IMT Placement Brochure 2011

1

PerfectionPolished to

Placements Brochure 2011

PGDm eXecutIVe

2

message from Director 02

message from head - corporate relations 03

about Imt 04

life @ Imt 07

committees at Imt 08

activities and events 09

about PGDm executive 12

course curriculum 13

International linkages 14

Faculty 16

Past recruiters 19

alumni speak 20

Industry speak 21

Industry Interface 22

Batch Profile 23

Student Profile Index 26

Student Individual Profiles 28

convocation at Imt 54

PGDm (executive) Placement calendar 2011 55

Contents

“the kind of commitment found among the best performers across virtually every field is a single-minded passion for what they do, an unwavering desire for excellence in the way they think and the way they work.”

—Jim Collins

1

Mission• constantly strive for excellence

• Inculcate values and ethics

• Foster thought leadership

• Provide a conducive and enabling environment

for continuous learning, research, management

development, consulting and international partnerships

• constantly innovate the curriculum design delivery and

pedagogy

• collaborate with alumni, industry, social organizations

and international institutions for sustainable

development

• Provide the necessary facilities for running

entrepreneurship

Visioncreate socially

responsible global

business leaders

“Do not follow where the path may lead. Go instead where there is no path and leave a trail.”

—Harold R. McAlindon

2

Institute of management technology, Ghaziabad has carved a distinguished niche in

management education over its journey of more than 30 years. Its accomplished faculty in

symphony with quality students and efficient infrastructures has been consistently delivering

value and talent that justifies its ranking consistently among top B-Schools in India. IMT

ensures producing capable leaders who can sustain and grow in a rapidly changing

corporate environment.

When incisive education gets amalgamated with practical industry experiences of faculty

and students, it produces quality talent. our executive education is aimed at harnessing

the versatile experiences of students to accelerate their readiness for leadership positions

for the corporate world. our students are provided with diverse specializations in marketing,

Finance, operations, hr and systems to hone their skills in the areas of their interest. our

program is fashioned and refashioned on a continuous basis to befit the changing trends of

global work place and context.

over the last ten years, our executive students have proved their mettle in different functional

areas across the industries. their experience, blended with the trained ability to be astute in

decision making made them outstanding achievers over the years.

I extend a hearty welcome to you to visit our institute and interact with the students. I am sure

you will appreciate meeting a group of driven leaders who are innovative in their thought and

committed and pragmatic in their approach towards implementation.

Dr. Bibek Banerjee

Message froM DireCtor

3

Imt Ghaziabad is recognized as the front runner in Business education countrywide and

the executive PGDm program, which is now in the eleventh year of its operation, is one of

the most coveted and sought after full time residential executive management program. the

response of the companies for participation in the Placement Process has been overwhelming

which proves the continued faith and patronage of the corporate world in this accelerated

management program from IMT. It also confirms the robustness of IMT’s academic processes

and quality of PGDm (executive) student managers. one of the highlighting points about the

program is the fact that the course curriculum is regularly updated to cater to the dynamic

business environment. this, coupled with our experienced faculty and pedagogy, has

ensured that our students are transformed into business leaders. the education delivery

process for the PGDm executive program is a combination of classroom lectures, Project

work with presentation, workshops and quizzes. Further to this, the students participate in

different committees and events that provide holistic growth to the students.

the students in this program are having experience in different business verticals and are

now trained in various functions of management. With these enhancements, they are ready

to join back the industry and prove their mettle.

I invite you to participate in Imt PGDm (executive) placements 2011 for your lateral

requirements and we are confident that the candidates will exceed your expectations.

We look forward to host you at our campus.

Prakash Pathak

Message froM HeaD-Corporate relations

4

Institute of management technology, established in 1980, strongly believes

in the philosophy of nurturing and developing the best of managerial talent.

With this belief the institute has consistently endeavoured to promote

excellence in academics, research, international relations, consulting and

executive development enriched by superior industry interface.

the Imt family has now grown to three campuses – in addition to campuses

in Ghaziabad and Nagpur, IMT has started its first international campus in

Dubai in 2006 to offer mBa Program. Imt has been consistently ranked

among the top management institutes in the country. the institute is

strategically located in Ghaziabad, near the national capital with a lush

green campus and an infrastructure ranked among the best in the country.

Infrastructure, both in terms of technology and educational aids is among the

best in the country. the Imt library and the computer center are equipped

with the latest technologies that provide round-the-clock-access to various

educational repositories and journals from around the globe.

The faculty, eminent in its field of expertise, includes highly experienced

professionals from various industries like automotive, FmcG and It in

addition to accomplished academicians from all fields of study. IMT’s

academic curriculum and pedagogy is in sync with the requirements of

the industry. The success of the past inspires confidence in the future. The

consistent 100% placements across a wide variety of domains and sectors

underline the confidence that corporate India has reposed in IMT as a

breeding ground for future leaders.

about iMt

• 30 Years of glorious history

• excellent International linkages

• state-of-the-art Infrastructure

• excellent Faculty

• consistent 100% Placement

iMt ranKing 2010

name of the Magazine

rank

Business India survey

9th in the survey of november and 1st in International relations

oPen c-fore survey

3rd in Private school category

outlook survey5th best private B-school

csr-GhrDc survey

7th in super league

Indian management survey

overall - 7th

5

it infrastruCture

Imt has a fully networked campus with around 1200 nodes

connected with a backbone of 10 gbps fiber connectivity with multi

layer, high end cIsco campus wide network. Imt has 8 mbps (2*4)

metro ethernet connectivity which can be upgraded to 100 mbps

on demand. Imt has 13 enterprise level servers to support domain

service, security and storage service. the server room is designed

as per International standards. each faculty member is now

equipped with high end laptops and dedicated laser printers. entire

main building, library, mDrc building and hostels are equipped with

wi-fi networks. The Institute provides 24*7 connectivity @ 128 kbps

per node to each student at no additional charge. each faculty,

student and alumnus is provided with an official email account that is accessible anywhere. Computer labs and classrooms are

equipped with high end projectors and latest teaching aids. academic alliance with IBm, cisco and microsoft enables us to provide

world –class technology education. In near future, the Institute plans to implement video conferencing, advance level security solutions,

It policy and enterprise-level backup and storage solutions.

the campus boasts of tree-lined walk-ways, spacious lawns

and playing fields, a well designed amphitheater, well-equipped

air-conditioned classrooms and offices. The world-class

infrastructure includes a modern auditorium, a well stocked library

and computer centre functioning round-the-clock, executive

dining hall/mess, canteen, banking and postal services. the well

connected campus provides comfortable hostel accommodation

for more than 800 students.

library & inforMation serViCes

the library operates in a fully automated environment. the library

is using integrated library automation software libsys, capable

of working in integrated multi-user and network environment.

open round the clock, the library offers students a rich resource

of books, project reports, annual reports, bound volumes of

journals, cDs, audio- Video as well as subscriptions to over 185

print periodicals with online databases.

CaMpus intranet

the campus network design consists of high speed multi -

services enabled network Infrastructure; converged network

with integrated Voice, Video, and Data; secured and Fast Internet

access; remote access capability for network users; Voice over

IP telephony and IP based Video conferencing facilities.

infrastruCture

6

7

the full time courses at Imt are compulsorily residential.

thus, the interaction between the students from various

parts of the country in itself provides valuable educational

inputs.

the campus is spread over more than 14 acres of sprawling

lush green lawns and provides an ambient atmosphere

most conducive to learning. learning beyond the classroom

is extended to an amphitheater on campus, which is set

amidst a botanical garden. Facilities have been provided for

a wide variety of indoor and outdoor games to keep students

physically and mentally fit.

to develop entrepreneurship and decision-making skills,

along with team spirit amongst students, at Imt, the students

are encouraged to participate in a wide spectrum of activities.

apart from that there are several annual business and sports

events which are conducted regularly on year-on-year basis.

life @ iMt

8

the annual committees and various specialized forums which

are part of IMT’s culture are listed below:

CoMMittees

alumni relations committee

cultural committee

media committee

mess committee

Placement committee

sports committee

speCializeD foruMs

Mark-up – a marketing forum which keeps conducting events

and publishes an e-magazine inviting discussions from industry,

latest happenings, case studies and presentations.

fin niche – a Finance forum which conducts quizzes, seminars

and simulated stock market games along with publishing an

e-magazine.

opus – an operations forum which organizes inter B-school

events on different operational verticals and interfaces with

industry for latest happenings.

MaDf – a make a Difference society for creating social awareness

amongst students and has tie-ups with renowned nGos.

globiz – an international business club and exposes students to

the nuances of international business through business games,

industry interface and journals.

summit – It is a system management club set up with a vision of

creating awareness about Information systems.

raCe – research and consultancy enterprise, a student run

organization which provides quality business solutions to the

client under the mentorship of esteemed Imt faculty.

entrepreneurship Cell – Its vision is to develop, support and

deliver the entrepreneur spirit among students.

CoMMittees at iMt

e-cell committee

alumni committee

media committee

9

“Chakravyuh” – a 72 hour non-stop annual Inter B-school sports festival, held in February every year. We conduct various inter and intra B-school sports tournaments ranging from Football, cricket, Badminton and Volleyball to Basketball, table tennis and virtual games. It is one of the most awaited and strongly contested inter B-school event in the country.

passion – the annual management cum cultural festival of Imt Ghaziabad. It is a holistic event that continues non-stop for a period of 3 days. It is a memorable experience for participants as it opens new vistas of knowledge and ideas.

eVents exClusiVely for pgDM (exeCutiVe)

Connexions - conneXions is a business conclave that builds an interface between the executive students and the industry. eminent leaders and strategists are invited to discuss pertinent issues relating to the fields of Marketing, Finance, Human resources and Information technology & operations.

symposium - the event focuses on discussion between eminent personalities from corporate world on contemporary issues.

round table Conference (rtC) – Prominent personalities of the corporate world are invited to discuss and analyse either the issues pertaining to their industry or contemporary issues.

aCtiVities & eVents

10

class of 2011

10

1111

12

• approved by aIcte.

• 15 months duration - 12 months full time residential and 3

months field based dissertation.

• an accelerated program designed to develop Business

ready leaders.

• aspiring, talented and dedicated managers with a strong

inner drive to excel as leaders.

• strong focus on analytical and problem-solving pedagogy.

• learning through group & case based approach.

• Bachelor’s Degree in any discipline with at least 50%

marks.

• minimum 5 years of work experience at executive/

managerial level.

• latest Gmat/cat score or all India level Imt entrance

test conducted in seven major cities across India

• Followed by group discussion & personal interview.

tHe prograMMe

PGDm (executive) is a 15 months course aimed at honing the

skills of middle-level managers. In addition to being one of the

most coveted executive management courses, it also serves

as a launch pad for a fast track career. along with a rigorous

academic curriculum, the course lays a great emphasis on

exposing students to top management interactions via round

table meets, guest lectures, and short term projects.

seleCtion Criteria

Imt has one of the most rigorous selection processes for

selecting candidates from all over the country, for its niche

PGDm –executive program.

PGDm (executive) candidates are short listed for group

discussion and interview on the basis of their latest Gmat/cat

score or all India level Imt entrance test conducted in seven

major cities across India.

Past work experience, academic performance and extra

curricular achievements are vital in the selection process.

the candidates are also evaluated for leadership potential,

management capability, through group discussion and

personal interview.

about pgDM exeCutiVe

13

Term I Term 2 Term 3 Term 4

Business Statistics Business Ethics Strategic Management International Business

Financial Accounting for Managers Business Research Method Business Environment Elective 1

Legal Aspects of Business Human Resource Management Elective 1 Elective 2

Managerial Economics Macro Economics: Principles & Policies

Elective 2 Elective 3

Marketing Management Management Accounting & Control Elective 3 Elective 4

Organizational Behaviour Management Information System Elective 4 Elective 5

Financial Management Operations Management Elective 5 Term 5

Dissertation

markeTIng FInance Human resource managemenT

Business to Business Marketing Commercial Banking Compensation & Reward Management

Consumer Behaviour Derivatives Management Competency Mapping & Assessment Centers

Customer Relationship Management Financial Econometrics Conflict & Negotiation

Distribution Management Financial Institutions and Markets Cross-cultural Skills for Global Managers

Export Management Financial Services Effective Talent Acquisition

Integrated Marketing CommunicationFinancial Statement Analysis & Business Valuation

Human Resource Planning & Staffing

International Marketing Fixed Income Securities Industrial Relations

Internet Marketing Infrastructure & Real Estate Finance Labour Laws

Marketing of Financial Services International Accounting Management of Discipline & Grievances

Marketing of Services International Finance Measurement in HR

Marketing Research Mergers, Acquisitions & Corporate Restructuring Organization Change & Development

Marketing Strategy Project Appraisal and Financing Performance Management

New Product Development & Marketing of Innovations

Security Analysis & Portfolio ManagementPsychological Testing

Product Management Strategic Corporate Finance Strategic HRM

Retail Marketing Strategic Cost Management Stress Management & Personal Growth Lab

Rural Marketing Treasury Management Training & Development

Sales Management Working Capital Management

Strategic Brand Management

Strategic Games in Marketing

InFormaTIon TecHnology managemenT operaTIons managemenT economIc & envIronmenT managemenT

Business & IT Consulting Advance Decision Analysis Business Strategies in Emerging Markets

Business Information Analysis & Design Business Process Re-engineering Entrepreneurship Management

Business Intelligence(Data Mining & Warehousing)

Operations StrategyGeopolitics & the World System: Intl. Structure & Relations

Business Modeling Through System Dynamics Project Management Global Competitive Dynamics & Strategy

E-Business Service Operations Management International Trade Laws

Enterprise Resource Planning Supply Chain Management Laws and Corporate Governance

Information Systems Audit Supply Chain Modeling Managing Innovation & Creativity

IT Applications in Verticals Technology Management Public Policy & Strategic Analysis

IT Service Operations & Vendor Management Total Quality Management Strategic Leadership

Knowledge Management & Collaboration Systems

Software Project Management

Software Quality Assurance

Strategic Information Systems

Course CurriCuluM

eleCtiVes

14

our partner institute

Deakin University Australia

University of Newcastle Australia

Fachhochschule Vorarlberg, University of Applied Sciences

Austria

FH Kufstein Tirol University of Applied Sciences

Austria

The Vrije Universiteit Brussel Belgium

ICHEC Business Management School, Brussel

Belgium

The COPPEAD Graduate School of Business

Brazil

Faculdades Ibmec Brazil

HEC Montréal Canada

University of Saskatchewan Canada

Zagreb School of Economics and Management

Croatia

Aarhus School of Business Denmark

IDE Business School Ecuador

ESCP-EAP, European School of Management

Europe

Imt has been ranked 1st in India in terms of number of international linkages & student exchange programmes. With the world

becoming a global village, the paradigm of excellence has got a new shift. Strategic alliances for operational efficiency is fast becoming

the tool of competitive advantage. Imt recognizes the importance of academic collaboration with business schools of other continents

for global exposure in the field of teaching, research and consultancy for development of management profession.

international linKages

Toulouse Business School, Groupe ESC Toulouse

France

Universite Paris Dauphine France

ESC Rennes School of Business France

Audencia Ecole De Management France

Grenoble Ecole de Management France

IESEG School of Management France

Euromed Marseille Ecole de Management

France

Reims Management School France

Normandy Business School France

Negocia Business School France

Burgundy School of Business France

Paris Graduate School of Management

France

Rouen Business School France

FH-Offenburg University Germany

15

Reykjavik University, Iceland Iceland

Waterford Institute of Technology Ireland

University of Milano-Bicocca Italy

“KIMEP (Kazakhstan Institute of Management, Economics and Strategic Research) “

Kazakhstan

University of Liechtenstein Liechtenstein

Universidad de Monterrey Mexico

IPADE Business School, Universidad Panamericana

Mexico

Universidad Latina De America, Morelia

Mexico

Fontys University of Applied Sciences

Netherlands

BI Norwegian School of Management

Norway

Skarbek Graduate School of Business Economics

Poland

University of Warsaw Poland

University of Stellenbosch South Africa

Chonnam National University South Korea

University of Sevilla Spain

National Taiwan University Taiwan

National Chung Hsing University Taiwan

University of Kasetsart Thailand

Essex Business School UK

The Business School, London Metropolitan University

UK

University of Northampton UK

The University of Greenwich UK

Nottingham Trent University UK

George Mason University, Virginia

USA

North Dakota State University, Fargo

USA

University of Florida, Gainesville USA

University of Nebraska, Omaha USA

The University of Wisconsin USA

16

the Imt Faculty members are well-known for their academic & research contributions both in India & abroad, especially in academic fields of Information Systems, Finance, Marketing, Human resources, operations and economic Development & strategy, and share among themselves a wealth of industry experience.

eConoMiC enVironMent & strategy

Dr. Deepak Kapur(on leave) ma, ranchi university, 1968 l llB, ranchi university, 1970 l PGPm, IIm-c 1966

Dr. sadananda prusty Ph.D., univ. of mysore, 2001 l m. Phil., Jnu, 1994

Dr. Vijay prakash ojha Ph.D., university of Delhi, 1997 l ma, Fms, Delhi university, 1977

Dr. Debabrata Datta Ph.D., calcutta university, 2008 l ma, Burdwan university, 1977

Dr. rakesh Chopra Ph.D., mumbai university, 2007 l mBa, Jamnalal Bajaj Instt. of mgmt., 2002 l m. sc., madras university, 1980

Dr. subhajit bhattacharya Ph.D., Indira Gandhi Instt. of Dev. res., 2001 l m. sc., Kalyani univ., 1987

Dr. raghavendra g. rao Ph.D., university of Brussele, Belgium, 1997 l ms, university of Brussele, Belgium, 1991

Dr. ranjana agarwal Ph.D., Jnu, 2000 l m. Phil., Jnu, 1995 l ma, Bhu, 1991

Ms. shalini rahul tiwari Pursuing FPm, mDI, Gurgaon since 2004 l mBa, sPJ Instt. of mgmt. & economics, agra university, 1995 l m. sc. (organic chemistry) agra univ. 1993

finanCe

Dr. santanu Kumar ganguli Ph.D., Vidyasagar university, 2006 l Fellow of IcaI, 1989 l B. com., univ. of calcutta, 1979

Dr. prateechi agrawal Ph.D., ccs university, 2008 l ca, IcaI, 1988 l B. sc., agra university, 1984

prof. girish Chandra tripathi Pursuing Ph.D., IIt Delhi l mFm, Jamnalal Bajaj Instt. 1996 l m. tech., IIt Delhi, 1991

Dr. sachin Choudhry Ph.D., Indore university, 2003 l mBa, aP university, 1981

Dr. barnali Chaklader Ph.D., Bundelkhand univ., 2005 l aIcWa, 1995 l ca, 1988

faCulty

17

Dr. ashish Varma Ph.D. ccs university, meerut, 2007 l FIcWa, 2010 l PGDBm, Fore school

Mr. pradip banerjee Pursuing Ph.D., utkal university l PGDFa, IcFaI, 2003 l m. com., calcutta university, 1999

Ms. puja aggarwal ca, 2002 l m. com. Delhi university, 2002

Hr & business CoMMuniCation

prof. b.D. singh ma, ranchi university, 1968 l llB, ranchi university, 1970 l PGPm, IIm-c 1966

Dr. nina Jacob Ph.D., Gujarat university, 1990 l master of Pub. administration, carleton university, canada, 1980 l ma (economics), Bombay university, 1978

Dr. amitabh Deo Kodwani Ph.D., Barkathullah univ. 2000 l master of P.m., Barkatulla univ., 1995

Dr. seeta gupta Ph.D., Delhi university, 1992 l m. Phil., Delhi univ., 1979 l ma, Delhi univ., 1977

Dr. bindu gupta Ph.D., IIt Kanpur, 1998 l ma, ccs university, 1990

Dr. rakesh Kumar agrawal Ph.D., IIt roorkee, 2003 l m. tech., IIt Delhi, 1996 l B. tech., IIt Bombay, 1993

Dr. sanjay Kumar singh Ph.D., university of Delhi, 2002 l ma, university of Delhi, 1993

Dr. shalini Kalia Ph.D., Gurukul Kangri Vishwavidyalaya, hardwar, 2003 l ma, ch. charan singh univ., meerut, 1999

Dr. bhavna bhalla Ph.D., IIt Kanpur, 2010 l ma, lucknow university, 2002

Ms. lipi Das PGDBm, cme - aIma, 1999 l ma (history), Delhi university,

inforMation teCHnology

Dr. arun Mohan sherry(on deputation) Ph.D., 1992 l m. tech., IIt Kharagpur, 2000

Dr. surinder batra Ph.D., IIt Delhi, 1995 l mBa, Delhi university, 1980

Dr. poonam garg Ph.D., Banasthali Vidyapeeth, 2006 l mca, Banasthali Vidyapith, 1991

Dr. reema Khurana Ph.D., Shreemati Nathibai Damodar Thackersey Women’s University, Mumbai, 2009 l mca, Imt, Ghaziabad, 1992

Dr. Jayanthi ranjan Ph.D., Jamia millia Islamia, 2005 l mca, avinashilingam Deemed univ. 1996

Dr. susmi routray Ph.D. GGsIP university, 2009 l mca, Barkatullah univ., 1997

international business

Dr. rajiv ranjan thakur(on leave) Ph.D., Patna university, 1998 l mBa, IIt, Delhi, 2001 l ma, Patna university, 1994

Dr. alok pandey Ph.D., univ. of lucknow, 2001 l mIB, Banras hindu univ. 1995

Dr. rashmi Kumar aggarwal Ph.D., Punjab university, 2007 l llm, Punjab university, 2001 l llB, Punjab university, 1998

Dr. ratna Vadra Ph.D., aligarh muslim univ. 2006 l ma, aligarh muslim univ. 1999

Dr. V.J. sebastian Ph.D., IIt Bombay, 1999 l m.a., mG univ. Kerala, 1986

18

MarKeting ManageMent

Dr. bibek banerjeePh.D. in economics, 1994, Purdue university, Indiana, u.s.a. l m.s. in economics, 1990, Purdue university, Indiana, u.s.a. l B.sc. (honors) in economics, 1988, university of calcutta

Dr. Vinita sahay(on leave) Ph.D., csJm university, 2002 l ma (Gold medalist), csJm university, 1991

Dr. sanjeev prashar Ph.D., Kurukshetra univ., 2002 l mBa, Kurukshetra univ., 1990

prof. rajat gera Ph.D. (pursuing) l PGDrm, Instt. of rural mgmt., 1992 l B. tech., allahabad univ., 1988

prof. anand Khanna PGDBa, univ. of allahabad, 1974 l master of Bus. statistics, univ. of allahabad, 1973

Dr. omkumar Krishnan Ph.D., IIt, mumbai, 2004 l ma, Kerala university, 1993

Dr. Vimi Jham Ph.D., amu, aligarh, 2006 l mBa, Imt, Ghaziabad, 1994

prof. Kaushik Datta PGDm, IIm ahmedabad, 1993 l B.e., allahabad univ., 1987

Dr. sita Mishra Ph.D., Kurukshetra univ. 1995 l mBa, Kurukshetra unv. 1992

Dr. somnath Chakrabarti Ph.D., (thesis submitted) IIt Delhi, 2007 l mBa, oklahoma state univ. 1992

Mr. sandeep puri PGDm (eXe.), Imt, 2007 l PGDm, IGnou, 1999 l B. Pharm, amravati univ. 1991

Dr. bikram Jit rishi Ph.D., Punjabi university, 2007 l mBa, Punjabi univ., 2001 l B. com., Guru nanak Dev. univ., 1998

Dr. lubna nafees Ph.D. Jamia hamdard, 2008 l mBa, amu, aligarh, 1999

Dr. Dhiraj sharma Ph.D., Jiwaji university, Gwalior, 2009 l mBa, Jiwaji university, 1999

Dr. Harvinder singh Ph.D., BIt, mesra, 2010 l m. Phil. madurai Kamraj univ. l mBa, Guru nanak Dev univ., 1997

operations ManageMent

Dr. r.K. Chakraborty Ph.D., calcutta univ., 1982 l m. sc., calcutta univ., 1973

Dr. santanu roy Ph.D., IIt, Kharagpur, 2000 l ms, IIt Delhi, 1980

Dr. Vijay Kumar gupta Ph.D., IIt Delhi, 1992 l m. tech. Indl. engg., IIt Delhi, 1974 l B. sc. mech. engg., Delhi university, 1972

Dr. Mrinalini shah Ph.D., Kumaun university, 2007 l m. sc., mumaun university, 1995

Dr. gunjan Malhotra Ph.D., Devi ahilya univ. 2007 l m. Phil, Devi ahilya univ. 2003

Mr. Kunal K ganguly Pursuing Ph.D., IIt, Kharagpur l mBa, IIt, Kharagpur, 2001 l B. tech., national Institute of Foundry Forge tech., ranchi, 1995

Dr. roma Mitra Debnath Pursuing Ph.D., (thesis submitted) BIt mesra l m. Phil., Delhi university, 1997 l ma, university of Delhi, 1995

19

• 3m India limited

• abhijeet Group

• accenture

• adani Power limited

• adhunik Group

• adobe systems

• afcans Infrastructure limited

• alankit Group

• all e technologies (P) ltd

• angelique International limited

• asian Paints

• Barclays

• candila

• chinatrust commercial Bank

• cimmco Birla ltd

• columbia asia

• corporate consultants

• costa coffee

• cummins

• Danisco (India) Pvt ltd

• Darashaw

• Dell Perot systems

• Deloitte

• Development credit Bank

• Dhanlaxmi Bank ltd

• Dicitex Furnishing

• Dr.Reddy’s

• GDc India Pvt ltd

• Ge

• Genpact

• Glocaledge

• Godrej Infotech limited

• hcl

• hDFc Bank

• hDFc mutual Fund

• helix corporation

• hettitch India Pvt ltd

• hindustan times

• honeywell

• hsBc

• IBm

• IcIcI Bank

• Idea cellular

• IKea

• Il&Fs

• India Infoline

• Indiafin Technologies Ltd

• Infosys technologies ltd

• Infotech enterprises

• IsGec John thompson

• itrust Financial advisors Pvt ltd

• JP associates

• JP Group

• Karvy Group

• Kec International limited

• Kotak mahindra Group

• larsen & toubro limited

• lG electronics India

• malwa Industries limited

• milagrow

• mscI Barra

• neilsoft

• nerolac

• omam consultants Private limited

• Patni computer systems ltd

• Pepsico

• Plan India careers

• Protiviti

• religare enterprises ltd

• shriram Pistons & rings ltd

• siemens Group

• su-Kam

• syscom technology

• tata aIG General

• tcs

• technopak

• tesco hsc

• thomas cook

• trident Group

• uB Group

• usha shriram

• Vatika Group

• Welspun Group

• Wipro eco energy

• Wipro Infotech

• Yes Bank limited

and many more

past reCruiters

20

“the one thing one got to say about PGDm(executive) is that it has courses that is famous. the models of teaching are faboulous. It has alumni who come back and say it was the best thing they ever did”

Principal, saP labs India ltd

2004-05 Batch

“Very few schools provide such a well balanced curriculum for experienced professionals. the quality of talent, knowledge and experience is being recognized by the best companies across the globe”

sr. consultant, client Development - Gallup consulting

2006-07 Batch

“PGDm (executive) is highly effective program with people with work experience. the most important aspect of this course is peer learning,between experienced professional from different business verticals. this program helps student managers to experience and understand the business challenges faced by corporate and helps them to be groomed into effective leaders. the success of this program can be gauged by the entrepreneurs and corporate leaders produced by this program, over such a small time.”

manager Global accounts & Pricing – Xerox India limited

2007-08 Batch

“the entire proposition of the PGDm (executive) program is designed to suit the requirements of professionals to equip them for further growth. Its positioning as an accelerated

full time mBa is attractive as well as appropriate. PGDm (executive) course equips one with the right skill sets, but also gives the right recognition. today, I can proudly mention, that all my peers are extremely well placed, be it in organizations or as entrepreneurs.”

Deputy General manager, Godfrey Phillips India

1999-2000 Batch

“the value of the study group cannot be understated. In the executive world, collaboration and leadership skills are desired.the study group format at Imt PGDm(executive) has benefited me to hone these skills.”

Vice President-marketing, hsBc

class of 2000

“In today’s world a proactive approach to change leads to customization and the same applies to Business education. Imt Ghaziabad has always been one step ahead in taking this initiative through its super specialized program which has been designed to provide the students a launch pad for the corporate world. It is not only the students but also the corporate world which gets benefited by having students with a blend of experience and education. each year courses are modified which are based on scrupulous market research and corporate interaction. I feel proud and honored to be associated with Imt”

senior manager - Products.united healthcare India Pvt. ltd.class of 2009

aluMni speaK

21

these students bring a very mature practical mindset to the

understanding of business and its challenges and would be the

ideal experimental group to launch innovative initiatives in the

Indian business domain.”

Mr. r. J. MasilaManiPGDm (IIm-a)

ex-mD timex, India

“the students of the PGDm executive programme at Imt

Ghaziabad bring with them, a vast pool of industry knowledge

and experience. this program inculcates among the students,

the requisite skills to reach the top echelons of the corporate

world and to enhance their skills to suit the changing business

requirements as leaders. after interacting with them, I found

that they have a lot of potential to lead and make the best in the

dynamics of the global business world.”

Mr. sanDip gHoseregional Director (north)

rBI

“our growing economy has stupendous need of a powerful platform, where young managers can learn and relearn new art of managing and leading business entities in challenging environment. executive Post Graduate Diploma in management program conceived and delivered by Institute of management technology seeks to meet changing demands of 21st century industry.selection and academic rigor at Imt facilitates participants to link theory with practice; as well as it enables them to face real world with conviction.We have hired a few students of executive PGDm program; and we have found them focused and business oriented.”

V. p. singHexecutive Director-hr

rKJ Group

thanks for inviting me to a very knowledgeable gathering to address my thoughts on the subject as a guest speaker. It is a great pleasure and privilege to address my thoughts to an audience possessing rich and diverse experience in varied corporate houses. my interaction with the students during the course of session re-emphasized the position of institution as ‘centre of excellence in management education’. The quality and depth of knowledge among the participated students were of high standard. they are proactive and there exists a tremendous hunger in them to learn more. as every day is to learn, I have also enriched myself and learnt from the interaction with the students.my best wishes to all the students for their personal endeavor and professional career. I would also request every student to continue to be a good human being along with professional success. In journey ahead.

thanks and Best Wishes

aMit roychief audit & assurance at nIIt limited

inDustry speaK

22

the speakers of the event were

Mr aquil busraiceo aquil Busrai consultingFormer eD, human resources, IBm

Mr. CHanDer sabHarwalDirector, oBcmD, crop health Products ltd

Mr. aMit royhead hr, l&t- Faridabad, Delhi ncr

Mr. naVeen lutHraVP - strategic alliancesGetIt Infoservices

Mr. suresH tiwariFounder and ceo- corporate spectrum

Mr. roHit sinHacFo nIIt technologies

sMita sonDHihead csm- symbiotic

the theme of the summit was one of the most relevant topics for future managers, “turning strategies into results”, on which a

panel discussion was hosted. The esteemed panel included corporate honchos with rich diversified experience. The keynote

speaker to the event was mr. aquil Busrai, ceo –auil Busrai consulting & Former executive Director,IBm. In his speech Director,

Imt Ghaziabad-Dr. Bibek Banerjee emphasized on the need to distinguish between the mindset of planning and execution. he

cited the case of a batsman in cricket who has various strategies in mind while the bowler is running towards him but it is his

execution that fetches him maximum rewards and brings him to the record books. mr. Busrai reminded everyone of the stark

reality that in organizations, strategy goes hand in hand with seniority. though it is realistic to an extent but keeping the enthusiastic

minds at tactical and operational levels away from strategic decision making is about marginalizing them.

the house was mesmerized by the power talk of mr. sabharwal. he stated that the strategy to be adopted should be the one

whose present value of future returns is measurable and quantifiable. Strategy, according to him, is not a rocket science but a

bottom up approach of getting the fundamentals correct.

In sum, the conclave was an incredible value addition for the participating student managers. It enticed them to nurture strong

beliefs to be carried forward to the corporate arena. everyone appreciated the fact that planning coupled with meticulous execution

is the way forward for a falcon to move ahead, unperturbed.

Connexions 2011: turning strategies into results

23

l 25-27 years

l 27-29 years

l 29-34 years

l 35 & above

l Be/Btech

l commerce

l science

l mca

l others

l 5-6 years

l 6-7 years

l 7-8 years

l 8-10 years

l above 10 years

age profile

eDuCation baCKgrounD

experienCe profile

professional baCKgrounD

31%

48%

18%

3%

61%

19%

10%

7%

3%

76%

4%

8%

2%

10%

batCH profile

l agribusinessl automobilesl BFsIl chemicalsl educational servicesl FmcGl hospitalityl Industrial Design & automation

2%

8%

12%

4%

4%

2%

2%

3%

29%

12%

2%

2%

2%

2%

2%

10%

4%

l Itl It consultingl Itesl medial Pharmal Powerl retaill telecoml textile

24

25

stuDent profiles

26

stuDent profile inDex

naMe seCtorspeCialization

1speCialization

2worK

ex.page no.

aditya singh rawat FmcG marketing operations 6 Years 28

akhil Kumar sharma BFsI operations Finance 6 Years 28

amiya Kumareducational & training

servicesmarketing Finance 5.5 Years 29

ankur Girdhar It/telecom marketing Finance 5 Years 29

anshul Gupta Power marketing operations 5 Years 30

arunendra Pandey Pharma marketing Finance 5 Years 30

arunkumar G It Finance systems 5.5 Years 31

ashima Kakareducational & training

servicesmarketing Finance 6.7 Years 31

avinash Prasad It marketing systems 7.2 Years 32

B. Pranith raj It marketing systems 5.8 Years 32

Bhupinder singh media Finance operations 8 Years 33

Deepak sharmaIndustrial Design &

automationmarketing operations 5.8 Years 33

Dilip Kumar mallick It marketing Finance 7.3 Years 34

Gagan Bhatia BFsI marketing Finance 6 Years 34

Gaurav arora telecom marketing Finance 8 Years 35

himanshu shekhar Jha hospitality/Ites marketing Finance 7 Years 35

Jatin chandna BFsI marketing Finance 5.2 Years 36

Karthik Venkat It consulting Finance marketing 5 Years 36

mainak mitra automobile marketing operations 5 Years 37

manoj Yadav telecom marketing systems 7 Years 37

manpreet singh sran chemicals marketing Finance 5 Years 38

Devendra chaudhary Ites Finance operations 6 Years 38

mehul J.sudra retail marketing operations 8 Years 39

mohsin ali Khan It marketing Finance 5 Years 39

monideepa saha automobile operations Finance 5 Years 40

nitin Jain textile Finance operation 6 Years 40

27

naMe seCtorspeCialization

1speCialization

2worK

ex.page no.

nitish arora BFsI marketing Finance 6.6 Years 41

Parag Dabhade It consulting marketing Finance 6.5 Years 41

Pradipta Paul It consulting Finance marketing 7 Years 42

Prashant chaudhary It consulting marketing Finance 5 Years 42

Pritish mahajan It consulting operations Finance 7 Years 43

Priyabrata Banerjee telecom operations marketing 6 Years 43

r.Kathirvelmurugan chemicals marketing Finance 5.5 Years 44

rajesh Kumar Gupta It marketing Finance 5 Years 44

ravi Kumar automobile marketing operations 5 Years 45

roshan Kumar It Finance systems 5.5 Years 45

sachin Kumar tyagiIndustrial Design &

automationmarketing Finance 6 Years 46

sankha mandal agribusiness marketing Finance 7 Years 46

satyabrata Dash automobile operations marketing 5.5 Years 47

saurabh matta It marketing Finance 5 Years 47

shailender chauhan It marketing systems 11 Years 48

shishir singhal It marketing Finance 5 Years 48

siddharth Khetawat It Finance marketing 7.8 Years 49

sumit Kaul It/Ites marketing operations 5.5 Years 49

susanta Dey telecom marketing Finance 7 Years 50

swarnali Bose BFsI marketing Finance 5.5 Years 50

tapabrata Guha roy It/Power operations systems 6 Years 51

tribhuvan Kumar textile marketing operations 5 Years 51

udai singh BFsI marketing Finance 9 Years 52

Vishveshwar Pise It consulting marketing Finance 5.1 Years 52

Vivek Vinodkumar Bhola

It Finance systems 5.5 Years 53

Writankar Kundu It consulting Finance systems 5.2 Years 53

28

akhil Kumar sharma29 years

B.tech (It)I.P. university

specialization operations & Finance

CertificationamFI

PGDBO Certification (Banking)

software DevelopmentPmP training

6 years experience in Corporate retail banking. it development and domain knowledge of CrM

banking operations official - iCiCi bank pvt. ltd.• Performing daily branch banking operations of various types and dealing with branch

resources• Act as an interface between corporate clients and Bank• Assigning targets to the team and achieving them in time• Allocating resource to solve their day to day activity• Initiated Cross Team Skill building Exercise• Communication management with corporate clients

business analyst - Continental india ltd.• Responsible for the scoping, solution design & implementation of CRM modules• Conducted a Scope, Objective and Approach workshop for CRM• Developed presentations for workshop sessions. Have acquainted domain knowledge

of crm• Conducted User Requirements gathering and mapping sessions• Responsible for documenting the As-Is and To-Be business practices• Identified opportunities to re-engineer existing business process to accelerate ROI• Completed and Presented Re-engineered Business Processes to the Management

Keane india pvt. ltd.• Software Developer for Liberty Mutual and Goldman Sach Project

aditya singh rawat27 years

B.e. (mechanical)m.D. university

specialization marketing & operations

6 years of experience in sales & Marketing, Customer service

regional service officer (Delhi-nCr) - asian paints limited• Handling over 450 CW Dealers (including high value privilege club dealers & critical

retailers) for service function • Leading a team of 8 Engineers, to ensure trouble-free functioning of computer operated

tinting machines across Delhi - ncr• Mentoring and conducting sales force training for better performance in DTS sales• Arranging and managing different product meets for prospective dealers• Handling the supply chain aspects of tinting machine - requirement forecasting, timely

procurement, installation and maintenance• Focused market visits & market intelligence including visits to premium customers

while providing market feedback to the rms/Dso• Planning & implementing schedules for up gradation of various CW components• Handling database management & reporting including management of legal/other

documents viz. loan documents, service agreements, return m/c documents

engineer Marketing - international Coil limited• Handled detailed engineering and project planning, generating BOQ & tech sheet• Conducted site visit with customer with complete briefing of the product• Project execution as per the drawing, measurement and billing• Coordinated with the HVAC consultants, architects, dealers and contractors• Positioned and commissioned Vapour Absorption Machines, executed related piping

and insulation work

achievements• Phenomenalinnetworkexpansion.DoubledtheColour-WorldretailerpresenceinDelhi

NCRduringthetenure

29

ankur girdhar27 years

B.tech, computer science sikkim manipal university

specializationmarketing & Finance

international exposure8 months

over 5 years experience in project Management, software Design & Customer relationship Management.

senior software engineer (functional lead) – ericsson india (r&D)• Analyzed business requirements by coordinating with marketing division and managed

release & implementation planning• Served as a R&D single point of contact to deliver path breaking projects namely, Who

is calling for china mobile & GPrs tunneling Protocol for tIm Italy• Made implementation proposals & designed customer centric solutions• Acted as Agile coach for a geographically split team of 7 Software Designers &

streamlined time - effort estimation of customer requirements

software engineer – infosys technologies• Functioned as the Infosys-BelgaComm Associate (IBA) for the Provisioning System of

Belgacomm, Belgian national telecom operator• Participated in client engagement workshops for product portfolio enhancements and

for feasibility analysis• Significantly contributed to defect prevention and configuration management initiatives

software engineer – ushacomm india private limited• Member of design team to deliver IPTV solution for GhanaTel• Rendered effective support to the verification and quality teams

achievements• SuccessfullyintroducedtheReviewforEricsson(R4E)practiceasanefforttoachieveFirstTimeCorrectdeliveriesatthedesigncentre

• Receivedthecoveted“AceFalcon”awardforbusinessexcellence• SelectedaspartoftheexchangeprogramwithEricssonSweden• SelectedastheSelfGovernanceLeadatInfosysMysoretoformaneffectiveinterfacebetweentheSoftwareEngineersandHR

amiya Kumar27 years

B. sc. math (h)magadh university

specialization marketing & Finance

5.5 years of experience in Marketing & business Development

Centre Manager - iMs learning Centre, faridabad (Haryana)• Managed `1.41 crore business, the largest management test Preparation center in the

region• Led a team of twelve members, trained them continuously and monitored their progress

and achievable• Executed brand promotion & BTL campaigns and rolled out effective communication

plans leading to 33% growth in walk-ins• Developed & sustained PR with colleges. Anchored Placement Support Program for

engineering colleges. achieved 15% revenue growth• Launched MaxPrep GMAT program for GMAT entrance test. Achieved revenue growth

of 10%• Achieved 200% growth in referral enrolment through implementation of College-

representative plan• Taught Mathematics and Reasoning, mentored MBA and BBA aspirants

faculty – Career forum, faridabad (Haryana)• Integral part of the start- up & handled the responsibility of sales & direct marketing• Taught Mathematics and Reasoning for MBA & BBA entrance test

teacher (Mathematics): bnDMg residential school, palamau (Jharkhand) • Taught Mathematics to Intermediate Students & counseled them on regular basis about

career options ahead in life

30

arunendra pandey26 years

B.sc.lucknow university


5 years of experience of sales and marketing in pharmaceutical (specialty segment)

senior executive (sales) - sun pharmaceutical industry limited• Managing institutional sale of cardiac and diabetic drugs • Instrumental in organizing various scientific and academic conferences to update the

medical fraternity• Conducted various program for the customer relationship management• Handling existing business with the help of channel partners. Identifying and appointing

new channel partners as per the requirement of business territory• Developing, executing and promoting the business plan for new products• Rendering support to the product management team by conducting the meeting with

potential clients, enhance awareness and acceptance level of company’s business solution in respective segment

• Keeping a track of recent development across the environment, study their impact for business optimization

• Generating personalized document on competitor mapping and communicate the same across the organization

• Periodic reporting to top management on inventory, forecast, and sales budget.• Address customer grievance and act upon the issue in quick time

achievements• Achievedsalestargetoverandabove100%forthreeconsecutiveyears• Conferredas‘StarAchiever’oftheYear2008forachieving117%oftargetsales• Successfullyplannedandlaunchedseveralnewproductsintheterritory

anshul gupta 27 years

B.tech (electrical)Kurukshetra university

PGDBa (operations)scDl, Pune

specializationmarketing & operations

Cert.: Recovery/ Filling of sF6 Gas as per the eu

regulationsinternational exposure

1 month(sabbatical-available for

Placements)

5 years of experience in project Management, site Management, project planning & Co-ordination for power & infrastructure projects

sr. executive projects – industry sector, siemens ltd., new Delhi • Supervision of projects and assisting site in-charges with respect to cost, resource

deployment, inventory, time over-runs and quality compliance, evaluating project progress & taking adequate corrective actions

• Co-ordination with client and consultants for planning, scoping, estimation, tracking & implementation of project plans within preset estimate/ revenue budgets and deadlines

• Directing the development and implementation of key purchase/procurement strategies, contingency plans and ensuring that plans are aligned with project requirements.

executive projects – industry sector, siemens ltd., new Delhi• In-depth exposure to Industries like Power-Substations/Textile/Cement/Glass/

automobile/metals/airports/ Power Plants/coal handling Plants/Ports • Handled sites individually having turnkey scopes (along with civil works) like 220/132

KV GIs/aIs substations, ht /lt Power distribution and Plant/Industrial lightings, being at client premises acting as a site manager

engineer – reliance energy ltd. noida • Handled the erection, testing & commissioning of 33/11 KV substations for UPRE

Project of m/s rel in etawah/ auraiya Distt. of uP• Maintaining of Incoming Material Invoices/Challans/Road Permits and further obtaining

the Grn and submission of the documents

achievements • Appreciationcertificatesfromallmajorclients

31

ashima Kakar29 years

BBaG.J. university


6.7 years of experience in Corporate relations & marketing with detailed exposure in atl and btl activities in diverse industries

Manager-Corporate relations, iMt ghaziabad• Maintaining relationship with existing recruiters and introduce new initiatives• Placement and campus engagement for the program• Co-create platforms for industry academia interactions• Brand building in industry forums and media tie-ups

Deputy Manager- Corporate relations, asia-pacific institute of Management• Ensuring a smooth process of internships and final placements • Alumni relationship and industry interactions such as guest lectures• Content formation for all corporate brochures and presentations• Formulating the budget for the department and other promotional activities.• Co-branding with bodies such as AIMA, CII, FICCI, NHRDN

Deputy Manager- Corporate Hr, nuchem india ltd.• Working with Government bodies for PF, ESI etc.• End to end recruitment process, induction and training• Performance Appraisal and Feedback

sr. executive- tDCC, DaViM• Worked on TDCC department wherein organized 100+ events for MDP’s• Media Releases and BTL activities

achievements • Introduced30firsttimerecruiterswith15%increaseinAverageCTC(IMT)• Inductedintothedepartmentinaturbulenttimeachieved100%placementswith70%firsttimerecruiters(AIM)

• Closedallkeypositionswithin20daysofrequisition(Nuchem)

arunkumar g27 years

Be computer scienceuniversity of madras

specializationFinance & systems

Microsoft Certified Professional


5.5 years of experience in software Design, Development & project co-ordination

lead engineer - HCl technologies• Interacted with the client & system engineering team for requirements gathering &

scoping• Managed a small team of 5 members and was responsible for the deliverable of the

modules from analysis to testing phase which included preparing estimations, time lines for the project deliverables and coordinating cross geographical internal teams

• Handled architecture and designing the solution for the product and undertook code review and troubleshooting the application

• Extended post go-live and application maintenance support to the client, design, and debugging applications in various software languages

• Played SME (Subject Matter Expert) role during the project initiation stage and did reverse engineering of the existing product to prepare business use-case requirement document

• Handled performance tuning, improvement, balancing, and usability, integrating software with existing systems and identifying new methodology for implementation & maintaining standards compliance

• Addressing all the important issues & defining best practices for project support and documentation and training project members to enable them to perform their activities effectively

achievements • Consistentlyexceededexpectationsandreceivedthecertificateforthe5–yearservicefromCEOofthecompany

• Received Certificate of Excellence for successful completion of Smart .NET Greencourseasafresher

32

b. pranith raj27 years

B. e. (electronics)nagpur university

specialization marketing & systems

5.8 years of experience in it project Management, Delivery in bfsi and operations

senior systems engineer - infosys technologies limited• Implemented multiple applications simultaneously across geographies leading to

approx. 20% cost reduction for a leading Bank in the World• Analyzed business architecture and requirements, led global resource teams to

implement business solutions spanning multiple domains and geographies• Involved in Development, Maintenance & Functional testing of Banking channel

technology applications and also led a critical production team with a peak size of 16 people

• Prepared Project cost estimates, Resource loading and Delivery dashboards for project management

• Anchoring Knowledge Management Team by Conducting Cross related trainings on the applications in channel technology with Performance measuring enhancements

engineer – sCM, Jabil Circuit (formerly Known as Celetronix)• Designed Chip for Philips Power systems• Functioned as a Buyer for Tata-Sky Dishnet Project which involved finding Cost effective

parts from prospective vendors and negotiating them on cost & quality• Analyzed the flaws of BAAN ERP system & mismatch between the physical quantity of

parts

Management trainee - archana paper products pvt ltd• Assessed market scope of the products & enlisted various clients working in Textile Mills• Played a key role in acquiring a Rs.1.5 crore Project from DCL Polyesters• Assisted the software team to develop an ERP System for Production and Sales team

achievements• Awarded the ‘Spot Award’ for delivering outstanding contribution to a Leading BankProject

• Bagged‘MostValuableTeam’Awardforaccountlevelhighperformance• ReceivedclientAppreciationforaFormgenerationtoolthatreducedmanualeffortby40%

avinash prasad30 years

B.e. (electronics & telecom)mumbai university


six sigma Green Belt Certified

7.2 yrs of experience in it - Consulting, project Management & service Delivery in telecom Domain

technology lead - infosys technologies limited, pune• Worked in close coordination with client’s IT and business division to define

requirements, prepare solution agreements, do effort estimation and provide functional and technical solutions

• Worked in multiple roles such as designer, consultant, test engineer in an offshore environment in various projects for telecom clients

• Managing the entire project life-cycle in Design validation, right from scope/requirement gathering, script generation, test execution till issuing the sign-off report documents for the design

• Delivered business critical projects which involved end-to-end application enhancement testing on cIsco product

• Increasing test efficiency through application of appropriate test technology, tools and innovation

assistant systems engineer - tata Consultancy services ltd, Mumbai • Enabled and led delivery teams to deliver business critical projects such as upgradation

of Data network services for telecom clients with good quality and on time schedule adherence

• Leveraged upon the technical and managerial skills to ensure customer delight in a multi vendor scenario

• Responsible for client engagement in Europe over multi vendor setups and project management for on time delivery of Data network up gradation

achievements• Receivedclientappreciationletterforeffectiveprojectimplementation

33

Deepak sharma28 years

B.tech (electronics & communications)


5.8 years of experience in technical sales & marketing, business development & channel management

asst. Manager – northern region, parker Hannifin Corporation• Developing new markets for Automation Systems & Precision Motion Control.• Mapping market potential and providing objective feedback to the company.• Managing a team of 5 channel partners & providing tech. support & training.• Organizing Seminars & Exhibitions for Brand Image Development.

sr. engineer – sales & Marketing, Machine tools india limited• Managed entire sales and marketing activities for the assigned territory & increased the

oem customer base to enhance the business• Worked closely with overseas Principals like Micron, Murata Machinery, Sugino

machines, seiwa, taylor hobson, adcole etc• Led activities pertaining to new developments and project implementation

engineer - eDM sales, electronica Machine tools limited• Handled complete sales and marketing activities in assigned territory for high value

cnc Wirecut & electric Discharge machines (eDm)• Managed 255 customers Account through CRM

achievements• IncreasedsalesrevenueofParkerHannifinIndia,AutomationdivisionfromRs.2-3milliontoRs.11million(2008-09),Rs.30million(2009-10)andhelpachieveGrossmarginof35-40%everyyear

• AccreditedwithBestSalesPerformanceAward(2006-07)inMTI,NewDelhi• AccreditedwithBestSalesPerformanceAward(2005-06)inEMTL,NewDelhi• MeritsofhavingaddedmajorKeyAccountsandNewChannelPartners

bhupinder singh28 yearsB.com.

G.n.D. university

specialization Finance & operations

8 years of experience in branch operations, Customer relationship Management as well as training & Development

assistant Manager - fastway transmissions pvt. ltd.• Managed operations of Amritsar branch including the monthly collection from

Franchises• STB Sales and Collections as well as Technical Services and Customer Care• Headed a team of 35 personnel (including technical team, administrative staff and

studio team)• Successfully launched the live coverage of gurbani kirtan from Gurdwara Shaheeda

Sahib for the first time on cable TV

senior executive - ibM Daksh• Handled process insurance claims for US Health Insurance Company• Imparted training to new recruits

entrepreneur - Jbs enterprises• Established market for the newly opened construction business in and around Amritsar• Successfully launched the first and only franchise of JK Lakshmi cement in Amritsar

achievements• PivotalinestablishingthenewCableTVNetworkinhostilesetupagainstallmarketingodds(Fastway)

• AccreditedwithanAwardofLiveWirefromtheclientforbeingthebestperformeramongnewjoinees

34

gagan bhatia28 years



Certification amFI mutual Fund

6 years of experience in sales & Distribution, business Development, Debt Management and team Management

agency Manager – Debt Management - HsbC, north upcountry• Managed all north upcountry branches with portfolio of over Rs. 200 million• Conducted monthly analysis of non starter, non performing and skip cases• Ensured monthly audit and regulatory compliances for the area

relationship Manager – Consumer finance – HsbC• Maximized the profit of the branch by controlling monthly cost of acquisition• Meticulously developed distribution network by adding associates and hubs• Mentored a direct sales team of 40 members and 7 direct sales associates

relationship Manager – used Car loan & overdraft - iCiCi bank ltd • Established relations with auto dealers, channel partners and branch network• Liaised with 12 business associates and guided a team of 30 members• Handled monthly commissions and promotional budgets for the dealers

resident sales officer – Consumer electronics - Videocon international ltd.• Efficiently handled primary and secondary sales operations in the area• Imparted technical trainings on products to customers and channel partners• Launched new products by organizing various exhibitions and dealer meets

achievements• Thriceaccreditedwith‘ThanksAward’fordeliveringexemplaryperformance• FelicitatedbyGBHfor‘BestPracticesImplementation’inalocation• Twicenominatedas‘LeaderoftheMonth’forhighestbusinessvolumes

Dilip Kumar Mallick29 years

B.tech (electrical)ouat university



7.3 years of experience in project Management, Client relationship Management and business development

technology lead - infosys technology limited• Performed client facing roles with responsibilities such requirement elicitation, scope

definition, work-schedule negotiation and offshore-onsite co-ordination.• Expertise in end to end software development lifecycle, encompassing analysis,

design, coding, implementation as well as support.• Led client projects spread across geographies (India, USA and Singapore) for Neptune

orient lines (nol), a world leader in transportation and logistics services.

site supervisor - indo electrical• In-charge of Operations & Maintenance as well as Repairing of 11 KV lines• Managed administrative work and client coordination

achievements• “Certificate of Excellence” for implementation of ‘Estimating time of Arrival Project’spreadforNeptuneOrientLines(NOL)

• “CertificateofExcellence” for implementationofOperationalQuote-to-CashLogisticsSystemsfroma25-yearoldlegacyplatformtoaservice-orientedarchitecture(SOA)forBekin’sVanLinesaUSbasedlandTransportationCompany

• PivotalinimplementingchangesinthesystemforNeptuneOrientLineswhichresultedincosteffectivenesstothetuneofRs.7millionannually

• Merit of having recommended and fixed the system of Neptune Orient Lines onoperationalissues&improvedtheefficiencyby25%

• Played a vital role in implementing quality measures & helped in achieving CMM5recognitionfortheproject

35

Himanshu shekhar Jha30 years

B.sc. ( hotel mgmt)Ihmctan, Kolkata


7 years of experience in sales, Customer service operations, sla Management, training & Development in banking Kpo & Hospitality sector

senior Customer service executive - HsbC eDp india pvt. ltd., Vizag • Managed activities pertaining to Sales, Complaint Handling & Customer Service of UK

credit card customers of hsBc Bank• Headed a team of 10 CSEs• Managed the shifts as acting Duty Manager and maintaining SLA• Coached & mentored underperformers & new joinees, thereby improving their

performance to Bau level• An active member of Quality Circle

senior guest service assistant (supervisor) - welcomHotel grandbay, Vizag• Led a team of 12 members• Managed Front Office Operations, Rooms Division Sales, Cashiering, etc• In-charge of Guest Relations & Feedback and key reports preparation• Functioned as Department Learning Co-ordinator (DLC) & imparted training to Front

Office Staff members• An active member of Area Effectiveness Team

achievements• Akeymemberoftheteamthatbagged“TeamoftheQuarter”(HSBC)• Accredited3TeamStar,2QualityStarand4TopPerformerAwards(HSBC)• ContributedLeanIdeastoGENIEthatwasapproved&implementedbybusinessarea,UK(HSBC)

• AppreciatedbyGlobalSupportOfficer,BusinessArea,UKHSBCforqualitycalls• ReceivedEmployeeoftheMonthAward(ITCHL)• Received“WellDone”CardtwicefromManagingDirector,ITCHL

gaurav arora30 years

B.e. (electronics)nagpur university

PGDBa (marketing)scDl, Pune


Certified in Telecom managed services

3G (WcDma) Flexi-trainer(sabbatical-available for

Placements)

8 yrs of experience in telecom Managed services, service Delivery,project Management & people Management

Manager –operations, ericsson india pvt. ltd.,gurgaon• Spearheaded a team of 30 Service Engineers (including 4 Team Leads)• Responsible for Overall Service Delivery in 24x7 Environment to the multiple Customers

under managed services contract• Responsible for competence development & performance management of entire team• Conducted resource assessment, interviewed & hired the prospective candidates• Merit of having worked with key Clients viz. Bharti, Idea, Sprint-US, CBW-USA, Zain–SA• Responsible for e-TOM compliance & ISMS ISO-27001 certification• Led a team in roles like TL-3G Remote Delivery, TL-Configuration Mgmt, and Shift-Lead

system support engineer - nokia india pvt. ltd., ahmedabad• Steered Configuration Management, Fault Management & Performance Management

of network for the entire region• Efficiently handled Network Management during the heavy floods in Gujarat

service engineer - bharti Cellular ltd, ahmedabad• Managed Operations & Maintenance of allocated region• Handled activities pertaining to Project Management right from locating the cell site up

to its integration• Merit of having integrated highest number of cell sites in one month• Successfully established the Airtel Network in entire North Gujarat Region

achievements (ericsson)• Recognizedas‘KeyContributor’&‘HighPerformer’byseniormanagement• Accreditedwith‘AceAward’&‘ExcellenceAward’forexemplaryperformance• Pivotalinstreamliningthe‘PerformanceIndicators’forSprint-US• Leadtheestablishmentofnewfunction,resultinginsavingof20FTEs

36

Karthik Venkat27 years

B. e.(computer science & engineering)

anna university, chennai

specialization Finance & marketing


5 years of experience in functional Consulting, project Management & pre-sales activities

technology lead - infosys technologies limited• Performed technical and functional analysis of the requirements and prepared

corresponding impact analysis & functional specifications documents on Oracle Financials Projects along with feasibility analysis

• Provided techno-functional consulting on Oracle Financials modules in Oracle e-Business suite (oracle applications)

• Acted in a client interfacing role for 3 years and was a single point of contact for complex module recognizing revenue of deals worth over usD 1 million

• Preferred point of contact for client thus instrumental in getting new projects. Invited to client locations in malaysia, Poland and united Kingdom to consult on project implementations

• Led a team of 12 business analysts and software developers from both Infosys and client teams across various geographies like Bangalore, Pune, chandigarh, us, Poland and malaysia

• Worked on multiple pre-sales activities & RFP’s for Infosys and the client

achievements• Consistentlyratedamongtop15%performersforthelast3years• Accreditedwith‘SPOT’awardfordeliveringoutstandingperformance• ReceivedmultipleappreciationsfromboththebusinessendusersandtheITteamofalargemanufacturingclientintheOracleR12UpgradeandOracleFinancialsSupportProjects

• Pivotal ingettingexcellentproject feedback from theclientduringquarterlybusinessreviewsconsecutivelyforover2years

• Nominated for the ‘Most Valuable Player’ Award at the unit level in Infosys, with aheadcountofover8000employees

• Appreciated foreventmanagementskillsby theHRManagers fororganizingover15major events at Infosys including its 25th anniversary celebrations

Jatin Chandna26 years

B.sc.Delhi university


5.2 years of experience in business operations, analysis, investment reporting, empanelment & administration

investment reporting analyst - fidelity international business services pvt. ltd• Steered Retail & Institutional Operations (Retail & Institutional), Empanelment as well as

Business Development activities • Prepared Management Information Reports & Investment Reports• Supported Fidelity’s Fund Managers, Relationship Directors, Client Service Managers,

client administrative managers and all Institutional clients by providing them with a wide range of investment reporting documents

• Drafted the Investment Reports using tools like Quark Express, Python, AS 400, microsoft excel and PowerPoint

administration executive - V.s. polypacks pvt. ltd • Managed Office Administration Activities• Organized supplier relationship building events & distributor events for the organization

achievements• Empanelled300+BusinessPartnersforFidelityinIndia• WonBusinessAchiever’sAwardinfirstquarterof2007• Interacted with Relationship Directors (London) and Client Service Managers(Kingswood)indeterminingreportcontentrequirementandarrangingsignoff

• InitiatedQualityImprovementstepswhichledtoreducingtheerrorratefrom9.1%to4.6%overtenureof4reportingquarters

• PreparedTrainingManualsforallthe48processeswithinNewAccountsfortheTraining/InductionteamwithinFidelity

• Attended trainings on SP2I-Security Private & Proprietary Information& Prevention ofMoneyLaundering&Fraud&SixSigma

• MeritofhavingderivedmaximumbusinessoutofthenewlyacquiredchannelforthenewfundofferofFidelityInternationalOpportunitiesfund

37

Manoj yadav31 years

B. e.(electronics & telecom)sGsIts Indore


(sabbatical-available for Placements)

7 years of experience in project Coordination, business analysis, operation & Maintenance

senior system analyst, Data Centre it project Circle -bsnl• Establishing Data Centre (IT infrastructure) for Convergent Billing & Customer care

centre, lead 28 members ensuring timely & defect free implementation of Dc• Designed and implementated Business Process CRM (MySAP), WSC (MYsap), IRB

billing (convergys), mediation (Intec), Pms, Inventory mgmt and Provisioning (clarity), revenue assuring

• Executing and scheduling site activities to ensure completion of projects within the time and budgetary parameters and for optimizing resource utilization

• Coordinating and managing vendors, generating System Requisition Specifications & handling Business Process redesign for crm and Provisioning system

• Designed, developed & implemented Sales & Distribution software (In-House)

system analysts, gsM Data Centre Chandigarh - bsnl• Handled the VAS service Management• Supervised the operations and maintenance of SMSC• Managed communication link of BSNL with all service providers around the world

Junior telecom officer, punjab telecom Circle• Planned, commissioned, installed and maintained Broadband Switch, routers, DSLAM,

aDm, stm• Prepared technical specifications, resource & task scheduling, resource deployment

and team meetings for reviewing progress of the project• Managed functions such as project estimation, project scheduling, brainstorming,

preparation, test validation, presentation of various reports and quality assurance

achievements• Receivedappreciation fordevelopmentand implementationofSalesandDistribution(Sancharsoft)in-houseS/WofBSNL

Mainak Mitra28 years

Be (electrical)nagpur university


5 years experience in project Management, operations Consulting, quality assurance & process enhancement

team lead - Denso• Headed a team of 6 engineers• Steered Product and Project Costing, Manufacturing Process, Project, Quality

assurance, Product Development (PPaP, PFmea, Value addition, Bom, etc.), Kaizens and resource management

• Conducted Capex analysis & assembly testing• Streamlined various operational activities processes & procedures to facilitate smooth

production process & enhance productivity• Implemented various quality assurance and process enhancement techniques• Spearheaded the complete project operations entailing planning, resource utilization,

maintenance, quality management & manpower management

achievements • Merit of being the youngest leader to lead a Quality Circle and accredited with anAppreciationAwardforthesame

• Successfully reduced overall line cycle time from 34 sec to 20 sec to achieve highvolumetargets

• WorkedonoffsiteprojectsinJapan,Thailand&India• Pivotalinapprovingabudgetof$1millionfortheproject,800L(ToyotaEtios)• EfficientlyinstalledAlternatorAssembly(c.t-20sec)lineafterstudyingthelatestassemblyprocessatDensoThailandaswellasStatorAssemblylineforK3Aalternators

38

Devendra Chaudhary29 years

B.e. (chemical)Gujarat university


6 years of experience in operations Management in the ites industry

Head of operations - Dhyey bpo services pvt. ltd.• Cross-functional experience in managing domestic and international processes and

leading teams while swiftly ramping up floor support management ensuring timely deliverables within pre-set cost parameters. lastly spearheaded as head of operations with DBsPl

• Expertise in managing the entire spectrum of functions including Operations Management, Service Excellence, Technical, Quality Compliance, Process Setup, Process transition and team management

account leader (operations leader) - etech inc.• Managed recruitment, training and mentoring for acquisition of fresh talent while

managing new process setup and transition and maintained Kra report for team members on daily & monthly basis and liaison

• Determined training needs through quality checks, identifying training gaps & conducting programs to enhance operational efficiency of the entire team

• Measured the performance of the processes in terms of efficiency and effectiveness matrix and ensured adherence to service level agreements

achievements• Mentored and groomed over 20 leaderswho at present are independently handlingcampaignsasTeamLeaders

• Instrumental in increasingrevenues from$1000permonth to$30000permonthanddialinghoursfrom12hoursto24hoursofdialingcoverageforDeVryCampaign

• HandledAT&TDSLOBProcessesforover3yearsenhancingrevenuesfrom$2000to$100000overthisperiodincreasingthebandwidthfrom8memberto50teammemberteam

Manpreet singh sran26 years

B.tech (chemical)Ict (Formerly uDct,

mumbai)


5 years of experience in sales & Marketing & technical service

sr. technical officer - resil Chemicals (p) limited• Handling Responsibilities of B2B Sales, Marketing, Logistics and Business Development

for north zone • Achieving the business plan targets systematically • Handling channels, key account management, commercial/technical training of dealers

& end customers, and organizing technical seminars. • Conducting Channel Partner Review Meetings on monthly basis to review the

performance of channel partners. Identifying and appointing new channel partners as per the requirement of business territory and needs

• Developed, executed and promoted business plan for new products and conducted field trials

• Served as a facilitator between central corporate research team & customer and was instrumental in launching trouble shooting and value added products

• Efficiently handled key accounts such as Vardhman Mills, Nahar Enterprises & T.C.Terry tex

• Managed ARC (Application research centre) of North region to support clients in developmental efforts for optimizing production and processing

achievements • PlayedamajorroleinachievingthesalestargetofoverRs.2CroresforLudhianaandChandigarhregion

• AdjudgedasthesecondbestSalesTeamfortwoconsecutiveyears

39

Mohsin ali Khan27 years

B.tech (textile)anna university, chennai


5 years of experience in operations Management & programming

Manager – operations with Hitstars trading and solution pvt. ltd• Executing govt. project under Ministry of Labor and Employment, named MES (Modular

employable skills)• Identifying skilled labor &carrying out procedure to certify them under National Council

of Vocational training• Conducting assessment and practical test according to the guidelines of CII and

generating the reports• Hiring resources for conducting assessments and identifying potential business

prospects• Locating sites for regional offices and recruiting local representatives• Coordinating the business operation in entire Eastern and Northeast India• Developing Internet portal for the company and maintaining MIS

programmer analyst - Cognizant technology solutions • Handled US based Insurance clients MetLife and Vikings. Major role included interaction

with onsite coordinator to gather the client requirement and implement the same• Extensive Analysis of codes of more than 15 applications and their migration on to new

platform and server.• Developed new applications, maintenance of existing system, testing and quality

assessment of project• Carried out testing and debugging of new application for 4 states• Coordinated with different interfaces of Met-Life and found out the key files, where we

had to make the changes according to new servers

achievements• AwardedasbestProjectoftheyearfortheyear2005-06incognizant.• Certifiedmorethan25000candidatesforMESproject,undergovtofIndia.

Mehul J.sudra34 years

PGD-Gmtn.I.F.t

B.com Gujarat university


8 years of diversified experience in brand Management, retail buying/operations, export Merchandising & production planning

buyer-Kid swear in reliance trends ltd.-a division of reliance retail ltd• Business development & brand management of in-house brands• Responsible for buying, sales, profitability, margin & SPF-MFP return of four in-house

brands as per aoP• Successfully launched fifth brand “Tee-Whiz” by managing all its conceptual, operational

& marketing activities

buyer-Kids wear in Max retail stores-a division of lifestyle int. p ltd.• Budgeting a right mix of product line to maximize ROI• Managing concept centric design development, range planning & subsequent buying

& sourcing activities• Sell through/SPF-MPF analysis, VM effectiveness for optimum utilization of floor space

& inventory controlling• Planning & ensuring maximum stock turn at store level, regular tracking of GRN-STN

status by coordinating with all concerned parties• Managing pan India merchandise sourcing as per cost, quality, lead time, planned

ros etc• Competition tracking & trend analysis

Merchandiser-brands next, Chicos in Mayur overseas• Export merchandising activities such as costing, material sourcing etc

production Merchandiser-shahi export House• Factory planning of materials, machine & manpower to meet delivery date

achievements• AppreciationfromMaxRetailtopmanagementfordevisingabreakthroughproductline&averagecostcuttingby15-20%

40

nitin Jain29 years

B.tech (textile)Govt. central textile

Institute, Kanpur


Certificationmanagerial training in

export marketing

6 years of experience in supply Chain Management & operations Management

asst. Manager, supply Chain - shahi exports pvt. ltd• Managing the Logistic & Vendor development ensuring Supply Plan adherence of

99.9%• Handling supply chain of yarn & fabric worth Rs. 50 Crore/Annum individually• Responsible for identifying, coordinating, implementing and sustaining cost reduction

initiatives• Instrumental in 90% reduction of Inventory levels by vendors & logistics development• Performed key strategic role including aiding MD take a stand on the issue of rising

yarn price with the apparel exports promotion council

executive, operations - Vardhman polytex ltd• Extensive experience in production & product development• Led a team of 100 to achieve target on SQDCM (Safety, Quality, Cost, Delivery, Morale)

for production line• Part of internal core team of SAP project implementation• Organized Kaizen & Quality Circle at production line and enabled increased production rate• Team Member of TQM implementation team• Provided on-job training and mentoring for colleague

Monideepa saha29 Years

m.sc. (applied economics)calcutta university


concentrated course on materials & Distribution

management from nItIe mumbai

5 years of experience in Material planning, procurement & supplier relationship Management

Manager (Central procurement) - tata Motors ltd, Jamshedpur• Material planning & procurement of High Value OEM components worth Rs 15 Billion

annually• Inventory planning and control of A –Class Components• Led Spend Management Analysis and identified key procurement value drivers• Responsible for formulating procurement strategy in line with the production forecasts• Supplier relationship management and performance assessment of strategic vendors• Analyzing purchasing trends to evaluate vendor performance and to zero in on the

optimum inventory level• Responsible for coordination with the Technical & Engineering Cell for issues related to

Bill of material management• Supply management & logistics control of High Value components• Streamlining of Order Fulfillment Cycle

assistant Manager (Central procurement) - tata Motors ltd, Jamshedpur• Demand planning of OEM components in line with the production target plan• Handled the release of schedule lines for OEM components as per the material

requirement planning• Served as Lead User of Materials Management Module (SAP) for High Value

components• Served as a Part of Cross functional Team for the introduction of bar coding in the

Jamshedpur plant

achievements• SpearheadedacostreductioninitiativetothetuneofRs10Million• Consistentlyratedamongthetop10percentileperformersinTataMotorsLtd

41

parag Dabhade29 years

B. e. (electrical)nagpur university

PGDeI aIIms, chennai


CertificationsMicrosoft Certified

technology specialist

international exposure 1 month

6.5 years of experience in it and operations

Consultant - Capgemini Consulting india pvt. ltd • Expertise in Microsoft Technology including development and functional understanding

of the project with the onsite team• Led a team of 8 members ensuring maintenance and support of business model of

client resellers & managed their orders for multiple geographical locations• Techno-functional consultant for multiple clients and worked as onsite coordinator for a

leading telecom client in France• Project Planning, establishing timelines, preparing technical and functional

specifications & mentoring the team members for largest telecom and FMCG clients of europe

• Performance tuning, improvement, balancing, integrating software with existing systems and identifying new methodology for implementing standards compliance

software engineer - Data technology instruments and systems pvt ltd• Functional understanding and application development in Microsoft Technology• Requirement analyst, test strategy & planning, user documentation and functional

testing for trading and security consulting application

operations Manager - navshakti traders • Marketing, general administration and distribution of products like Plaster of paris, card

board, chalk moulds, wax candle moulds etc.• Dealt with DIC of all district offices in Maharashtra

achievements• Recipientofaward&appreciationfrom“CountryHeadSogetiIndia”• Recipientof“CapgeminiProjectStar”Awardin2009• Most“valuableprojectteam”award2007• Awardfor‘Exemplaryperformanceandteamspirit’atDISPvt.Ltd

nitish arora28 years

B.com Delhi university

BIt IGnou


6.6 yrs. of experience in sales, business Development, underwriting and relationship Management in financial services

Manager - Mortgages with Citifinancial Consumer finance india ltd• Handled relationship with the branch network for business development and recruitment

of channel partners• Ensured revenue and profit targets are achieved on a continuous basis through focused

approach on mortgages• Published regional level dash board to the top management• Monitored nonstarters/ Cheque bounce trends for branches and channels and their

sourcing pattern to take corrective actions• Trained & coached the branch network & channel partners on product policy parameters

and market intelligence• Handled business & income targets of Third Party Products such as life Insurance and

home Insurance

branch Manager – personal loans with Citifinancial Consumer finance india ltd • Led the team through target setting and review measures• Achieved operating profit of the branch through revenue and cost management• Strategized and implemented the branch sales promotion activities to become preferred

neighborhood lender• Mentored, trained and groomed credit resources for underwriting of new borrower

personal loans and maintained healthy tat on credit• Monitored branch collections by minimizing delinquency, write off and non-starters

achievements:• Citigroupshootingstaremployeeforqtr.2inFY06-07and09-10

42

prashant Chaudhary28 yrs

B.tech (computer science & engineering)

u.P. technical university


5 years experience in project Management and Consulting in top it companies(telecom & banking domain)

software Designer - royal bank of scotland• Steered activities pertaining to requirement elicitation, feasibility analysis & time - effort

estimation of requirements along with offshore-onsite co-ordination• Provided integration for trade analytics, dynamic pricing & algorithmic modeling

through time series database with a time lag of few milliseconds• Evaluated various products & recommended best customer centric solution• Led the team to develop near real time system capturing enormous amount of market

data, trades & inside prices from various exchanges like Bloomberg, reuters etc

specialist (J2ee) - google india• Understand requirements for upcoming Google products & develop strategy to provide

advanced analytical decision support system for the same• Managed vendor relations & developed strategy for optimizing their performance• Responsible for entire SDLC including high level architecture to low level design

associate technology l2 - sapient Corp.• Analyzed business requirements by coordinating with marketing division & client,

served as a sPoc for a complex module, was involved in pre-sales as technical advisor• Prepared scope matrix, project specification, & design documents through FPA & WBS• Delivered alternative implementation proposals considering complexity of requirements• Proposed rule engine based “Rule builder” which reduced development time to 60%

achievements• FounderofWay2Contact.com.RunningonGoogleclouds&integratedwithFacebook• Proposed“BulkJob”frameworktoAirtel,currentlyusedfor90%ofordermanagement• Receivedmanyawardslike‘S’tarrating,Pat-On-Back,ClientFocusedDelivery,etc• Receivedappreciationlettersfromclientduringonsitetenureof2.5years

pradipta paul 31 years

B.tech (computer science and engineering)

nIt, Warangal



7 years of Consultancy experience for erp sap implementation for business solutions

techno - functional Consultant, ibM india pvt. ltd.• Involved in project planning and establishing timelines along with providing guidance

to the team members • Coordinated & closely interacted with clients to establish strategic relationship and

understand the requirements• Conducted analysis of business processes for different industries with a main focus on

optimization of critical business processes

senior Consultant and abap lead, sap labs india pvt. ltd. • Analyzed, designed, implemented business processes and spearheaded teams of

various sizes in implementing saP for international clients• Served as a Techno-Functional Consultant in various SAP functionalities• Imparted on - job training and mentored colleagues of other business units

assistant systems engineer, tata Consultancy services• International exposure for 2.5 months in UK and Germany handling clients• Spearheaded a development team of 4 members while working on the Southern Water

project, which was a utilities based client• Worked on the Toyota Financial Services project on the CRM front

Consultant – level 2 - pricewaterhouseCoopers india pvt. ltd.• Served as part of the business team of PricewaterhouseCoopers as a Subject Matter

expert helping to bag a deal from General electric• Handled numerous projects such as GE, HFCL and TEGA

achievements• Receivedappreciationsonnumerousoccasionsfromboththebusinessendusersandprojectteams

43

priyabrata banerjee28 years

Be (electronics and communication)

Burdwan university

specialization operations & marketing

CertificationsPmP training (Vinsys)

6 years of experience in telecom service Delivery & operations

assistant Manager – service Delivery, tata Communications transformation services• Led a team of 35 Engineers (Including 3 group leaders) for End to End Order to Deliver

Process of enterprise customers in telecom• Efficiently managed Customer SLAs, internal OLAs and Process KPIs including

standardizing outputs & quality• Estimated work effort, prioritized work and handled resource planning• Worked as part of the Organizational Internal Audit Management team for ISO 9001/

Iso 14001/Bs18001• Completed Kaizen & Juran projects for continual improvement and implemented CAPA• Involved in client interfacing for technical/operational escalations & ensured high levels

of e-sat & c-sat scores• Ownership & upkeep of LWIs and status reporting to management

Deputy Manager – networks, reliance Communications ltd. • Managed the Enterprise Customer Circuits of entire WB circle ensuring n/w availability

complying with mttr as per quality objective.• Headed a team of Field-Engineers for customer escalations and provisioning activities• Managed provisioning and service assurance of Broadband in WB circle and involved

in material management using saP

achievements• Blue Ribbon award in Tata Communications for individual performance in removingdesigndefectsinoperations

• BestColleagueawardbyClient in2009 forpartneringand implementing transactionpricingmodelintooperations

• RecognizedasaCriticalResourceoftheorganizationin2008bythetopmanagement• ObtainedEmployeeSatisfactionScoreof4.21(5pointscale)inQ12Questionnaire• Teamgot“Outstanding”ratingonclient’sSupplier&PartnerPerformanceassessment

pritish Mahajan30 years

Be (mechanical ) Pune university


CertificationcPIm (aPIcs)

PmP training (Pmcc)

7 years of experience in erp Consulting, software development and Manufacturing

senior solution specialist - oracle india pvt. ltd., bangalore • Served as Lead Functional Consultant of Manufacturing and SCM in end to end

implementations of oracle e-Business suite for various countries and industries • Headed 4 projects ($120M) in the span of 3 years reducing completion time by 30%.

coordinated with sales team, Partners and clients• Implemented setups of Inventory, Bills of Material, Work in Process, Flow Manufacturing,

Demand Planning (Demantra), advanced supply chain Planning (ascP), eam, Purchasing, multi-org and gained sound knowledge of other modules

• Analyzed the Localizations, Taxes and Translations of various countries. Tested and dexterously developed ‘functional assets like TE40s, flow models, flow videos etc

software engineer - patni Computers systems ltd., Mumbai • Analyzed the relationship of data and developed PL/SQL programs and UNIX scripts

for Interfaces and Data migration for Guardian (us)• Generated extracts/reports, created Functional/Technical Specifications, performed

unit testing and carried out defect prevention activities as a DPr

sr. executive – Manufacturing with godrej & boyce Mfg. Co. ltd., Mumbai• Headed team for designing, manufacturing and commissioning of Pneumatic/

hydraulic equipments, sPms and layouts of sPF lines reducing the cost by 35%.• Worked on daily production targets, project/production planning, scheduling, cycle

time reduction, process improvement and Baan entries

achievements• Publishedpaperon‘GreenSupplyChainStrategiestoSpearheadTomorrow’sGrowth’inWorldBPCConference(Aug2010)

• ValuableContributionLetterfrommanagementinPatni

44

rajesh Kumar gupta28 years

B. tech (computer science & engineering)

GGsIPu, new Delhi



5 years of experience in project Management, software Development & business analysis

assistant system engineer with tata Consultancy services• Handled business development through analysis of client’s business processes and

identification of scope of improvement in key IT process areas• Met satisfaction level & managed IT team by allocating and working on technical

Issues, bug fixing which involved 24/7 Technical production Support• Led team of 5 members and ensured on time delivery to client while maintaining quality• Involved in architecture design of IT application. Analyzed requirements, code reviews,

documents and provided timely status report to clients (like telecon)• With critical deadline, successfully done migration of databases on different server

to same platform due to merging of two manufacturing companies (ashland Inc and hercules Inc)

• Worked for conducting initial due diligence for an outsourcing contract and managed a part of transition of It support and subsequently also managed the offshoring of It support

• Entrusted with Additional responsibilities of making RFP for TCS and clients• Delivered and executed the project CMM Level 5 as per scheduled deadlines, extended

post implementation and maintenance support to the client by minimizing business impact

• Handled and resolved high criticality issues with immediate attention in defined SLA

supervisor with Modern industries• Served as supervisor for ensuring on time delivery of products (Tractor’s Seat) to

various companies such as escorts tractor, eicher tractor, etc.• Effectively coordinated with transport vendor & bill verification and led a team of 4

people

achievements• Awarded“CertificateofAppreciation”and“CLAP”byTCSforincreasingCSI• “LotusCertifiedProfessional-710”fromIBM,ITILFoundationV3CertifiedAssociateandClearedOracle9iSQL(1Z0-007)

r.Kathirvelmurugan28 years

B.tech (chemical)Ict (Formerly uDct,

mumbai)


5.5 years of experience in sales & Marketing & business Development

senior executive - technical sales with Harris & Menuk• Handled operations in Ahmedabad and surrounding market and key corporate

accounts such as arvind limited, mafatlal & Welspun India• Headed a team of 3 members in sales with individual target planning• Responsible for locating customer, identifying new clients, market & competitor

mapping, roping & evaluating new channel partners, sales forecasting, inventory management, administrative budgeting and talent spotting

• Managed continuous bleaching range (CBR) business for ZSM auxiliaries• Led operations for lab functions in Ahmedabad from its conception and imparted

technical training in cBr to new sales recruits

senior officer - technical sales with Croda Chemicals (india) pvt ltd• Managed operations in Erode & Kolkata Sub region Market for sales of Textile Auxiliaries• Enabled market expansion in Kolkata for knits segments• Responsible for Sales forecasting, Channel management, Ware house auditing,

imparting technical training for sales personal at distributor end, addressing grievances

sales associate - basf india ltd• Handled operations in Erode Sub region Market for sales of Textile Auxiliaries• Involved in promotional programmes for newly developed product ranges and field

trials

executive - auro textiles (a Vardhman division)• Managed shift production, resource allocation, machinery maintenance, schedule

production, achieve production targets, facilitate process improvement, adherence to strict housekeeping and ensure TQM delivering Right First Time product.

45

roshan Kumar28 yearsBIt, mca

sikkim manipal university

specialization It & Finance

5.5 years of experience in the it industry

senior software engineer - noreast shipping pvt. ltd., new Delhi• Worked with clients to define requirements • Mentor the Solution Engineering team to impart standard customer solutions• Responsible to develope templates and tools, to be used by Solution Engineers to

streamline the design and implementation of the tool• Led QA team of 6 people and was involved in Project Planning, establishing schedules

and timelines, providing support & technical guidance to team members• Evaluated the testing processes and recommended solutions for improvements• Assessed candidates for recruitment and did the appraisal of the team members

software test engineer - applied research international (ari), new Delhi• Testing of product in terms of its functionality, technicalities & performance• Reviewing, Monitoring and guiding team members for Test case design, Bug reporting,

user guide and client support mails• Involved in Product Deployment at the client side• Training and Interaction with clients at various levels

technical leader, iseva/e4e inc., bangalore• Led a team of 20 Technical Support Engineers in providing support for various Symantec

products• Involved in beta testing of Norton Antivirus and Norton Internet Security (Symantec

products)• Extensive testing of the GUI in order to find the behavior of different Symantec tools• Providing the work request for the further enhancement of the tool performance

ravi Kumar28 years

B.e. (Production engineering)

Birla Institute of technology, mesra ranchi


Certifications“tata Gems” mDP from

tmtc & sIBm, Pune

5 years of experience in new product Development & quality assurance

Manager (prototyping, world truck project) - tata Motors ltd.• Headed a team of 4 supervisors & 24 operators for prototyping & development of 5

new models of tippers, tractor trailers & trucks• Managed production scheduling & material planning for Prototype assembly.

Implemented Inventory control & 5S at shop floor• Prepared BOM, analyzed 2D & 3D drawings using PLM & resolved design issues.

ensured quality standards & quality reporting• Improvement of fits & finish, weight & cost reduction through VE

assistant Manager (quality assurance, assembly line)- tata Motors ltd.• Headed a team of 5 supervisors & 48 operators in chassis assembly line (M&HCV)

ensuring product quality & process audit, internal PDI & for implementation of PDI gating system

• Pivotal in deploying quality systems & end-of-line vehicle testing• Spearheaded reduction in warranty, PDI complains & cost saving

achievements• Instrumental insuccessful launchofWorldTruckPrimaseries inMay2009aswellasproductrangedisplayatAutoExpo2010

• Successfullyled2CFTs-1stforaestheticsimprovementofchassisbyrouting&clampingofpipelinesbybenchmarkingcompetitors&2ndforbenchmarkingthebestpracticesattheLucknowplanttoeliminatePDIcomplainofairleakageinbreakcircuit

• SuccessfullyStudied&validatedenginesuspensionwithIVECO(FPT)team&withZFteamforgearbox

• AchievedcostreductionthroughVEofAvg.Rs.2millionfor4yrs• Successfully implemented new/modified engineering changes & standards for TS16949,TBEM,OHSAS&ISO14001

46

sankha Mandal32 Years

B.sc (agriculture)Bidhan chandra Krishi

Viswavidyalaya

m.sc (agriculture)Bidhan chandra Krishi

Viswavidyalaya


7 years of experience in strategy planning, Channel sales, business Development, Management, supply Chain Management and brand Management

state in charge /Marketing executive - technico agri sciences ltd. • Spearheaded production and marketing of seed potatoes in domestic and international

markets and supply chain of Itc ltd• Established goals, budgets and developed business strategies and plans for the

achievement of these goals• Explored innovative sales channels & organize sales promotional activities, Steered

warehouse & cold store management, logistics management, contact farming and procurement

sales officer - elen Crop science ltd.: • Effectively and efficiently launch and market new brands of pesticides of a start-up

company in West Bengal

sales officer - paradeep phosphates ltd.• Managed sales & marketing of phosphate fertilizers• Explored new business opportunities in various segments by organized promotional

campaigns and ensured accomplishment of business goals

achievements • Continuouslyachievingsalestargetbynurturingastrongchannel,developingastrongbrand,introductionofnewvarietiesandnewmarketdevelopment

• AccreditedwithTechnicoMarketingAwardfortheseason2005-2006&BestEmployeeAward for the season 2006-2007.Merit of having provided highest profit for threeconsecutiveyearsamongallstates

• RedesigntheSupplychainprocessesleadingtoreducecostby25%andleadsupplytimeby50%

• InitiatorofbusinessprocessesinBihar,OrissaandNorthEast

sachin Kumar tyagi28 years


(u.P. technical university)


CertificationISTQB Certified Tester


6 years of experience in project Management, project planning, Coordination & testing in industrial automation.

associate Consultant - power Domain - siemens information system limited, gurgaon • Functioned as a Project Administrator of Siemens DCS for Jebel Ali-M Station 2000MW

co-generation plant • Integration Testing of Siemens DCS (SPPA-T3000,TXP) for Power Plant Automation• Led a team of 5 people for Testing of Migration of Legacy System TXP to SPPA-T3000• Measurement of deviation against planned Effort, Schedule and Quality with respect to

the project quality goals as defined in Project Quality plan• Mentored a team on delivering projects & testing system features with high degree of

customer satisfaction• Conducted reviews sessions of R-Spec & F-Spec outside area of work

as senior project engineer - Honeywell automation india limited, Mumbai • Installation & Commissioning of Honeywell Experion DCS at Unit 5 (500MW) & DM

plant at tata Power• Executed Migration of Triconex to Honeywell DCS for Soot Blower system at Tata Power• Analyzed customer requirements & conducted Kick off Meeting with Client• Conducted FAT & SAT at customer site, viz. Tata Power, HPCL, BPCL & IOCL• Handled AMC Activities & Renewals as well as Add-On Projects & Migration

achievements:• AccreditedwithSiemensPowerGeneration–TechnicalExcellenceYear2010• FunctionedasSystemAdministratoratvariouslocationsincludingMalaysia&Germany• RewardedEmployeeOftheQuarterAwardforProjectatTataPower,Mumbai• ReceivedCertificationforAdd-On&MigrationProjectsfromTataPower&SHCL,Mumbai• InvolvedinCrisisManagementatDeepakFertilizers&SchenectadyHerdilliaChemicalsduringMumbaifloodswhichhelpedHoneywellinwinningtheorderofRs.2Crores

47

saurabh Matta27 years

B. tech (electronics)Kurukshetra university


CertificationncFm Financial markets

ITIL CertifiedOracle Certified Database

associateinternational exposure

12 months(sabbatical-available for

Placements)

5 years of experience in business analysis, functional Consulting & Database administration in it industry

information technology analyst, tata Consultancy services ltd • Provided consultancy, requirement analysis, implementation, development and

maintenance in master Data management domain• Worked as a team-lead for implementing migration solutions and standardization of

data for Banking and Financial services (BFs) client• Engaged in Business Development activities such as liaisoning with senior management

on business possibilities, business forecasting, hiring and inducting new recruits• Supported higher management with pre-sales activity, RFP development, technology

and domain presentations

onsite Co-ordinator and team Member, tata Consultancy services ltd • Handled overseas assignment for one year as single point of contact for a large

investment bank client for enterprise level programs such as database migration and archiving activity

• Worked as Database Administrator for a leading German Bank & led end to end delivery of database management solutions

• Implemented automation programs like MIS automation and setup automated delivery systems

achievements• Wonaccoladesforestablishingoffshoreproductionsupportfacilityandteamcreation,definingrolesandresponsibilitiesaswellasimplementingescalationprocedures

• Ratedamongtop20%performersofthecompanythroughoutmycareeratTCS• Awardedthe‘StaroftheMonth’and‘StarPlayer’fromTCSandtheclientfordeliveringexemplaryperformanceduringprojectexecution

satyabrata Dash29 years

Be (mechanical)utkal university

specialization operations & marketing

Certification IPMA Level D Certification


5.5 years of experience in project Management,new product Development, Design engineering

asst. Manager (new products) - brose india automotive systems• Led activities pertaining to new product development & dimensional management• Served as point of contact for dimensional management & drawing release for Asia

region• Led the team of 5 design engineers in new product development at India

ase - tata Consultancy services, pune & Chennai• Steered dimensional management for engine components & ensured final deliverables

to the client• Functioned as Module Leader for volume calculation

e1 - larsen & toubro ltd.• Led a team of 10 CAD Engineers on 3D Modeling of jigs & fixtures for BIW• Managed 3D Modeling & design modification of jigs & fixture and BIW components• Imparted training to new joinees on CATIA V5

achievements• MeritofhavingfiledaPatentinGermanyforaconceptgeneratedbytheteamforAirgate• PivotalinconvincingthemanagementtotransferthetoleranceinvestigationactivitiestoIndia&saved30000Eurosannually

• FinalizedIndianmaterialsandsuppliersforsomecomponentsmanufacturedinGermanythusreducingthecostby18%

• Meticulouslyautomated40%oftheprocessin‘CombustionChamberVolumeCalculation&achievedreductionintheprojecttimefrom3weeksto2weeks/module

48

shishir singhal27 years

B.tech (mechanical)uP technical university

specialization: marketing & Finance

Certified professionalDatastage

DB2 Database

cognos report net Product user Datawarehousing

level 1

5 years experience in it industry spanning Client relationship Management, requirement elicitation, project Management and it development

Data specialist - ibM india pvt limited• Interacted with client to understand the requirements and establish strategic relationship• Acted as a SPOC (Single point of contact) with the client and played an instrumental

role in getting high satisfaction rating• Project planning, establishing timelines, designing architecture, evaluating technologies

and providing guidance to the team members• Managed teams, kept track of schedule and assigned tasks• Trained and managed summer interns, new recruits and employees

software engineer - satyam Computer services limited• Understand requirements from business clients, prepare documents and propose

possible solutions• Used analytical tools to generate reports and provide analysis to help higher

management to take strategic decisions• Developed Data Stage jobs using Built-in stages and performed rigorous testing for

their correctness• Prepared the Test cases in Mercury Quality Center and mapped them as per the

business requirements

achievements• Co-foundedasocialwebsite-www.way2contact.com• Ratedas‘S’tarperformerinannualappraisalprocessofSatyamcomputers• PromotedtoTechLeadpositionwithin3monthsofjoiningIBM• Appreciatedonvariousoccasionsforexceedingclientexpectations

shailender Chauhan34 years

Be (electronics & communications)Bamu university



11 years of experience in it – account Management, project Management and Consulting

account Manager, prolifics - globallogic• Managed various IT initiatives for US client Prolific which included scoping, estimation,

planning, scheduling, risk management, communication and quality management • Apart from project management, responsibility included managing financial projection

for projects, invoicing and monitoring actual revenues from projects• Worked as a SCRUM master, responsibility included taking daily standup meeting,

removing any impediments and helped team achieve its full potential

project Manager – techMahindra pvt ltd.• Creation and maintenance of project metrics, estimation using FPA, RFP’s, risk

management and client communication• Responsibility included financial projection for the whole project, budgeting and

monitoring of operating margins of the individual projects• Responsible for growth of Team member in their respective roles by providing training,

guidance, motivating and mentoring them

program analyst - redbrigade uK • Project Leader for team of 10-12 members for a major UK Bank• Project rated CMM level 5 for successful implementation• Involved in Vendor management and overall quality management

achievements• Certification in SCJP, Portlet Factory and Portal Developer• Responsible for successfully implementing SCRUM in Project

49

sumit Kaul29 years

Bca Imc, new Delhi

PGDBm aIma


5.5 years of experience in process Migration, project Management, business analysis & Customer service operations

business executive - tata Consultancy services eserve• Led all end to end international migrations of a BFSI of Citi Bank N.A from Tampa

Florida, usa• Implemented ‘Time Tasking’ theory while managing Citi Group global window clients for

corporate accounts & research reports on daily, weekly & monthly basis• Reduced the resource cost of migration by implementing Cross Training & Time Tasking• Worked as process lead for new migrations, process implementations & client

interaction• Entrusted with the additional responsibilities of process automation by senior

management

technical Consultant - pel technology • Handled business development through analysis of client’s business processes and

identification of scope of improvement in key IT process areas• Analyzed requirements, model reviews, documents and provided timely report to

clients• Making pre sales presentations to prospective clients and involved in requirement

gathering and architecture design of It application

executive operations, technical - ibM Daksh india • Met satisfaction level & managed technical team and working on technical Issues, bug

fixing which involved 24/7 Technical production Support for Yahoo! Web Hosting global customers

• Consulted regularly by the manager on how to improve C-SAT (Customer Satisfaction) for the team and all major meeting sessions with clients

achievements• Recognized&awardedasbestexecutive&bestCSATachiever• Highly appreciated by the client for efficient handling of migrations & managingoperations

• Meticulouslyexceededproductivity,quality&customersatisfactionMetrics&SLAs

siddharth Khetawat29 years

Ies, IPsa, B.e. (cs) Indore


Certification ncFm (Depository module)

international experience30 months

7.8 years of global experience in i.t. project, people and performance management with leading financial services firm as clients.

project lead tata Consultancy service ltd. :• Lead a team of 15 people for critical banking I.T. Systems• Business relationship management at customer sides.• Responsible for development of Fully Managed Services model with one of Top 5 TCS

customers in north america Geography.• Co-ordination with senior management on both client and TCS end.• Attended special training for account managers role handling cross cultural teams.• Maintaining co-ordination with offshore deals for major deliverables and software

installation.• Resources management for new and existing programmes.

Module lead tata Consultancy services.• Worked with clients to define requirements.• For mulation of timely status report and billing for the customer.• Technology lead IBM mainframes.• Responsible for development and successful implementation of application solution

strategy for migration of critical legacy application to open source. this lead to major It savings for the customers.

• Successful Disaster recovery solution planning and implementation.

achievements :• ReceivedBestperformanceawardwithnamepublishedincustomerwebsiteandalsoreceivedcashamountfor1099implementation.

• ReceivedaccoladesforachievingCPUsavingviaapplicationoptimization.• Received accolades fromHR for organizingmany formal and informal gatherings atclientsiteforassociates.

50

swarnali bose28 years

B.tech (agri. engineering) J.n.K.V.V., Jabalpur


Certificationc.a.I.I.B (both parts) from

I.I.B.F

SBI Probationary Officer’s mDP from IIm, lucknow(sabbatical-available for

Placements)

5.5 years of experience in Marketing, business Development, Client relationship Management & Credit Management

treasury Marketing officer & Dealer - global Markets - state bank of india• B2B marketing of Structured products/ Derivatives for Corporate clients• CRM for Forex solutions- Hedging, FCNB loans, ECB arrangements• Provided advisory to key clients- market study & currency movements• Conducted extensive presentations & client education programmes for MCG credit

customers. trial generation & new market development• Merchant rate quoting for local & cross currency transactions

Deputy Manager, advances (officiating) - state bank of india• Key Account management in terms of corporate credit & Forex business• Managed appraisal of loan proposals of SME & MCG clients• Handled corporate credit products- WC financing, TL & project financing• Facilitated Forex business for existing credit clients- LC, BG, Buyer’s credit, ECB.

sWIFt handling. new business development

Marketing officer (agriculture) - state bank of india• Managed marketing of high value agricultural advances• In-charge of business development for 10 agriculture intensive branches

achievements• Keyaccountsmanaged-Haldiram’s,Techno India,DPSC ltd.,NatwarTracon(SPVofEmamigroup),GreenplyLtd.,GajaJewellery&LincPens.

• ForexTurnoverhandled-Rs.4612cr.Creditportfoliosize-Rs.217cr (Newbusiness-Rs.32.50cr)Crossselling-Rs.75.00lacs• Distinctionofhavingmotivatedfarmersforcropdiversification-creationofaclusterof5horticultureintensivevillages.EstablishedContractfarmingtie-upwithalocalsugarmillthroughStrategicB2Bmarketing

• CreditAuditratingimprovedfromB+toA+duringincumbency

susanta Dey35 years

Be (Instrumentation) Jadavpur university,

Kolkata



7 years of experience in sales & Marketing, business Development, Customer relationship Management as well as operations & Maintenance

Direct recruit Junior telecom officer - bsnl• Led service provisioning, activation, inventory release & order management for GSM,

3G, umts, eVDo, GPrs, 2000IX including Data cards & Blackberry for sanchar soft• Supervised a team of 17 involved in demonstrating product during special marketing

drives like road shows, telecom adalat & talk shows• Managed and coordinated with subscribers in front end and Operation of Customer

care node (ccn)• Spearheaded the distribution channel & coordinated with Direct selling Agents,

Franchisees as well as Bsnl Business partners• Addressed Value Added Service related subscriber issues & involved in online

marketing “sampark”• Assess impact of change in tariff rates & different plans on revenue• Initiated sales of 3G and EVDO data card service from CCN• Steered testing & maintenance of frequently used telecom devices like HLR (Ericssion,

nokia), switches (ocB-283), data cards

achievements• Meritofbeinganactivememberofthe‘ProjectVijay’teamwhichworksontheintensivemarketing and sales for general customers, franchisees, BBAs in GSM, 3G, UMTS,GPRS,EVDO,2000IX&Blackberryservices

• AnactivememberoftheTaskForcethatdealswithsystemrestorationprocessduringnaturalcalamities(Heavyrainfall,Strikes)onemergencybasis

51

tribhuvan Kumar28 years

B.tech (textile chemistry)Guru nanak Dev university,

amritsar


5 years of experience in production planning & control, supply Chain Management & Manufacturing operations

asst. Manager - raymond uCo Denim, yavatmal• Liaised with procurement, utilities and different departments for ensuring smooth

execution of operations• Managed inventory and raised purchase requisition• Formulated & implemented production & raw material plans• Resolved customer complaints and took corrective measures• Achieved cost reduction by maintaining a minimum level of raw material stock• Responsible for shade & new product development with new recipe and new chemicals• Conducted technical evaluation of chemical suppliers• In-charge of process control, quality control & quality settings of product• Active member of the ISO: 9001/2000 documentation & implementation program

achievements• Merit of having analysed consumption pattern of chemicals with respect to differentproducttypesanddevelopedasystemthathelpedreduceinventorylevelsby8%

• SuccessfullyimplementedPARETOanalysistoreducedyeingdefectsto2.2%fromtheprevalent4.2%

tapabrata guha roy29 years

B.tech (electrical)nIt, Kurukshetra

specialization operations & systems

6 years of diverse experience in software Development, software testing & power Distribution Management

senior systems engineer in infosys technologies ltd, pune • Conducted requirement analysis, created detailed design, coding, test script

preparation & execution, logged defects and retested them after the fixing in various business development projects

• Designed test plans and strategies, test cases and test scripts/procedures, tracked and reviewed test results & unresolved problems to ensure fulfillment of business requirements in a system testing project

• Led teams situated in various geographic locations for successful transition both for development & testing projects

officer in north Delhi power ltd, new Delhi • Analyzed the breakdown, provided preventive maintenance of ACBs, LT networks in

shifts and responsible for load forecasting, load balancing on distribution circuits• Headed a team of 5-6 members for maintaining uninterrupted power supply in an area

of 10000 consumers• Managed the metering and billing of an entire district of above 80000 consumers and

increased the efficiency of the process in every subsequent billing cycle• Coordinated with Enforcement & Projects team for AT&C loss reduction by infrastructure

improvement & theft reduction

achievements• ConfigurationControllerofatestingprojectinInfosys• Successfully completed a course on ‘Best Practices in Electrical Safety Procedure,AccidentPrevention&DisasterManagement’undertheDistributionReforms,UpgradesandManagement(DRUM)TrainingProgramofUSAID

52

Vishveshwar pise27 years

B.e. (electronics & telecom)

amaravati university


Microsoft Certified Professional

5.1 Years of experience in Project management, software Development & consulting

Consultant - Capgemini Consulting india pvt. ltd, Mumbai• Steered the technical team of 8 for Order Management System (OMS) of a leading

telecom company in Europe, US $ 16 billion revenue• Managed project estimates, global delivery model, scheduling, resource loading, time

management & project status dashboard for reporting to higher management• Involved in creation of RFP (Request for Proposal) for new projects, Business Analysis,

Presales, mPP (microsoft Project Planning) and internal auditing• Highly appreciated for successful customer relationship and efficient coordination

within teams• Successfully executed development and maintenance of critical projects

programmer analyst - Cognizant technology solutions, pune• Managed IT system project for leading American Bank of portfolio worth US$ 33 billon• Serviced as Single point contact for BFS PMO Team at Cognizant• Developed financial dashboard for top management, saving up to 40% time for report

generation• Member of SME (Subject Matter Expert) team in BFS domain and Microsoft Technologies• Meticulously reengineered PunePMO application resulted into faster performance and

improved uI

software engineer – usit Consulting pvt. ltd, pune• Managed successful end to end smooth delivery of IT systems to the client• Responsible for complete SDLC, DR, CR and UAT• Achieved zero defect level in web application development

achievements• Wontheprestigious“StarPerformanceAward”atCognizantTechnologyServices• MeritofbeingCognizantCertifiedProfessionalinFoundationCourseonBankingDomain• MeritofbeingCertified“MainframeApplicationProgrammer”

udai singh33 years

Be (mechanical)aligarh muslim university

mcm lucknow university


9 years of experience in sales & Marketing (b2b & b2C), business Development, Client relationship Management & team Management.

sales Manager- iCiCi prudential life insurance• Headed direct sales & marketing as well s distribution activities of the assigned region• Led efficiency of different Direct Marketing Channel (Internet, Cold Calling, Upsell,

Affinity Sales, and IBANK Credit Card Channel)• Ensured compliance with internal policies and procedures

sales Manager – Kotak life insurance• Led the front-line team through target setting and reviewed measures• Generated and maintained MIS for tracking performance

account executive - HCl infosystems ltd.• Managed sales, business development and consultation activities of the Area Office

(covering 13 Districts of central uttar Pradesh)• Developed new clients through direct corporate/Institutional and dealers• Handled PC_ Workstation, Servers products of HCL and other Partners as well as met

specific requirements of clients in terms of Networking and System Integration

achievements• PivotalinestablishingDirectMarketingChannelofKanpurandMeerut• With inyearofstartupMeerutbecameno.2 inCategoryCcities intermsofTargetvsAchievement

• Certificate of Recognition for Employee Retention and ProcessManagement for thefinancialYear2008-2009fromRegionalManager&VicePresident(DirectMarketing)

• SuperAchieverfortheMonthShieldfortheMonthofJune08,July08,Dec08andMarch09• DuringthetenureinHCLaddedmorethan30newclients,whichresultedinexponentialgrowthinbusiness

53

writankar Kundu30 years

Be electrical & electronics Vtu, Karnataka

specialization Finance & systems

Certifications:Salesforce.com Certified

authorized level II consultant

international exposure:2 months

5.2 years of it development & domain experience in delivering Cloud solutions across various verticals as a techno-functional consultant.

Consultant – CrM, Cognizant technology solutions india limited, Kolkata. • Part of the first team of 5 members which formed the Cloud Solutions Group across

cognizant as part of the customer solutions Practice (csP)• Was part of the business team as a Technical Subject Matter Expert which helped to

clinch a US$ 2 million deal with Dow Jones & Co. in New Jersey, USA. This was the very first & the highest revenue (2008) deal struck for the Cloud Solutions Group

• Conducted PoCs & feasibility studies on implementing SalesForce.com as on-demand hosted crm solution in place of conventional software for different clients spanning across verticals like Banking & Financial services, Information, media & entertainment and Pharmaceuticals

• Project Lead for a project of 10 associates spanning across different locations in India & USA. Responsible for final delivery & quality assurance

achievements • Authorized Salesforce.com Consultant & Administrator. Successfully cleared theConsultantAuthorizationLevelIIExam

• Co-authored two papers titled, “Towards Low-cost handsets: Engineering financialstrategies for mobile value-added services market proliferation” and “Strategies forintroducinglow-costphones:Afinancialperspectiveofbusinesspartnershipsbetweenhandset makers and service providers”, IEEE Transaction Letters on ConsumerElectronics,California,September2008

• Co-authored a paper titled, “Studying computations with arbitration in multi-radiosupportive asynchronous processor datapaths”, in proceedings, InternationalConference onModelling and Simulation,MS-07, Post-Centenary Golden Jubilee ofUniversityofCalcutta,DepartmentofAppliedPhysics,December3-5,2007.

Vivek Vinodkumar bhola28 years

Be (electronics & telecommunications)

amravati university

specialization Finance & systems


5.5 years of it experience project Management, software Design, Development and Maintenance.

associate - Cognizant technology solutions, pune & Hyderabad• Managed projects for key clients from BFSI & Insurance domain, viz. Credit Suisse, JP

morgan, Washington mutual, metlife, and americhoice• Extensive work on various stages of SDLC• Responsible for high quality project deliverables and direct communication with the

client in Beta engine• Steered the technical team for Credit Suisse Bank’s Beta Engine Application on Pricing

service and FIX engine used for securities trading• Independently developed reflection based dashboard application for maintaining

pricing service and FIX engine• Involved in R & D activities on new technologies ex: service virtualization• Worked on technologies like SSRS, SSIS & SSAS, .Net 2.0, 3.5, C#, SQL Server 2008,

oracle 9i, VBa, VB 6, WcF. WPF, Web service, Web & Windows apps• Led a team of 2 members in redesigning UTD project at offshore

ad-Hoc lecturer - g.H. raisoni College of engineering, nagpur• Delivered lectures on Electrical Engineering material & Semiconductors and Electronic

circuit Designing

achievements• Certificationofclient’snewbrokersfortradingviaFIX• Achievedconsistent2ndbucketratingthroughout5years• ClientAppreciationcertificatefromWashingtonMutualBank• CognizantCertifiedProfessionalinFoundationCourseonbanking(level0)• CognizantCertifiedProfessionalinMortgageBanking(level1)

54

chief Guest mr. Vijay mallya, chairman uB Group & mr. Kamal nath, President Imt Ghaziabad at Imt convocation 2010 held on 20 march, 2010

chief Guest mr. anand G. mahindra, Vice chairman & managing director, mahindra & mahindra ltd at Imt convocation 2009 held on 21st march 2009.

ConVoCation at iMt

55

proCess start Date enD Date Duration loCation

Pre Placement talk 26th march ‘11 25th april ‘11 31 Days Imt, Ghaziabad

Final Placement 2nd may ‘11 6th may ‘11 5 Days Imt, Ghaziabad

Placement process commences with the Pre – Placements talks (PPt) by recruiters to the students, about their organization,

profile expectations and positions for offer. Participating organizations will conduct the interviews during final placement week.

During the final placement week our participants will be exclusively focused on exploring career opportunities.

registration

companies can register their participation by sending an email to [email protected] . Interview dates in the above mentioned

schedule will be decided on the basis of mutual convenience.

ContaCt Details

Mr. praKasH patHaK – HeaD, Corporate relations

Email : [email protected]

Mobile : +91- 9811163609

Phone : + 91 -120 3002211

Ms. niDHi CHowDHry - Manager, plaCeMents

Email : [email protected]

Mobile : +91- 9818156243

Landline : +91 -120 -3002362

Fax : +91-120-2825020/2827895

pgDM (exeCutiVe) plaCeMent CalenDar 2011

56

E-Mail : [email protected]

Phone : +91-120-3002255/3002258/2825131

Fax : +91-120-2825020/2827895

Ashima Kakar : +91- 9818594494

Gagan Bhatia : +91- 7838590008

Kartik Venkat : +91 -7838590229

Parag Dabadhe : +91- 8800804568

R.Kathirvelmurugan : +91-7838590241

Shailender Chauhan : +91-9910130947

plaCeMent CoMMittee

57

Imt is located close to the national capital i.e. new Delhi which is very well-connected with all possible corners of the world and India. large number of International flights fly from various cities across the world daily into Delhi.

Imt Ghaziabad is just 45 kilometers from the Indira Gandhi International (IGI) airport, new Delhi.

How to reaCH us

58

Please contact us at :

Mr. Prakash Pathak – Head-Corporate RelationsE-Mail : [email protected] I Mobile : +91-9811163609 I Phone : +91-120-3002211

Ms. Nidhi Chowdhry – Manager, PlacementsE- Mail : [email protected] I Mobile : +91-9818156243 I Phone : +91-120-3002326

Fax : +91-120-2825020/2827895

Placement CommitteeE-Mail : [email protected] I Phone : +91-120-3002255/58 I Fax : +91-120-2825020/2827895

www.imt.edu

IMT Placement Brochure 2011

Documents