauseshumanstopursueadevoutandreligiouslifestyle.32Yetthetwoagreethattheprocesscanbedescribedbyachainofsecondarycauses,onestartedandwhollycontrolledbyGod.Inthethirty-secondbookoftheRevival,al-Ghazālīmakeshisliteraryinterlocutorsummarizehisownperspectiveonhowhumanactionsarethecausesoftheirownredemption:

Youmightsay:Thegistofthis[scil.al-Ghazālī’s]talkistosaythatGodhasputapurpose(ḥikma)intoeverything.Hemadesomehumanactscauses(asbāb)forthefulfillmentofthispurposeandforitsattainingtheobjectivethatisintendedinthecauses.God(also)madesomehumanactionsobstaclestothefulfillmentofthepurpose.33

Inallofhisworks,al-GhazālīpromotestheperspectivethatGod’screationisaperfectconglomerationofcausesandeffects,withonecreationharmoniouslydovetailingwiththenext.InsuchworksashisRevivaloftheReligiousScienceorinthelesswell-knownIntellectualInsights(al-Maʿārifal-ʿaqliyya),wherethecompleteharmonyofGod’screationiselaboratedinfinedetail,hedoesnotdiscussthecosmologicalnatureofcausalconnection.34Intheseworks,itsufficesforal-Ghazālītosaythat“inactualtermsthereisonlyoneefficientcause(fāʿil)andHeistheonewhoisfeared,whoistheobjectofhope,inwhomonehastrust,anduponwhomonerelies.”35InanadaptationofQ85:16,he

Page 8: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 8 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

saysthatGodistheproducer(ortheactiveagent,faʿʿāl)ofeverythingthatHewillstocreate.36Godis“thecauserofthecauses”or,asRichardM.Franktranslates,“theonewhomakesthecausesfunctionascauses”(musabbibal-asbāb).37AlthoughthistermisconsideredofAvicennanorigin,theexpressionoriginallyusedbyAvicennawasmostprobably“causeofcauses”(sababal-asbāb).38Theexpression“theonewhomakesthecausesfunctionascauses”(musabbibal-asbāb)hasaSufibackgroundandhadalreadybeenused,forinstance,byAbūṬālibal-MakkīinhisNourishmentoftheHearts(Qūtal-qulūb).39“Causeofcauses”expressestheAvicennanpositionthatGodisthestartingpointofallchainsofsecondarycausesandthattherelationshipbetweensuchchains’elementsisthatofefficientcausestotheireffect.IncontrasttowhatwaslikelytheAvicennanformula,al-Ghazālī’stermavoidscommittingtoanexplanationofhowthe“causes”comeabout.Inal-Ghazālī’sRevival,Godisdescribedastheonewho“carriesoutHiscustomandbindstheeffectstocausesinordertomakeHiswisdomapparent.”40Allotherexistencesarefullysubservientoperators(musakhkharūn)ofHimandlackindependenceeventomoveaspeckofdust.41Usingtheseformulas,al-GhazālīwishestoleaveopenwhetherGod’sarrangementof“causes”happensbymeansofsecondarycausalchainsorbycreatingexistencesindependently,sidebyside.

(p.222) TheConditionalDependenceofGod’sActionsAl-GhazālīpostulatesthatGodcreatedtheuniversesuchthatwhatwecallaneffectalwaysexistsalongsidewithwhatwecallitscause.Godwillalwayscreatecombustioninacottonballwhenitistouchedbyfire.IntheIncoherence,al-Ghazālīarguesthattheconnectionbetweencauseandeffectisnotnecessaryandcouldhavebeenconstructeddifferently.IntheRevival,theseconnectionsaredescribedastheresultofGod’svoluntaryactions.Al-GhazālīpositsthatGod’swill,whichexistsfrometernity,includesthevoluntarydecisionalwaystocombustacottonballifacertainotherevent—inthiscase,aclosecontactwithfire—precedesit.InHiseternity,GodfreelydecidestolimitHiscreativeactivitysuchthathumansjustifiablyconcludethattheconnectionbetweenfireandcombustionisaninseparable—andinthismeaning:necessary—causalconnection.

Inthethirty-secondbookoftheRevival,al-GhazālīdiscussestheconceptthathumansmustbethankfultoGod.Al-GhazālīopensthepassagewithaquestionofacriticalinterlocutorwhoinjectsthatsinceGodisthecreatorofeverything,itisnotplausiblethathumansshouldbegratefultoHim.GoddoesnotgiveanythinginparticulartoHiscreaturesforwhichtheyshouldbethankful.Indeed,Godisthecreatorofallhumanactionsanddecisions—includingthedecisiontobegratefultoGod.Aftertheusuallamentationthatthisproblembelongstothe“mysteryofpredestination,”whichhecannotsharewithhisreaders,al-Ghazālīexplains:theaction,whichGodcreateswithinthehuman,isthegiftforwhichoneshouldbegrateful.IfthatactionispleasingtoGod,itwillleadtorewardintheafterlife:“YouractionisagiftfromGodandinasmuchasyouareitsplace(or:substrate,maḥall),Hewillpraiseyou.”42Thecreationofthegoodactionisthefirstblessing(niʿma)ofGod,andtherewardintheafterlifeforthisveryactionisasecondblessingfromHimtothehuman(niʿmaukhrāminhuilayka).ThisisagainanexampleforhowGodhasarrangedthecauses.God’screationofthegoodactioninthehumanisacauseforHisrewardintheafterlife.God’sfirstaction(creatingagoodaction

Page 9: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 9 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

inahuman)isthecauseforHissecondaction(rewardingthehumanintheafterlife).ThisalsoapplieswhenGodcreatesthankfulnessinahuman:

OneofGod’stwoactionsisthecause(sabab)fortheturningofthesecondactioninthedirectionofwhatpleasesHim.IneachcaseGodhasthegratefulness(al-shukr).Youare[simply]describedastheonewhoisgrateful(shākir),andthismeansthatyouaretheplaceofthethingthat“gratefulness”isanexpressionof.Thisdoesn’tmeanthatyouaretheonewhobringsgratefulnessintoexistence(mūjid).Similarly,ifyouaredescribedassomeonewhoisknowledgeable(ʿārifwa-ʿālim),thisdoesn’tmeanthatyouareacreatoroftheknowledgeandtheonewhobringsitinexistence.ItrathermeansthatyouareaplaceforitandthatithasalreadybeenbroughtintoexistenceinyoubytheEternalPower(al-qudraal-azaliyya).43

(p.223) AllcausesthatleadtosalvationintheafterlifeareindividualactsofGod(fiʿlminafʿālAllāh).ThecausalchainforhowGod’srevelationleadstosalvationintheafterlifeischaracterizedasfollows:Godsendshumansarevelationthatgivesthemknowledgeabouttheconnectionbetweendeedsinthisworldandredemptioninthenext.Godusesrevelationasasecondarycausetocreatethisknowledgeinhumans.Next,theknowledgeofthisconnectioncausesamotive(dāʿiya)thatencouragestheobeyingofGod’simperativesandtheperformanceofgooddeeds.ThismotiveisalsoGod’screation.ThedesiretoavoidpainintheafterlifeandtoachievethepleasuresofparadisecombinedwiththeknowledgethatcomesfromrevelationcausethehumanmotivetoactjustlyandthuspleaseGod.PleasingGodwillindeedleadtotheenjoymentofparadise.God’sactionofcreatingpiousdeedsforthehumanisthecauseofanotherofGod’sactions,namely,rewardinthenextlife.

Al-Ghazālī’sexplanationforhowactionsinthisworldleadtorewardorpunishmentinthehereafterisessentiallythesameasAvicenna’sexplanation.InhisPointersandReminders(al-Ishārātwa-l-tanbīhāt),AvicennaaddressesthequestionofwhyGodpunisheshumansiftheiractionsarepredetermined.Punishmentforone’stransgressions,hesays,islikeadiseasethataffectsthebodyfollowinggluttony(nahma):“Punishmentisoneoftheconsequencesthatpaststateshaveledto.Theoccurrenceofthesepaststatesandtheoccurrenceofwhatfollowsthemarebothinevitable.”44Punishmentorrewardinthehereafterisacausaleffectofone’sactionsinthisworld.Ourgoodactionsinthisworldarethusthecausesofhappinessinthenextwork,al-Ghazālīsays,andourbadactionsarethecausesofdistress,justasmedicineisthecauseofrecoveryfromasicknessandpoisonthecauseofdeath.45

HumanshaveeveryreasontobegratefultoGod,al-Ghazālīargues,sinceHecreatesinthemtheactionsthatlatercausetheirredemption.Next,al-Ghazālīaddressesanobjectionthathedoesnotexplicitlystate,althoughhisanswermakesthenatureoftheobjectionquiteevident:ifallhumanactionsareinrealityGod’sactions,al-Ghazālīexpectshisreaderstoask,whydoesHenotsimplytransferahumanintoparadisewithoutthewholeprocessofcreatingknowledgeinthehuman,creatingamotive,andcreatinghumanactions?IfGodistrulyomnipotent,couldHenothavemaderedemptionmucheasierforHiscreation?Al-Ghazālīanswers:

Page 10: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 10 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

OneofGod’sactsisthecause(sabab)foranother;Imeanthatthefirstoneisthecondition(sharṭ)forthesecond.Thecreationofthebody,forinstance,isthecauseforthecreationoftheaccident(ʿaraḍ),sinceHedoesnotcreatetheattributebeforeit.Thecreationoflifeisaconditionforthecreationofknowledgeandthecreationofknowledgeisaconditionforthecreationofvolition.AllthesearefromamongGod’sactionsandoneofthemisacausefortheother,meaningthatitisacondition.Beingaconditionmeansthatonlyasubstance(jawhar)ispreparedtoreceivetheactoflife,andonlysomethingthatlivesispreparedtoreceiveknowledge.Thereisnoreceptionofvolitionotherthanbysomethingthathasknowledge.(p.224) Therefore,“someofGod’sactionsareacauseforothers”meansthisanditdoesn’tmeanthatoneofHisactionsbringstheotherintoexistence.Rather[oneofGod’sactions]clearsthewayforacondition[whosefulfillmentisrequired]fortheexistenceofanotherofGod’sactions.46Ifthetruthofthisisgrasped,itelevatestothe[higher]stageofbeliefinGod’sunitythatwehavespokenabout.47

Godcannotsimplymovehumansfromtheircradleintoparadise,becausethe“conditions”ofenteringparadisearenotyetfulfilledwhenthehumanisstillinthecradle.Enteringparadisehasaspecificcause.Havingacausemeansoneormoreconditionsmustbefulfilledbeforethecreationoftheeventcantakeplace.Withoutthefulfillmentoftheseconditions,Godcannotcreatetheevent.ThusGodcannotcreatesomeone’sentryintoparadiseunlessHehasearliercreatedgooddeedsintheperson.Gooddeeds,inturn,cannotbecreatedinahumanwithoutapriorvolitionforperforminggooddeeds.Thevolitionrequiresthepriorexistenceofknowledge.Knowledge,inturn,requireslife,andlifecanonlybecreatedinasubstance(jawhar),beitinabodyorinastableincorporealentitysuchasacelestialorhumansoul.48Thehuman’sgooddeeds,hisvolition,hisknowledge,hislife,andhissubstanceareallindividualelementsinachainofconditionsthatmustbefulfilledbeforethehumancanenterparadise.Apropheticalḥadīthsaysthat“peoplewillbeledintoparadiseinchains.”Foral-Ghazālī,thisstatementexpressestheideathatonecanonlyenterparadise“ledbychainsofcauses”(maqūdbi-salāsilal-asbāb).49

Asecondpassageinal-Ghazālī’sRevivalconfirmstheviewthatGod’screativeactivityislimitedbyratherstrictconditions.Inthispassagefromthethirty-fifthbookonunderstandingGod’sunity(tawḥīd),al-Ghazālīrejectstheviewthatknowledgegenerates(wallada)volition,volitiongeneratesthehuman’spower-to-act,andthispowerthengeneratesthemovementofthelimbs.Thereaderknowsthathereal-GhazālīreferstoaMuʿtaziliteunderstandingofthe“generation”(tawallud)ofhumanactsandtheireffects.TheMuʿtazilitepositioniswrong,al-Ghazālīstresses:“[t]osaythatsomeofthesecomeintobeing(ḥadatha)fromothersispureignorance,nomatterwhetheronecallsit‘generating’(tawallud)oranythingelse.”Alltheseeventsgobacktoanentity(maʿnā)thatisknownasthe“EternalPower”(al-qudraal-azaliyya),andonlythosewhoaredeeplyrootedinknowledge(al-rāsikhūnafīl-ʿilm)understandthetruenature(kunh)ofthisbeing.50Inthenextsentence,al-Ghazālīexplainssomeoftheworkingsofthe“EternalPower”:

Page 11: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 11 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

Someoftheobjectsofthispower(muqdarāt),however,arearrangedsothattheircomingintobeingfollowsothers.Thearrangement(tartīb)isthatsomethingconditioned(al-mashrūṭ)followsafterthecondition(al-sharṭ).Avolitiononlycomesoutof(taṣduruʿan)theEternalPowerafterknowledge,andknowledgeonlyafterlife,andlifeonlyafterthereisasubstrateforlife.Andlikeonecannotsaythatlifeisbroughtintobeingbythebody,whichistheconditionforlife,so[onecannotsaythis]inthecaseofallotherstepsofthearrangement.(p.225) Someconditionsareapparenttotheordinaryperson,butothersareonlyapparenttotheelite(al-khawāṣṣ),whoexperienceunveilingbythelightoftheTruth.

Inanycase,nothingprecedingprecedesandnothingfollowingfollowsexceptbymeansofrightandnecessity.ThisappliestoallofGod’sactions.51

Accordingtothispassage,theconditionedprocessionofbody,life,volition,andhumanactionsis“bymeansofrightandnecessity”(bi-l-ḥaqqwa-l-luzūm).RichardGramlich,inhisvaluableGermantranslationofbooks31–36oftheRevival,renderstheArabicwordḥaqq(lit.“truth,”oralso“one’sdue”)insuchpassagesas“laws”or“regulations”(Gesetzmäßigkeiten),probablymeaningthelawsofnature.52Althoughitisnotimpossiblethatal-Ghazālīhadinmindthelawfulcharacterofthearrangementofconditionsandtheconditioned,itseemsalongstretchtoextractthismeaningfromtheadmittedlyhighlyambiguousArabicwordḥaqq.Morelikely,al-Ghazālīmeanstosaythatthearrangementfollowsarightnessthatgiveseachelementitsallocateddue.InAshʿaritetheology,“justice(ʿadl)istoputthingsintheirappropriateplace.”53Theword“necessity”thatfollowsafterthisexplanationislessproblematicinitsmeaning,thoughmoreproblematicwithregardtowhatitimplies.ItsuggeststhatGod’sactionsaretheresultofanarrangementthatworksbynecessityandleavesnoroomforalternatives.

InsomebooksofhisRevival,al-Ghazālīviewscausesaseventsthat“cleartheway”(mahhada)forthecreationoftheireffects.Theperspectivethatunderstandscausesas“conditions”fortheexistenceoftheireffectssuggeststhatGodcannotsimplycreateasHewishes,butrather,Hemustfollowamatrixofsuchconditions.Al-GhazālīhadalreadyputforwardaverysimilarpositionaboutconditionsforGod’screationintheThirdPosition(al-maqāmal-thālith)oftheseventeenthdiscussionintheIncoherence.HereintheRevival,asinhisIncoherence,al-Ghazālīavoidsclarifyingthenatureoftheseconditions.ThisnecessitycanbeeithertheresultofGod’schoosingortheconditionsthatareimposeduponGod’sactions.Al-GhazālīleavesopentheideawhetherGodHimselfchoosessuchconditionsuponHisactionsorwhethertheyarerequirementsbeyondGod’scontrolwithwhichHemustcomply.

TheConditionsofaCreationThatIstheBestofAllPossibleCreationsAssumingthattheconditionsthatapplytoGod’sactionsarebeyondGod’scontrolwouldmeanfollowingAvicennaandacceptingthatGodisnotafreeagentwhocannotchooseHisactions.BecauseeverycausalconnectionisessentiallysuchaconditionandarestrictionuponGod’sactions,adoptingtheviewthatGodcannotviolatecausalconnections,evenifHewantedto,wouldmaketheworldinwhichwelivenecessarywhiledeprivingGodofallfreedomforHisactions.ForAvicenna,Godnecessarilyactstoestablishthebestorder.

Page 12: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 12 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

Avicenna’s(p.226) positionsimplydoesnotallowfortheworldtobeanydifferentfromthisbestandnecessaryorder.Thedivineprovidence(al-ʿināyaal-ilāhiyya)thatallowsforcreationresultsfromGodbeingthepuregood(al-khayral-maḥḍ)thatonlyemanatesthebest.TheorderthatfollowsfromGod’sknowledgeisthebestorderthatispossible.ForAvicenna,Goddoesnothaveaparticulardesiretocreatethebestofallpossibleworlds;ratherHesimplycannothelpdoingso.EverythingthatHecreatesisthebestofallpossiblecreations.54

Al-Ghazālīgivesadetailedaccountoftheseteachingsinthetwobooksinwhichhereportsthepositionofthefalāsifa.55InthebookpreservedinMSLondon,Or.3126,al-GhazālīreproducestherelevantpassagesfromAvicenna’sPointersandRemindersandfromthemetaphysicsofhisHealing,whileaddinghisowncomments:ifonestudiestheanimalsandplantsandrealizesthatnature(al-ṭabīʿa)cannotgenerateallthesedetailsbyitself,oneunderstandsthatallthismustbe(lāmaḥāla)theproductofdivineprovidence.Thesameistrueifoneevaluatestheprivateinterchanges(muʿāmalāt)betweenpeople.Differentpeoplehavedifferenthabitsanddifferentunderstandingsofjustice.Divineprovidencerespondstothesedifferencesbysendingprophetstoteachthevariedpeopleonetruesenseofjustice.Theexistenceoftheseandotherbenefits(manāfiʿ)cannotpossiblycomefromanysourceotherthanGod.56

AlthoughthesethoughtsaimtoillustrateAvicenna’steachings,theyarenot,strictlyspeaking,partofthelatter’sdoctrine.ObservationalorempiricalevidenceoftheperfectionofGod’screationplaysnexttonoroleinAvicenna’sthought.Hemerelysaysthat“youcannotdenythewondrousmanifestations(al-āthāral-ʿajība)intheformationoftheworld(…)allofwhichdonotproceedbycoincidencebutrequiresomekindofordering(tadbīrmā).”57ForAvicenna,thisarrangement—howeverperfectitmayappear—cannotcountasevidenceforthisworld’sperfection.TheperfectioncanonlybededucedfromreflectingonGod’sknowledge,whichistheoriginofdivineprovidence.Theempiricalperceptionofthisworld’sperfectionisamotifofSufiliteratureandappearsprominentlyinAbūṬālibal-Makkī’sNourishmentoftheHearts(Qūtal-qulūb),amongotherplaces.ItisalsoanelementoftraditionalAshʿarism.ForAshʿarites,theskillfulness(itqān)andorderliness(intiẓām)ofGod’screationisaclearsignthatGodhasall-encompassingknowledge.58Suchargumentsbasedondesignandteleologicalmotifsalsoplayanimportantroleinal-Ghazālī’stheology.59InhisBalancedBookonWhat-to-Believe,al-GhazālīstressesthatallofGod’screationsareskillfullyandwiselyarranged.StudyingGod’screationmakesonerealizehowperfectlyitisordered.Here,asinmanyotherplaces,al-Ghazālīusestheparableofaskillfullyhandwrittentexttopointtothemanyaccomplishmentsofitsauthorandscribe.60

Inthethirty-fifthbookofhisRevival,al-Ghazālīincludesarelativelybriefpassageinwhichhealsoarguesthatthiscreationisthebestpossiblecreation.Theteachingsonthesetwopagesbecamefamousfortheircompressedformula:“Thereisinpossibilitynothingmorewondrousthanwhatis”(laysafī-l-imkānabdaʿmimmākān).61Thisteachingwasalreadyseenascontroversialinal-Ghazālī’slifetime,andoverthefollowingcenturies,itstirredalong-lastingdebateamongMuslimtheologiansaboutwhatexactlyal-Ghazālī(p.227)

Page 13: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 13 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

meanttoexpresshereandwhetherthestatementthatthisworldisthebestofallpossiblecreationsisactuallytrue.62Oncemore,al-Ghazālīfailedtobeexplicitaboutthetheologicalandphilosophicalimplicationsofhisteachings.ThispassageintheRevivalendswithacrypticstatementthatthepositionexpressedisaseaofarcanemattersinwhichmanyhavealreadydrowned.Behinditliesthesecretofpredestination(sirral-qadar)inwhichthemajorityofpeoplewonderinperplexity,andthosetowhomthingshavebeenunveiled(al-mukāshafūn)areforbiddentodivulgethesecret.63Later,al-Ghazālīcommentedonthispassageinashortexplanatorybook,TheDictationonDifficultPassagesintheRevival(al-Imlāʾfīishkālātal-Iḥyāʾ),writteninresponsetocritics.Here,heconfirmsthepositionthatthisworldisthebestofallpossiblecreationsbuthardlyaddsanythingthatcouldclarifythetheologicalbackground.64

Al-Ghazālītooksignificantpartsofthistwo-pagepassageonthebestofallpossibleworldsfromAbūṬālibal-Makkī’sSufihandbook,TheNourishmentoftheHearts.65Whatinterestedal-Ghazālīaboutal-Makkī’searliertextwastheapparentorderlinessoftheworld’sdesignthatal-Makkīillustrates.Basedontheseexamples,al-Ghazālīpositshistheorythatthiscreationisthebestofallpossibleones,aconclusionnotexplicitlyfoundinal-Makkī’swork.Thepassagemarkstheendofal-Ghazālī’sexplanationofwhyonemust“believeinGod’sunity”(tawḥīd),atwhichpointthetexttriestoconnectGod’sunitywiththeideaof“trustinGod”(tawakkul).Thediscussionoftawḥīdmakesclear,al-Ghazālī’sliteraryinterlocutorclaims,thathumanactionsarenotfree,butrathertheyarecompelledbythecauses(asbāb)thatdeterminethehuman’svolition.AlleventsinGod’screation,includinghumanactions,arecompulsory(al-kullujabrun).Ifthisisthecase,theinterlocutorasks,whydoesGodrewardandpunishhumansfortheiractions?SincesuchactionsareinrealityGod’sactions,whydoesGodbecomeangryatHisownactions?Al-Ghazālī’sresponserefersthereaderbacktothepassageinwhichhewritesthatoneofGod’searlieractions,namely,theactionthatHecreateswithinahuman,isthecauseforoneofGod’slateractions,thatis,bestowingrewardorpunishmentintheafterlife.66OnlythosewhohaveachievedahighdegreeoftrustinGodwillunderstandthisaspectoftawḥīd.

CompletetrustinGod,al-Ghazālīcontinues,resultsfromafirmbeliefinGod’smercy(raḥma)andinHiswisdom(ḥikma).Suchbeliefisitselfcreatedbyaninquiryinto“theonewhomakesthecausesfunctionascauses”(musabbibal-asbāb).Itwouldtaketoolong,al-Ghazālīwrites,toexplainhowthosetowhomtruthshavebeenrevealedreachtheirstronglevelofbeliefinGod’smercyandwisdom.Onecanonlygivethegist(ḥāṣil)oftheirmethod:theonewhoaimstodevelopafirmanddecisivetrustinGodbelievesthat,ifGodhadgivenallhumanstheunderstandingofthemostunderstandingamongthem,theknowledgeofthemostknowledgeableamongthem,andthewisdomofthemostwiseamongthem,andifHehadtaughtthemthesecretsofthisworldandthehereafter,andifHehadgiventhemtheopportunitytoorderthisworldanew,theycouldnothavecomeupwithanarrangementbetterthanorevendifferentfromthisone,notevenbyagnat’swingoraspeckofdust.67

(p.228) Al-GhazālīcopiedthislastlongsentencealmostverbatimfromAbūṬālibal-

Page 14: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 14 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

Makkī’sbook.68Inal-Makkī’stext,however,thesentencehasaverydifferentfunction.HeconstructsanargumentthataimstoillustratethefactthatGodcreatedthisworldinaccordwithhumanmeansforunderstandingit.Al-MakkīwishestoshowthatGod’screationisinaperfectorder,asviewedfromtheperspectiveofhumans.ThecompatibilitybetweenhumanmindsandtheorderofGod’screationgiveshumansreasontotrusttheaccuracyoftheirknowledgeandtheirunderstandingsoftheworld,anditallowsthemtomakepredictionsregardingfutureeventsinthisworld.Accordingtoal-Makkī,trustinGod(tawakkul)issynonymouswithtrustintheorderlinessofthisworld,whichisadirectresultofGod’smercy.Al-Makkīwrites:

Godcarriedoutthiscreationaccordingtothearrangementoftheminds(ʿalātartībal-ʿuqūl)andaccordingtothecustomarynotions(maʿānīl-ʿurf)andhabitualarrangementsthatcomewiththewell-knowncausesandfamiliarmediatorsaccordingtotheyardstickthatisimprintedinthemindsandthattheyhavebeenendowedwith.69

Al-Ghazālīdoesnotreiterateal-Makkī’sconclusionthatGodcreatedthisworldaccordingtothearrangementofhumanminds.Whatfascinatedhimwastheimplicationthatthisworldismostorderlyinitsdesign.Asaresult,hecopiedonlythatpartofal-Makkī’stextthatservesasafittingillustrationforthetwofactsthatthisworldiscreatedaccordingtoaperfectarrangementandthatthearrangementisaccessibletohumanunderstanding.Eventhemostperfecthumanmindswillperceivenothingbutorderlinessintheworld.Foral-Ghazālī,thisorderisnottheresultofasimpleaccordbetweenhumanmindsandGod’screation.Hecomestoamoreradicalconclusionandsaysthattheorderisthebestofallpossibledesignsfortheworld.Thisistrueinabsoluteterms,notjustaccordingtohumanunderstanding:

EverythingthatGoddistributesamonghumans,suchassustenance,life-span(ajal),pleasureandpain,incapacityandcapacity,beliefandunbelief,piousandsinfulactions,isallofsheerjustice,withnoinjusticeinit,andpureright,withnowronginit.

Indeed,itisaccordingtothenecessaryrightarrangement(ʿalāl-tartībal-wājibal-ḥaqq)inaccordtowhatshouldbe(ʿalāmāyanbaghī)andlikeitshouldbe(kamāyanbaghī)andinthemeasureinwhichitshouldbe(wa-bi-l-qadralladhīyanbaghī);andthereisinpossibilitynothingmoreexcellent,moreperfect,andmorecompletethanit.70

Ifpeoplelivewiththeimpressionthattheirlotinthisworldisunjust,al-Ghazālīexplains,theyshouldwaitforthenextworldtoseehowtheywillbecompensatedforthelossesthatmightbeinflictedontheminthisworld.Thosewhogainadvantagesinthisworldbydoinginjustice,however,shallhavetopayforthatintheafterlife.

Imperfectionsinthisworldarereal,al-Ghazālīsays,yettheyservethehigherpurposeofrealizingthemostperfectworld.Inthetwenty-secondbook(p.229) oftheRevival,al-Ghazālīsaysthatdesire(shahwa)andanger(ghaḍab)arecharactertraitsresponsible

Page 15: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 15 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

formuchharminthisworld.Yettheyarenecessarybecausewithoutdesireforfoodandsex,humanscouldnotsurvive;withoutanger,theywouldnotbeabletodefendthemselvesfromthosethingsthatthreatentheirlives.71Eventhemostperfectarrangementfortheworldincludesacertainamountofharmthatmanifestsitselfasimperfectionsthat,inturn,pointtowardtheperfect.Iftherewerenosickness,thehealthywouldnotenjoyhealth.Ifbeastshadnotbeencreated,thedignityofmanwouldnothavebecomemanifest.Althoughthepunishmentsinhellmayseemlikeimperfections,theyarenecessaryinordertohonorthosewhowillenterparadiseandshowtherighteoustheextentoftheirreward.Inasense,themeritsoftherighteousareransomedbythesufferingoftheunbelievers.Thisislikesavingthehealthofapersonbyamputatinghisgangrenoushand.Perfectionandimperfectiondonotbecomeapparentinabsolutetermsbutonlyinrelationtoeachother.Theperfect,therefore,needstheimperfectinordertodemonstrateitsperfection:“[God’s]generosityand[His]wisdomrequirethesimultaneouscreationoftheperfectandtheimperfect.”72

Thenotionthatthebestofallpossibleworldsnecessarilyrequiresthecreationofimperfectionscomesfromphilosophicalliterature.EricOrmsby,whooffersaninsightfulanddetailedanalysisofthispassage,observedthatal-GhazālīhadtakenthisideafromtheworksofAvicenna.73InhisPointersandReminders,Avicennawritesthatitisnecessarytocreatethingsthatarelackinginperfectioninasmuchastheyarebadorharmful(sharr).74Inordertorealizeaperfectorder,itisalsonecessaryforthegoodtopredominateovertheharmful.Yetsomeharmmustbethere,orelsethegoodwouldnotbeabletoshowitsadvantages(faḍīla).Aperfectworld,therefore,mustcontaincreationsthatareabsoluteevilaswellasthoseinwhichtheevilaspectspredominateoverthebeneficialones.Thisisbecauseasmallamountofevilpreserves(taḥarraza)thegoodcreationsandsafeguardsthatharmfuleffectswillalwaysbelimited.AllthisistakenintoaccountinGod’sprovidenceforHiscreation.God,whoaccordingtoAvicennapursuesnogoalsforHiscreationandhasnodesires,createstheharmfulasifHedesiresitbyaccident.OnecanthereforesaythatharmentersGod’screationbyaccident,likeadiseaseaccidentallyaffectslivingbeings.75

Althoughharmaffectsexistenceaccidentally—thatis,harmisnotnecessaryfortheexistenceofanykindofworld—harmisindeednecessaryfortherealizationofaworldthatisthebestofallpossibleworlds.Itisnotanundesiredsideeffectofcreatingthegood,butratheritisintrinsictoitsestablishment.Thecreationofperfectionnecessarilyrequiresthesimultaneouscreationofimperfectionsfortheperfecttoexist.Harmisanecessaryconcomitantofthisworld’sgoodconstitution:“[t]heexistenceofevilisanecessitythatfollowsfromtheneedforthegood.”76ForAvicenna,harmisaprivationofperfection,andthemostessentialprivationisthenonexistent(al-ʿadam).77Somethingthatexistsisalwaysbetterthansomethingthatdoesnotexist.Therefore,thefactthatGodcreatesthisworldisabenefitthatbyitselfoutweighsmanyofitsprivations.Ifthingsareaffectedbyharm,theysufferfromprivationofperfection.Such(p.230)imperfectionsmanifestthemselvesasignorance,forinstance,orasphysicalweakness,deformation,pain,ordistress.78Harmandevilexist,however,onlyinthesublunarsphereofgenerationandcorruption,andinthatsphere,theyaffectonlyindividualsand

Page 16: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 16 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

notclassesofbeings.79Theheavenlyspheresandtheuniversalsareperfectandnotaffectedbyit.EchoingAristotle,Avicennasaystheharminthesublunarsphereisinsignificant(ṭafīf)incomparisontotheperfectionoftherestofexistence.80

Al-GhazālīwasevidentlyimpressedbyAvicenna’ssolutiontothequestionoftheodicy.Inthethirty-secondbookoftheRevival,al-Ghazālīmentionstheexampleofafatherwhoforceshisinfantsontoundergothepainfulprocessofcuppinginordertohealanillness.Thisfatherismorebeneficialtothechildthanhismotherwho,inherlove,wishestosparehimalldistress.81HeelaboratesfurtheronthisexampleinhisHighestGoal(al-Maqṣadal-asnā),inwhichhecommentsonthedivinename“theMerciful”(al-raḥmānal-raḥīm).TotheobjectionthatGodshouldnotbecalledmercifulaslongHecreatessomuchpoverty,distress,sickness,andharminHiscreation,al-Ghazālīrespondswithaparable:

Amothercareslovinglyforhersmallchildanddoesnotallowthatitundergoescupping,yetthefatherisinsightful(ʿāqil)andforciblytreatsthechildwithit.Anignorantpersonthinksthatonlythemotherismercifulbutnotthefather.Aninsightfulpersonknowsthatitispartoftheperfectionofthefather’smercy,hisaffection,andhiscompletecompassionwhenhecausespaintothechildbymakingitundergocupping.[Theinsightfulpersonalsoknows]thatthemotherisanenemytothechildintheguiseofafriend.Thepain[causedbycupping]issmallandyetitisthecauseformuchpleasure.Soitisn’tharmful,ratheritisgood.82

Thisexplanationappliestoallimperfectionsandharminthisworld.Theyservethelargergoodofpreservingtheperfections:“Thereisnoharminexistencewhichdoesnotcarryinsidesomegood;werethatharmeliminated,thegoodthatithasinsidewouldvanish.Theresultwouldbeanincreaseinharmincomparisontowhatithadbefore.”83GodreferredtothisrelationshipwheninaḥadīthHerevealed:“[m]ymercyoutstripsmywrath.”Beneathallthisinsight,however,liesasecretthatrevelationcannotfullydisclose.84

Whileal-GhazālīevidentlyacceptsAvicenna’sjustificationofwhyharmexistsinGod’screation,hedoesnotacceptthemetaphysicalpremisethatcreatingperfectionisanecessaryresultofthedivinenature.Al-Ghazālī,forinstance,nowheresaysthatitisinGod’snaturetocreatethebestcreation.KnowledgeaboutthebestofallpossibleworldsisnotacquiredbyreflectiononGod’sattributes.Rather,weknowthatGodcreatesthebestbylookingathiscreatures.InhisDictationonDifficultPassagesintheRevival,inwhichal-GhazālīapologeticallycommentsonteachingsintheRevivalthatpromptedoppositionamonghispeers,hedevoteslittlemorethanonepagetotheissueofthebestofallpossibleworlds.Hereheexplainshowweknowthatthiscreationcouldnotbemoreperfect:(p.231)

IfeverythingthatGodcreatesweredefectiveincomparisontoanothercreationthatHecouldhavecreatedbutdidn’tcreate,thedeficiencythatwouldinfectthisexistenceofHiscreationwouldbeevidentjustlikeitisevidentthatthereareinHis[actual]creationparticularindividualswhomHedidcreatedeficientinorderto

Page 17: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 17 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

showtherebytheperfectionofwhatHecreatesotherwise.85

GodcreatesdeficienciesinordertopointthoseinsightfulhumanstowardtheperfectionofHiscreation.Withoutthemanifestimperfections,theperfectionofothercreationswouldsimplyremainunknown.ImperfectcreationsdrawattentiontotheperfectonesandmakeGod’sperfectionobvious:

InasmuchasHeshowshumansHisperfection,HepointsthemtowardsHisdeficiency;andinasmuchHemakesthemknowHisomnipotence,HemakesthemseeHisincapacity.86

Studyingthecreatedbeings(makhlūqāt)istheonlymeansofknowingthatthisworldisthemostperfect.Revelationcanonlyhintatthisfactbecauserevealingthisworld’sperfectiontothemassesofthepeoplewouldmakeitsperfectionvoid.InhisDictation,al-Ghazālīsaysthatthesubjectofthebestofallpossibleworldsisoneofthesecretsofworship(asrāral-ʿibāda)andcannotbediscussedopenly.Godgivesuspreciselytherightamountofknowledgetoenableustocontributeourbestactionstothisworld.TheamountofknowledgeHegivesusispartofthemostperfectarrangementofHiscreation.Ifpeoplewithweakintellectsweretobecomeawarethateverythingisforeseenandinaperfectorder,theywoulddrawwrongconclusionsandbepromptedtoperformactionslessperfectthanthosetheydowithoutthisknowledge.WouldGodhavegiventhosehumansdestinedtoenterparadiseawaytoknowtheirfuturebliss,forinstance,theywouldneverarrive.Suchknowledgewouldleadtobadactionsandpreventredemptioninthehereafter.Thesameistrueforonewhohasbeentoldthathewillendupinhell.Hewouldmakenofurtherefforttorestrainhisbadpassions.ItispartofGod’sperfectarrangementtopreventallbutthemostlearnedfromgainingknowledgeofthisworld’sperfection.87

TheNecessityoftheConditionsinGod’sCreationAl-GhazālīteachesthatGodchoosestoshowutmostmercytoHiscreationandthatHecreatesthebestofallpossibleworlds.Heisliketheinsightfulfatherwhochoosestobemercifultohischild.Yet,suchastheactionsofthiswisefather,God’swiseactionscaninflictpainuponHiscreation.Itisasignofwisdomthattheworldiscreatedwithacertaindegreeofharmfulnessintrinsictoit.EvenifGodfreelychoosestofollowthewisdomoftheplantocreatetheworld,onceHedecidestocreatethebestpossibleworld,Henolongerhasachoiceaboutwhattocreate.Amongallpossibleworlds,thereisonlyonethatisthebestofallpossibles.InhisDictationonDifficultPassagesintheRevival,al-GhazālīsaysthatGod’sactionsaretheresultofthefreechoice(ikhtiyār)that(p.232) thisfreeagent(fāʿilmukhtār)hasaboutHisactions.OnceGodchoosestocreatethemostperfectworld,however,Hisactionsfollowanecessarypaththatisdictatedbywisdom.Al-Ghazālīexplainshowwisdom(ḥikma)determinesthedivineactions:

OnceGodacts,itisonlypossibleforHimtodowhatis[within]thelimitthatthewisdom(al-ḥikma)requires,ofwhichweknowthatitis[true]wisdom.GodletsusknowaboutthisonlybecauseweknowthechannelsofHisactionsandtheoriginsofHisaffairsandbecauseHeverifiesthateverythingwhichHedecidedandwhich

Page 18: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 18 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

HedecreesinHiscreationisbymeansofHisknowledge,andHiswill,andHispower,andthatitisofutmostwisdom,ofextremeskillfulness,andofthefullamountofthecreation’sgenerosity.[Godletsusknowaboutthis]becausetheperfectionofwhatHecreatesisadecisiveargumentandanevidentdemonstrationforHisperfectionintheattributesofHisglory(jalāl)thatmakeitnecessarytocallHimthemostglorious(al-mūjibali-ijlālihi).88

ThedivinemotivetocreatethebestofallpossibleworldsexplainswhyGodcreatesthisworldasitisandwhyHeputsspecificconditionsonachievingcertainbenefits.Itexplains,forinstance,whyGoddoesnotmovehumansimmediatelyfromthecradletoparadise.Inthethirty-secondbookofhisRevival,al-Ghazālīonlypartlyanswersthisquestion.Certainconditionsexist,whichmustbefulfilledforhumanstoenterparadise.Humanshavetoperformpiousdeeds,whichinturnrequirethepriorexistenceofavolitionthattriggersthesedeeds.Thevolitionrequiresthepriorexistenceofknowledgeonthepartofhumans,andsoforth.Aswehavealreadysaid,theseconditionsmayalsobeunderstoodascausalconnections.Thecorrectsortofknowledgethatanindividualhaswillcausethecorrectkindofvolition,whichwillcausethecorrectkindofactiontocauseentryintoparadise.Yetthelargerquestionremains:whydoalltheseconditions—orcausalconnections—exist?SinceGodhasauniversalanddetailedpre-knowledgeofalleventspastandfuture,andsinceHecreatesallhumanactions,whycanHenotmakehischosenpeopleenterparadiseevenbeforetheyexperiencethehardshipofbirthandchildhood?Whyallthesecomplications?Whynotsimplycreatehumansoulsandplacethemintoparadise?

ForanAshʿarite,thereisnoanswertothisquestionandthusnoreasontoask.Yetinthisparticularquestion,al-GhazālīclearlygoesbeyondtheAshʿariteapproachandventurestoanswertheproblemopenly,albeitwithoutdiscussion.Thearrangementsoftheworldinwhichwelivearethoseofthebestofallpossibleworlds.Thisworldcannotbebetter,becauseitisalreadythebestpossible.Italsocannotbeworse,becauseGoddecidedinHismercynottosatisfyHimselfwithlessthanwhatisthebest.ThearrangementisthereforedeterminedbyGod’sdecisiontocreatethebestpossibleworld.

InhisRevival,al-GhazālīstatesafewtimesthatGod’sactionsarenecessary.Oneofthemostoutspokenpassagesisinthethirty-fifthbook,which(p.233) focusesontawḥīd,shortlybeforeal-Ghazālīwritesthatthiscreationisthebestpossibleone.Inthispassage,creationisdescribedasanecessaryprocess:

Everythingbetweentheheavenandtheearthhappensaccordingtoanecessaryarrangementandabindingrightnessandonecannotimaginethatitwouldbedifferentfromhowithappensordifferentfromthisarrangementthatisfound.Whatcomeslatercomeslateronlybecauseitwaitsforitscondition.Theconditioned(al-mashrūṭ)isimpossiblebeforethecondition(al-sharṭ).TheimpossiblecannotbedescribedasbeingwithinGod’spower.Thereforeknowledgeonlycomesafterthespermbecausetheconditionoflifeneedstobefulfilled,andvolitiononlycomesafterknowledgebecausetheconditionofknowledgeneedstobefulfilled.Allthisisthewayofthenecessary(minhājal-wājib)andthe

Page 19: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 19 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

arrangementoftherightness(tartībal-ḥaqq).Thereisnoplayinitandnocoincidence(ittifāq);ratherallthisisthroughwisdomandordering.89

God’screativeactivityfollowsa“necessaryarrangement”(tartībwājib)andcontainsa“bindingrightness”(ḥaqqlāzim)thatcannotbeotherwise.ThenecessityofGod’sactionsexists“throughwisdomandordering”(bi-ḥikmawa-tadbīr);wisdomdictatestheconditionsofthebestofallpossibleworlds,andGodchoosetoabidebyitsprecepts.ThenecessityofGod’screationalsoappearsinthethirty-secondbookofhisRevival.Inasentencethatwehavealreadyquotedabove,al-Ghazālīsaysthat“nothingprecedingprecedesandnothingfollowingfollowsexceptbymeansoftherightnessandthenecessity(bi-l-ḥaqqwa-l-luzūm).”90ThenecessityofGod’sorderisalsoexpressedinthepassagewherehedescribesthebestofallpossibleworldsascreated“accordingtothenecessaryrightarrangement”(ʿalāl-tartībal-wājibal-ḥaqq)and“inaccordtowhatshouldbe”(ʿalāmāyanbaghī).91ThenecessityinthispassageneednotbetheabsolutenecessityofAvicenna,butratheranecessityrelativetothedecisiontocreatethebestpossibleworld.

WehavethusfargivenarelativelysmoothinterpretationofdifferentmotifsintheRevival.Iftheseinterpretationswereallthathavebeenproposed,however,al-Ghazāliwouldnotbeseenassuchacontroversialauthor.Theabovequotedpassageincludesatleastoneformulathatcannotbeexplainedbyreferringtothenecessitiesthatspringfromthedecisiontocreatethebestofallpossibleworlds.WhereasitisplausiblethatthebestorderrequiresthatGod’sactionsabidewithcertainconditions,al-Ghazālīcontinuesandsaysthatanyarrangementdifferentfromwhatexistsisimpossible,and“theimpossiblecannotbedescribedasbeingwithinGod’spower”(al-muḥāllāyūṣafubi-kawnihimaqdūran).

Therearetwowaystounderstandimpossibilityinthissentence,astrongwayandaweakway.Triggeredbythispassage,RichardM.Frankproposedthesetwointerpretations.92Frankprefersthestrongwayofunderstandingimpossibility,whichsuggeststhatGod’sactionshavetocomplywiththenecessityofGod’snature.GodmustfollowHisgenerosity(jūd);Godmustcreatethebestofallpossibleworlds.Whenal-Ghazālīsays,Frankhasargued,thatGod’s(p.234) decisionsaremadebypurefreechoice(ikhtiyārmaḥḍ),hesimplymeansthatGodisnotdistractedfromchoosingwhatistrulybeneficial(khayr)forHiscreation.Inreality,however,Godcannothelpchoosingthegood,whichmeansthateffectivelyHedoesnotactuallychooseandcannotmakefreedecisionsaboutHisactions.ThecreationofthisworldproceedsfromHislackoflibertyasanecessaryact.Readingsuchstrongsenseintothewords“impossible”and“necessary”assumesthattheactionsofal-Ghazālī’sGod—liketheGodofAvicenna—aredeterminedbyHisnature.ThisistheGodofthefalāsifawhosewillisidenticalwithHisknowledgeandHisessence.

Al-Ghazālī,however,rejectedtheideathatcreationtakesplaceasadirectandinevitableconsequenceofGod’sbeing.InAvicenna,God’sknowledgeistheoriginofthebestofallpossibleworlds.Inal-Ghazālī,however,itisGod’swill.Godchoosestobegenerous,andthischoiceisundetermined.God’swillisthereforetheundetermineddeterminingfactorofcreation.Thisideaisexpressedforcefullyinmanyofhiswritings,andFrank

Page 20: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 20 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

acknowledgestheimportanceofthismotifinal-Ghazālī’stheology.93FailingtodetachGod’swillfromHisknowledgeandthusconstructingaGodwhoactsoutofnecessityratherthanoutofHisdecisionsisal-Ghazālī’smainobjectionagainstthefalāsifainhisIncoherence.94Foral-Ghazālī,itisanaffronttoreasontoclaimthatitisnotinGod’spowertocreatethisworlddifferentlyfromhowitis.Becausewecaneasilyimaginethisworldtobelargerorsmaller,forinstance,itisthereforenotimpossibleforittohavebeencreatedlargerorsmaller.Theworldwaspossiblebeforeitcameintoexistence,andGodwasneverincapableofcreatingit.95InhisLetterforJerusalem,al-GhazālīsaysthatGodchooseswhatHecreatesamongthealternative(ḍidd)ofnotcreatingit.96InthecontextofAshʿaritetheology,al-Ghazālīexpressesthedivineliberumarbitrium—thedivinecapacitytochoosefreely—inthetenetthatGod’swillandHisknowledgeare,likeHislife,power,hearing,seeing,andHisspeech,attributesthatarenotidenticaltobutrather“additionaltoGod’sessence”(zāʾidʿalāl-dhāt).97TheubiquityandforcefulpresentationofthistheologicalmotifmakesitallbutimpossibletoacceptFrank’sstronginterpretationofwhyanothercreationwouldnotbewithinGod’spowertocreate.

Theimpossibilityofanyothercreationmeans—accordingtoasecond,weakerreading—thattheexistenceofwhatGoddoesnotwilltocreate(thatwhichHeknowswillneverexist)thoughpossibleinitself,isactuallyimpossible.ThisformulationreferstotheFarabiandistinctionbetweenthetwotypesofnecessities,restatedbyal-GhazālīinhisBalancedBook.AnyfuturecontingencythatGodknowsHewillnotcreateis“possiblewithregardtoitself,”yet“impossiblewithregardtosomethingelse,”meaningimpossiblewithregardtoGod’sforeknowledge.CreatingwhatisnotpartofGod’sforeknowledgecannothappen,evenifitremainspossibleinitself.ItwouldturnGod’sknowledgeintoignorance,andthatissimplyimpossible.Therefore,onecansaythatwhateverisnotpartofGod’sforeknowledge“isnotwithinGod’spowertocreateinthesensethatitsexistencewouldamounttoanimpossibility.”98Acreationdifferentfromthisoneisnotimpossibleinabsoluteterms,asGodcouldhavechosentocreateit.ButitremainsimpossiblerelativetothechoicesGodhasalreadymade.

Notes:

(1).Al-Ghazālī,Iḥyāʾ,1:27.3–5/27.11–13.ForasynopsisandanindexofsubjectsintheIḥyāʾ,seeBousquet,Ih’yaʿouloûmad-dînouvivicationdessciencesdelafoi.

(2).Al-Ghazālī,Iḥyāʾ,1:12.21–23/5.4–7.

(3).Thepositionthatthehumanactisthecausaleffectofamotive(dāʿinordāʿiya)goesbacktotheBasranMuʿtaziliteAbūl-Ḥusaynal-BaṣrīandtoIbnSīnā.InAshʾaritekalām,itappearsalreadyinal-JuwaynīandhadaconsiderableinfluenceonlaterAshʿaritethought,particularlyonFakhral-Dīnal-Rāzī.OnAbūl-Ḥusayn’stheoryofaction,seeGimaret,Théoriesdel’actehumain,59–60,124–26,130–31,143;Shihadeh,TheTeleologicalEthicsofFakhral-Dīnal-Rāzī,25–29;Madelung,“LateMuʿtazila,”250–56;andMcDermott,“Abūl-Ḥusaynal-BaṣrīonGod’sVolition.”Ontranslatingirādawhenitappliestohumansas“volition”ratherthanas“will,”seeFrank,Creation,32–34.

Page 21: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 21 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

(4).Heer,“MoralDeliberation,”166–68.

(5).Al-Ghazālī,Iḥyāʾ,3:53.19–20/1417.12–13;Heer,“MoralDeliberation,”166,168.

(6).Heer,“MoralDeliberation,”170.

(7).Al-Ghazālī,al-Mustaṣfā,1:196.6–9/1:61.12–14.

(8).Al-Ghazālī,Iḥyāʾ,4:315.11–318.4/2508.21–2512.11;theperspectiveinthispassageisdistinctlycausalist.Anotherpassageinthethirty-firstbookontawba(ibid.4:7.19–9.7/2084.11–2086.10)usesmoreoccasionalistlanguage.Seealsoapassageinthethirty-secondbookonshukr(ibid.4:111.7–112.18/2223.21–2225.18).TheparableofthewayfarertoGodinthethirty-fifthbook(ibid.4:307.ult.–314.6/2498.11–507.5)alsoincludesanexplanationofthecompelledcharacterofhumanactions.Onal-Ghazālī’stheoryofhumanactionintheIḥyāʾ,seeFrank,Creation,23–27,31–37;idem,Al-GhazālīandtheAshʾariteSchool,42–47;Gimaret,Théoriesdel’actehumain,130–32;Marmura,“GhazaliandAshʿarismRevisited,”102–10;Heer,“MoralDeliberation”;Gardet,Dieuetladestinéedel’homme,74–77;andAbrahamov,“Al-Ghazālī’sTheoryofCausality,”88–90.OnthemoreAshʿariteformulationofthesametheoryintheIqtiṣādandotherworks,seeMarmura,“Ghazali’sChapteronDivinePowerintheIqtiṣād”;Gimaret,Théoriesdel’actehumain,129–30;Gyekye,“GhazâlîonAction”;andDruart,“Al-Ghazālī’sConceptionoftheAgent.”

(9).Schwarz,“’Acquisition’(kasb)inEarlyKalām.”

(10).Seetheexplanationofal-Ashʿarī’stheoryofhumanactionaboveonp.128.OnkasbinearlyAshʿaritetheology,seealsoGimaret,Théoriesdel’actehumain,79–128,esp.84–85;Watt,FormativePeriod,189–94;andAbrahamov“ARe-examinationofal-Ashʿarī’sTheoryofkasb.”

(11).Al-Ghazālī,al-Iqtiṣād,86.ult.–87.3;Marmura,“Ghazali’sChapteronDivinePower,”303;Druart,“Al-Ghazālī’sConceptionoftheAgent,”436.

(12).Al-Ghazālī,Iḥyāʾ,4:307.14–18/2497.19–22;4:314.24–25/2508.3–4.

(13).Analyzingthelessexplicitworkal-Iqtiṣād,Druart,“Al-Ghazālī’sConceptionoftheAgent,”439,concludesthathumansare“agentsonlyinametaphysicalway.”

(14).Al-Ghazālī,Iḥyāʾ,4:316.5–7/2509.paenult.–2510.2;al-Zabīdī,Itḥāfal-sāda,9:421.

(15).Frank,Creation,33–34.

(16).(…)annal-irādatabiʿal-ʿilmaalladhīyaḥkumubi-annal-shayʾamuwāfiqunlaka;al-Ghazālī,Iḥyāʾ,4:316.10–11/2510.7.

(17).Ibid.4:317.4–6/2511.8–10;correctedtoal-kulluyaṣduruminhuaccordingtoal-Zabīdī,Itḥāfal-sāda,9:422.10.

Page 22: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 22 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

(18).innakhilāfal-maʿlūmimaqdūr?al-Ghazālī,al-Iqtiṣād,83–86.Marmura,“Ghazali’sChapteronDivinePower,”299–302.Seeabovep.192.Seealsoal-Juwaynī,al-Shāmil(ed.Alexandria),375–76.

(19).Al-Ghazālī,al-Iqtiṣād,85.1–3;85.5–7;Marmura,“Ghazali’sChapteronDivinePower,”301.

(20).kār-ikhalq-ihamaba-rāykhweshast;al-Ghazālī,Ḥimāqat-iahl-iibāḥat,9.3/169.13.

(21).Al-Ghazālī,Iḥyāʾ,4:317.6–11/2511.10–16.

(22).Fakhral-Dīnal-Rāzī,al-Tafsīral-kabīr,4:88.5–9(adQ2:134),alreadyascribesthispositiontoal-Juwaynīandhisal-ʿAqīdaal-Niẓāmiyya.HeaddsthatthispositionisclosetothatofAbūl-Ḥuṣaynal-Baṣrī.

(23).SeeIbnSīnā,al-Shifāʾ,al-Ilāhiyyāt,360.6–9,362.16–19.OnIbnSīnā’steachingsaboutthegenerationofhumanacts,seeMichot’sintroductiontoIbnSīnā,Réfutationdel’astrologie,59*–75*;Belo,ChanceandDeterminism,115–17;andJanssens,“TheProblemofHumanFreedominIbnSînâ.”Al-GhazālīgivesacolorfulreportoftheseviewsinhisMaqāṣidal-falāsifa,2:82.4–paenult./236.3–23,wherehediscusses,ashedoesinmanyworksthatpresenthisownteachings,theexampleofhowwritingiscaused.OntheAvicennaninfluenceonal-Ghazālī’stheoryofhumanaction,seeFrank,Creation,24–25;andMarmura,“GhazaliandAshʿarismRevisited,”107.VandenBergh,“Ghazalion‘GratitudeTowardsGod,’”pointstowardstheStoicoriginsoftheseteachings.

(24).IbnSīnā,al-Shifāʾ,al-Ilāhiyyāt,133.13–15.Seealsothedetaileddiscussionofhumanactioninchapter6.5oftheIlāhiyyāt,220–35.Theword“motive”(dāʿinordāʿiya)appearsinIbnSīnā’sIlāhiyyātafewtimes,sayingthatGodhasnomotive(233.4–6,303.11)orthattheactionsofhumansareguidedbymotives(223.9,230.12,372.18).ItisveryprominentincertainpassagesinIbnSīnā,al-Taʿlīqāt,50–51,53/108,295–97.OnthesepassagesaboutthegenerationofhumanactionsinIbnSīnā,seeMichot’sintroductiontoIbnSīnā,Réfutationdel’astrologie,68*–75*.

(25).Al-Ghazālī,Iḥyāʾ,4:307.ult.–314.6/2498.11–507.5.AbriefversionoftheparableisinIḥyāʾ,4:103.5–ult./2213.4–ult.;andinal-Arbaʿīn,241.4–242.9/220.5–221.5.Inthisparable,al-Ghazālīoffersaviewofhumanknowledgeinwhichthe“pen”intheʿālamal-malakūtwritesonablanktabletinthehumansoul.ThisisanapplicationofphilosophicalideasbasedonAristotle,Deanima,III.5.Al-Ghazālī’s“pen”istheactiveintellectthatwritesknowledgeonwhatisinAristotlethe“erasedtablet”(thetabularasa)withintheindividualhumansoul(Aristotle,Deanima,430a.1–2).Inal-Ḥikmaal-ʿarshiyya,12.4–5,IbnSīnāidentifiestheactiveintellectwith“thepen”andthesouloftheprophetwith“atablet.”Onal-Ghazālī’sparable,seeGimaret,Théoriesdel’actehumain,131;Nakamura,“Ghazālī’sCosmologyReconsidered,”40–43;Gianotti,Al-Ghazālī’sUnspeakableDoctrine,152–55.Ontheactiveintellectinal-Ghazālī’sMishkātal-anwār,seeAbrahamov,“IbnSīnā’sInfluenceonal-Ghazālī’sNon-PhilosophicalWorks,”8–12.Ontheterms

Page 23: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 23 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

malakūt,jabarūt,andmulkinal-Ghazālīandinpreviousauthors,seeNakamura,“Ghazālī’sCosmologyReconsidered”;Davidson,Alfarabi,Avicenna,andAverroesonIntellect,119,133–35;Lazarus-Yafeh,Studies,503–22;Frank,Creation,19;andWensinck,“OntheRelationshipBetweenal-Ghazālī’sCosmologyandHisMysticism.”

(26).Theimperative“act!”(iʿmalū)appearsnumeroustimesintheQur’an(e.g.Q6.135).Fromthecanonicalḥadīthcorpus,al-Ghazālīquotes:“Act!becauseeverythinghasbeenmadeeasyifithasbeencreatedforyou”(Iḥyāʾ,4:111.18/2224.12).Forthisḥadīth,seeal-Bukhārī,al-Ṣaḥīh,qadar4;orIbnMāja,Sunan,muqaddima10;cf.Wensinck,Concordance,7:364b.ThetheologicalimplicationsofthisḥadītharediscussedinvanEss,ZwischenḤadīṯundTheologie,39–47;andGramlich,Muḥammadal-ĠazzālīsLehre,194–95.

(27).Al-Ghazālī,Iḥyāʾ,4:111.21–23/2224:17–19.Thathumanactsarepromptedbyamotive(dāʿinordāʿiya)goesbacktotheBasranMuʿtaziliteAbūl-Ḥusaynal-BaṣrībuthasalsobeentaughtbyIbnSīnā.Seeabovenotes3and24.Theusageofjāzima(“decisive”)isentirelyAvicennan.ForIbnSīnā’sdistinctionbetweenadecisivevolition(irādajāzima)andanincliningvolition(irādamumīla),seeMarmura,“TheMetaphysicsofEfficientCausality,”183;andidem,“AvicennaonCausalPriority,”70.

(28).Al-Ghazālī,Iḥyāʾ,4:112.5–8/2225.2–6.Seeal-Zabīdī,Iṭhāfal-sāda,9:62.17–21,whohasyussirainsteadoftayassaraandtaqūdahuinsteadofyaqūdahu.Cf.Gramlich,Muḥammadal-ĠazzālīsLehre,195.

(29).Seealsoal-Ghazālī,Iqtiṣād,6.10–7.6;onthispassage,seevanEss,Erkenntnislehre,338.

(30).Seeabovep.133.Cf.Q80.20“(…)then[God]makesthepatheasyforhim(…)”;Al-Subkī,Ṭabaqāt,3:386.5–6,alreadyremarkedthatal-Ghazālī’stheoryofhumanactionisidenticalbothtothatofal-JuwaynīandtothatoftheMuʿtazila.SeeGimaret,Théoriesdel’actehumain,129.

(31).IbnTūmart,Sifrfīhijāmiʿ,taʿālīqal-Imām,214.1–5.Thischainalsoappearsinthetext“al-Kalāmʿalāl-ʿibāda”;ibid.,205–6.

(32).See,however,asomewhatsimilarpassageinIqtiṣād,6.10–7.6.

(33).Al-Ghazālī,Iḥyāʾ,4:119.14–15/2235.9–11.Cf.al-Zabīdī,Itḥāfal-sāda,9:72.8–11;andGramlich,Muḥammadal-ĠazzālīsLehre,207.

(34).IntheIḥyāʾ,seemostofalltheBayānfīkayfiyyatal-tafakkurfīkhalqAllāhattheendofthethirty-ninthbookonmeditation(tafakkur);al-Ghazālī,Iḥyāʾ,4:540–57/2822–44;Ormsby,Theodicy,45–51.Onal-Ghazālī’sal-Maʿārifal-ʿaqliyya,seeCabanelas,“UnopusculoinéditodeAlgazel:Ellibrolelasintuiconesintelectuales.”

(35).Al-Ghazālī,Iḥyāʾ,4:318.17–18/2513.9–10.Cf.ibid.,4:323.14/2520.4;4:307.17–22/2497.21–2498.3.

Page 24: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 24 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

(36).Ibid.,1:124.paenult./156.7;1:148.16/189.1;Tibawi,“Al-Ghazālī’sSojourn,”85.6,105.

(37).Frank,Creation,18.Thetermappearsnumeroustimesinal-Ghazālī’sIḥyāʾ;see,e.g.,1:104.20/126.6;4:58.9/2151.peanult.;4:120.21/2237.4;4:136.11/2258.11;4:149.23/2277.16;4:321.4/2516.20;4:355.11–13/2565.6–8.Forthesynonymousmudabbiral-asbāb(“theonewhoorders[or:governsover]thecauses”),seeibid.,4:340.22/2545.23.Seealsoal-Ghazālī’sTahāfut,65.4/38.22,182.9/107.19;andal-Maqṣad,116.13.IntheMunqidh,49.20,al-GhazālīreferstoGodasthemuqallibal-qulūb,“theonewhochangesthehearts,”meaningtheonewhodeterminespeople’sopinionsandmoods.

(38).FortheAvicennanbackgroundofmusabbibal-asbāb,seeJanssens,“FilosofischeElementenindemystiekeLeer,”341–42;andFrank,Creation,18.ThetermappearsatleasttwiceinworksofIbnSīnā,inal-Ḥikmaal-ʿarshiyya,9.7,andal-Shifāʾ,al-Ilāhiyyāt,2.16.Basedonaclosestudyofthemanuscriptevidence,Bertolacci,ReceptionofAristote’sMetaphysics,489,rejectsthereadingofmusabbibal-asbābinIbnSīnā’sal-Shifāʾ,Ilāhiyyāt,2.16,andcorrectsittosababal-asbāb.TheLatintranslationconfirmsthisandtranslatescausacausarum(IbnSīnā,Avicennalatinus.Liberdephilosophiaprima,1:3.2).Asimilarcorrectionmightbenecessaryforthepoorlyeditedal-Ḥikmaal-ʿarshiyya.Al-Juwaynī,al-Irshād,235.3–4,reportsthatthephilosopherssayGodisthesababal-asbāb.InhisTahāfut,102.4/59.10,al-Ghazālīreportsroughlythesame(cf.alsoibid.,97.1/56.2).Itispossiblethatal-Ghazālī’sprominentuseofmusabbibhadaninfluenceontheAvicennanmanuscripttraditionandpromptedsomecopyiststochangetheoriginalAvicennansababtomusabbib.

(39).Al-Makkī,Qūtal-qulūb,1:209.8;2:11.9;GermantranslationinGramich,DieNahrungderHerzen,2:97,317;seeFrank,Creation,18.Al-Ghazālī’sstrategyofcombiningacausalistviewofeventsinthisworldwithapossibleoccasionalistperspectiveonGod’sactionsseemstogobacktoal-Makkī;seeforexamplehischapteronasbābandwasāʾiṭinQūtal-qulūb,2:10–15;GermantranslationinGramlich,DieNahrungderHerzen,2:315–29.

(40).musabbibul-asbābiajrāsunnatahubi-rabṭil-musabbabātibi-l-asbābiiẓhāranli-l-ḥikma;al-Ghazālī,Iḥyāʾ,4:355.3/2564.16–17.

(41).Ibid.4:307.20/2498.2.TheusageoftheverbsakhkharaisQur’anic;seeforexampleQ13:2,16:14.

(42).Al-Ghazālī,Iḥyāʾ,4:111.11/2224.3–4.

(43).Ibid.4:111.12–15/2224.5–8.Ḥalabī’seditionhasmūjidinsteadofmūjib.

(44).IbnSīnā,al-Ishārātwa-l-tanbīhāt,188.17–19.Cf.Marmura,“DivineOmniscience,”91–92.Abrahamov,“IbnSīnā’sInfluenceonal-Ghazālī’sNon-PhilosophicalWorks,”14–16,dealswithIbnSīnā’sinfluenceonsomeofal-Ghazālī’sviewsaboutrewardinthe

Page 25: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 25 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

hereafter.

(45).Al-Ghazālī,al-Maqṣadal-asnā,98.4–6.

(46).bal[huwa]mumahhidusharṭil-ḥuṣūlli-ghayrihi.

(47).Al-Ghazālī,Iḥyāʾ,4:111.23–112.3/2224.19–ult.Cf.Frank,Creation,26.

(48).Onal-Ghazālī’sunderstandingofjawhar—whichdoesnotconcurwiththeearlierAshʿarites’understandingofjawharasanatom—seeFrank,Al-GhazālīandtheAshʿariteSchool,48–67.

(49).Al-Ghazālī,Iḥyāʾ,4:112.11–12/2225.9–10.Ontheḥadīth,seeal-Bukhārī,al-Ṣahīh,jihād,144;andWensinck,Concordance,2:501a.

(50).Al-Ghazālī,Iḥyāʾ,4:317.17–20/2511.paenult–2512.1;al-rāsikhūnafī-l-ʿilmistakenfromQ3:7inwhich—accordingtoal-Ghazālī’sinterpretationofthisverse—those“deeplyrootedinknowledge”areidentifiedasthescholarswhoknowthemeaningofdifficultpassagesfromrevelation.Onal-Ghazālī’sunderstandingofQ3:7,seeGriffel,ApostasieundToleranz,448.

(51).Al-Ghazālī,Iḥyāʾ,4:317.20–25/2512.3–6.Seeal-Zabīdī,Itḥāfal-sāda,9:423.20–26,wholacksthewordazaliyyainthethirdsentence.

(52).Gramlich,Muḥammadal-ĠazzālīsLehre,542–43.

(53).Al-Isfarāʾīnī,“al-ʿAqīda,”168,fragm.94.Cf.al-Ghazālī,al-Maqṣad,105.17:“Godarrangesthem(scil.allthings)intheirappropriateplacesandtherebyHeisjust(ʿadl).”SeeFrank,Creation,64–65,andparticularly56–57,wherehediscussesthemeaningofḥaqqinaverysimilarpassagetotheonewearelookingat.Onḥaqq,cf.apassageinal-Ghazālī,al-Iqtiṣād,102.2–3,ontherelationshipbetweenGod’swillandhisforeknowledge:“Thedivineforeknowledgeistrueto(ḥaqqaal-ʿilm)[thedecisionofthedivinewill]andcontainsthemastheyare.”

(54).Seeabovepp.141–43.

(55).Al-Ghazālī,Maqāṣidal-falāsifa,2:82.paenult.–85.2/236.24–239.3;MSLondon,Or.3126,foll.237b–240a.ThetextinMaqāṣidisafreeadaptationofIbnSīnā,Dānishnāmah-yiʿAlāʾ-i,Ilāhiyyāt,95–97,thatillustratesIbnSīnā’steachingswithoriginalexamples.FortheAvicennantextsusedinthepassageoftheLondonMS,seeGriffel,“MSLondon,BritishLibrary,Or.3126:AnUnknownWork,”15.

(56).Al-Ghazālī,MSLondon,Or.3126,foll.238a.8–238b.9.

(57).IbnSīnā,al-Shifāʾ,al-Ilāhiyyāt,339.4–8;al-Najāt,284.12–13/668.14–16,quotedinal-Ghazālī,MSLondonOr.3126,fol.238a.5–8.

(58).Al-Juwaynī,al-Shāmil(ed.Alexandria),621.21–22and622.3–8(withtheexample—

Page 26: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 26 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

alsousedbyal-Ghazālī—thatawell-writtenmanuscriptgivesnecessaryevidencetotheskillsofthescribe);al-Makkī,Qūtal-qulūb,2:35–36.ThemotifthatGod’screationisskillfullyarrangedgoesbacktotheQur’an,inwhichinvariouscontextsitsaysthatGod’screationcontains“signs(āyāt)forthosewhocanunderstand.”TheideathatcertaindivineattributesshowinHiscreationisalsoQur’anic.TheusualproofforGod’sonenessandunityinkalāmliteratureisbymutualhindrance(tamānuʿ).ItappearsalreadyinQ23:91,17:42–3:Becausethiscreationshowsnosignsoftheactivityofmorethanonedivinecreativeforce,whichwouldnecessarilycompetewithandhinderoneanother,thereisonlyoneGod.SeealsothestoryofAbraham’sconversiontomonotheisminQ6:75–79,discussedbelow.

(59).Kukkonen,“Plentitude,Possibility,andtheLimitsofReason,”545–46;Davidson,Proofs,226–27,234;Goodman,“Ghazâlî’sArgumentfromCreation,”69.Onargumentsfromdesigninthethirty-secondbookoftheIḥyāʾ,seevandenBergh,“Ghazalion‘GratitudeTowardsGod,’”86–88,97–98.

(60).Al-Ghazālī,al-Iqtiṣād,99–100.

(61).Ormsby,TheodicyinIslamicThought,37,75.Foradiscussionofal-Ghazālī’sposition,seeibid.,39–74;Frank,Creation,60–66;andidem,Al-GhazālīandtheAshʿariteSchool,20–21.

(62).ThedebateisdocumentedandanalyzedinOrmsby,TheodicyinIslamicThought,92–265,andal-Zabīdī,Itḥāfal-sāda,9:434–60.

(63).Al-Ghazālī,Iḥyāʾ,4:322.1–3/2518.5–8;EnglishtranslationinOrmsby,TheodicyinIslamicThought,40–41.Cf.al-Zabīdī,Itḥāfal-sāda,9:433.ThesewordsseemtobeinspiredbythebeginningparagraphofIbnSīnā’sRisālaFīsirral-qadar,inwhichallelementsinal-Ghazālī’spassage(theobscurityofthematter,thedeepsea,theprohibitiontoteachittotheʿāmma)alsoappear.SeethetextoftheRisālaFīsirral-qadarinHourani,“IbnSīnā’s‘EssayontheSecretofDestiny,’”27–31;andinʿāṣi,al-Tafsīral-Qurʾānī,302–5.

(64).Al-Ghazālī,al-Imlāʾfīishkālātal-Iḥyāʾ,50–51/3083–85;MSYale,Landberg428,pp.55–56.ForanEnglishsynopsisofthispassage,seeOrmsby,TheodicyinIslamicThought,75–81.Theavailableeditionsofal-Imlāʾfīishkālātal-Iḥyāʾ,printedattheendoronthemarginsofmanyeditionsoftheIḥyāʾʿulūmal-dīnandonthemarginsofal-Zabīdī,Itḥāfal-sāda,1:192–204,areofverypoorquality,withsometextualpassages(likelysomelinesintheunderlyingmanuscript)missing.Theyalsorepresentarecensionofthetextthatisnotoriginal.Inthisrecension,theorderofthefuṣūldoesnotmatchthedescriptionofthecontentsgivenbyal-Ghazālīatthebeginningoftheworkonpp.19–20/3038–39.AmoreoriginalrecensionandamuchbettertextisavailableinmanuscriptssuchasMSYale,Landberg428(onceownedbyal-Murṭadāal-Zabīdī),and,withslightvariationsintheorderofthetext,MSBerlin,PetermannII545(Ahlwardt1714).

(65).Onal-Makkī’sQūtal-qulūb,seetheveryhelpfulGermantranslationbyRichard

Page 27: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 27 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

Gramlich,DieNahrungderHerzen,whichincludesnotesandananalyticalindex.

(66).Seeabovep.222.

(67).Al-Ghazālī,Iḥyāʾ,4:321.1–16/2516.17–2517.13.EnglishtranslationinOrmsby,TheodicyinIslamicThought,38–39.

(68).Al-Makkī,Qūtal-qulūb,2:35–36.Cf.Ormsby,TheodicyinIslamicThought,41,45,81.

(69).Al-Makkī,Qūtal-qulūb,2:35.paenult.–ult.EnglishtranslationinOrmsby,Theodicy,58;GermantranslationinGramlich,DieNahrungderHerzen,2:396;andidem,Muḥammadal-Ġazzālī’sLehre,549.

(70).wa-laysafī-l-imkāniaṣlanaḥsanuminhuwa-lāatammawa-lāakmala;al-Ghazālī,Iḥyāʾ,4:321.16–18/2517.13–16.Cf.al-Zabīdī,Itḥāfal-sāda,9:430.18–26.SeetheEnglishtranslationinOrmsby,TheodicyinIslamicThought,39.

(71).Al-Ghazālī,Iḥyāʾ,3:73.10–13/1446–47.

(72).Al-Ghazālī,Iḥyāʾ,4:321.20–26/2517.18–2518.2.SeetheEnglishtranslationinOrmsby,TheodicyinIslamicThought,40,andhiscommentaryonpp.64–69.

(73).Ormsby,TheodicyinIslamicThought,257.

(74).IbnSīnā,al-Ishārātwa-l-tanbīhāt,186.5–6.Ormsby,TheodicyinIslamicThought,257,saysthataccordingtoIbnSīnā,harmappearsaccidentalwhengoodiscreated.Thisis,however,amisunderstandingthatseemstobebasedonIbnSīnā’swordinginal-Ishārāt,186.1and187.1–3.Frank,Creation,61,sharesthismisunderstanding.Creatinggood,however,necessarilyrequiresthecreationofharm.

(75).IbnSīnā,al-Ishārātwa-l-tanbīhāt,185–87.OnIbnSīnā’steachingsonharmorevil(sharr),seeSteel,“AvicennaandThomasAquinasonEvil,”173–86.

(76).IbnSīnā,al-Shifāʾ,al-Ilāhiyyāt,342.4–5.Steel,“AvicennaandThomasAquinasonEvil,”179–81.

(77).IbnSīnā,al-Shifāʾ,al-Ilāhiyyāt,340.11;idem,al-Najāt,285.11/670.17.Steel,“AvicennaandThomasAquinasonEvil,”174–77.Thisseemstobeapremisenotsharedbyal-Ghazālī.InhisImlāʾ,50.10–11/3083.20–21;MSLandberg428,p.55.20,al-Ghazālīcounterstheobjectionthattheideaofthebestofallpossibleworldsisincompatiblewiththepositionoftheworld’screationintime.Hisbriefresponsemakessenseonlyifexistenceisnotregardedasbetterthannonexistence.Ontheapparentincompatibilityofthebestofallpossibleworldsandcreationintime,seeOrmsby,Theodicy,76–77;andFrank,Creation,66.

(78).IbnSīnā,al-Shifāʾ,al-Ilāhiyyāt,339.13–15;al-Najāt,284.18–19/669.9–10.

Page 28: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 28 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

(79).IbnSīnā,al-Shifāʾ,al-Ilāhiyyāt,341.8–10;al-Najāt,286.4–7/672.9–13.Thepositionthatspeciesareunaffectedbyharmdoesnotseemtohavebeensharedbyal-Ghazālī,whoconsidersthespeciesofbeasts(bahāʾim)harmful(Iḥyāʾ,4:321.24–25/2518.1).

(80).IbnSīnā,al-Shifāʾ,al-Ilāhiyyāt,341.8–9;al-Najāt,286.5/667.9–10.Cf.Aristotle,Metaphysics,1010a.25–30.

(81).Al-Ghazālī,Iḥyāʾ,4:124.21–125.2/2242.17–2243.2.Itisherethatal-Ghazālīsays:“Anignorantfriendisworsethananinsightfulfoe.”VandenBergh,“Ghazalion‘GratitudeTowardsGod,’”92,remarksthatal-Ghazālī“mayhavereadit”inKalīlawa-Dimna.VandenBergh’sarticlehasnoreferences,andasfarasIamaware,thereisnosuchsentenceinthatwork.

(82).Al-Ghazālī,al-Maqṣadal-asnā,68.1–5.

(83).Ibid.68.6–8.

(84).Ibid.68.15–16;69.15–16.Fortheḥadīth,seeal-Bukhārī,al-Ṣaḥiḥ,tawḥīd15,22,28,55;orMuslimibnal-Ḥajjāj,al-Ṣaḥīḥ,tawba14–16.Cf.Wensinck,Concordance,4:526a.

(85).Al-Ghazālī,MSYale,Landberg428,p.56.4–7.Intheprintedtextinal-Imlāʾ,50.16–18/3084.6–8,andinthemarginsofal-Zabīdī,Itḥāfal-sāda,1:201,thissentenceiscorrupted.SeealsothetranslationinOrmsby,Theodicy,78,basedonMSBerlin,PetermannII545,fol.16b.

(86).Al-Ghazālī,al-Imlāʾ,50.20–21/3083.10–11;idem,MSYale,Landberg428,p.56.9–10.Cf.thetextinthemarginsofal-Zabīdī,Itḥāfal-sāda,1:201.

(87).Al-Ghazālī,al-Imlāʾ,50.23–51.7/3084.14–3085.5.ThispassageisnotinMSYale,Landberg428.Itisthisreasoningthatlikelyliesbehindal-Ghazālī’sdecisiononlytowriteabouttheworld’sperfectionintwocomparativelybriefpassagesinhisIḥyāʾʿulūmal-dīnandinhisal-Imlāʾfīishkālātal-Iḥyāʾ.ThesubjectisnotexplicitlydiscussedinotherbooksoftheIḥyāʾcircle,suchasal-ArbaʿīnorKīmiyāʾ-yisaʿādat.Al-Ghazālī,however,alludestoitinTahāfutal-falāsifa,289.4–6/172.17;al-Iqtiṣād,165–66;al-Maqṣadal-asnāʾ,47.12–13,68.6–8,105–6,81.12–13,109.8–15,152.11–13;andprobablymanyotherpassagesofhisworks.

(88).Al-Ghazālī,al-Imlāʾ,50.13–16/3084.2–6.CorrectedaccordingtoMSYale,Landberg428,pp.55.ult.–56.4,whichvariesinthefollowingreadings:wa-l-yataḥaqqiqa;wa-annadhālikaʿalāghāyatil-ḥikma;andburhānanwāḍiḥan.

(89).Al-Ghazālī,Iḥyāʾ,4:317.ult.–318.4/2512.12–16.Cf.al-Zabīdī,Itḥāfal-sāda,9:423–24.ThispassageistranslatedanditslanguagediscussedinFrank,Creation,56–61.SeealsoGramlich’sGermantranslationinMuḥammadal-ĠazzālīsLehre.543.

(90).Seep.225.

Page 29: Oxford Scholarship Online Causes and Effects in The Revival of the Religious Sciences ·  · 2014-03-13Causes and Effects in The Revival of the Religious Sciences ... human action,

Causes and Effects in The Revival of the Religious Sciences

Page 29 of 29

PRINTED FROM OXFORD SCHOLARSHIP ONLINE (www.oxfordscholarship.com). (c) Copyright Oxford University Press, 2014.All Rights Reserved. Under the terms of the l icence agreement, an individual user may print out a PDF of a single chapter of amonograph in OSO for personal use (for details see http://www.oxfordscholarship.com/page/privacy-policy). Subscriber: University ofChicago; date: 13 March 2014

(91).Seep.228.

(92).Frank,Creation,55–63.

(93).Ibid.,69.

(94).Thisismostforcefullyexpressedinal-Ghazālī,Tahāfut,96–103/56–60;155–60/91–94.Seealsoabove,pp.184–85.

(95).Al-Ghazālī,Tahāfut,64.5–66.6/38.12–39.13.Logicallyimpossiblemeans“conjoiningnegationandaffirmation”(al-jamʿbaynal-nafīwa-l-ithbāt).

(96).Al-Ghazālī,Iḥyāʾ,1:148.16–18/189.1–3;Tibawi,“Al-Ghazālī’sSojoun,”85.6–7,105.Kukkonen,“PossibleWorlds,”480,concludesthatal-Ghazālī’sinnovationstothephilosophyofIbnSīnā“havetheirrootintheideaofGodfreelychoosing(arbitrating)betweenalternativesequaltohim.”

(97).Al-Ghazālī,al-Iqtiṣād,129–39.ThiscategorycametobeusedbytheNishapurianAshʿarites,mostprobablyinconsciousresponsetothefalāsifa’steachings.ʿAbdal-Qāhiral-Baghdādī’sUṣūlal-dīn,117–18,121–22,referstoagroupofdivinenamesthatarederivedfromGod’sessenceandtoasecondgroupthat“arederivedfromanattributethatHehasresidingwithinHim”(mushtaqqminṣifalahuqāʾimatanbihi).AthirdgroupisderivedfromGod’sactions.Onal-Baghdādī’sdivision,seeGimaret,LesnomsdivinsenIslam,107–8.IbnSīnāalreadyreferstothisconceptandsaysinal-Ḥikmaal-ʿarshiyya,9.9,thatGod’sknowledgeisnotzaʾidʿalāl-dhāt.Onal-Ghazālī’sconceptionofthedivineattributes,seeFrank,Creation,47–52.

(98).ghayrumaqdūrinʿalāmaʿnāannawujūdahuyuʾaddīilāstiḥāla;al-Ghazālī,al-Iqtiṣād,85.8–86.4.Marmura,“Ghazali’sChapteronDivinePower,”301–2.Onthissenseofnecessityinal-Ghazālī,seeKukkonen,“CausalityandCosmology,”41–42.

Accessbroughttoyouby: UniversityofChicago