Top Banner
GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES: SEASON THREE 1. ADMINISTRATION, SCHEDULE, IRREGULARITIES ADMINISTRATION YEARLY SCHEDULE AND 40-MAN ROSTERS WEEKLY SCHEDULE AND SCORING GAME PLAYING ERRORS STATISTICS ROSTER MOVES UPDATED ROSTERS 2. RULES FOR PLAYING THE GAME HANDLING THE FAST ACTION CARDS (FAC) PITCHER’S STUFF NORMAL PLAY PLUS / MINUS RATINGS PITCHER’S STAMINA INFIELD POSITIONING RUNNERS ADVANCING ON BASE HITS TRIPLES DEFENSE OPTION PLAY CHART ADVANCING ON FLY BALLS STOLEN BASE CHART HIT AND RUN CHART BUNTING FOR BASE HIT FIELDERS OUT OF POSITION 3. VISITING MANAGERS INSTRUCTIONS HEAD TO HEAD GAMES PLAYERS ON BOTH TEAMS IN GAME STRATEGY RELIEF PITCHING 4. ROSTERS INNINGS / PLATE APPEARANCES ROSTER MOVES PITCHER’S REST 5. ALL-STAR GAME 6. POST SEASON PLAYOFF STRUCTURE PLAYOFF PLAYING RULES Updated January 5, 2016
47

GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... •.....

Mar 14, 2018

Download

Documents

phammien
Welcome message from author
This document is posted to help you gain knowledge. Please leave a comment to let me know what you think about it! Share it to your friends and learn new things together.
Transcript
Page 1: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

GREATAMERICANFANTASYBASEBALLLEAGUERULES:SEASONTHREE

1. ADMINISTRATION,SCHEDULE,IRREGULARITIES• ADMINISTRATION• YEARLYSCHEDULEAND40-MANROSTERS• WEEKLYSCHEDULEANDSCORING• GAMEPLAYINGERRORS• STATISTICS• ROSTERMOVES• UPDATEDROSTERS

2. RULESFORPLAYINGTHEGAME• HANDLINGTHEFASTACTIONCARDS(FAC)• PITCHER’SSTUFF• NORMALPLAY• PLUS/MINUSRATINGS• PITCHER’SSTAMINA• INFIELDPOSITIONING• RUNNERSADVANCINGONBASEHITS• TRIPLES• DEFENSEOPTIONPLAYCHART• ADVANCINGONFLYBALLS• STOLENBASECHART• HITANDRUNCHART• BUNTINGFORBASEHIT• FIELDERSOUTOFPOSITION

3. VISITINGMANAGERSINSTRUCTIONS• HEADTOHEADGAMES• PLAYERSONBOTHTEAMS• INGAMESTRATEGY• RELIEFPITCHING

4. ROSTERS• INNINGS/PLATEAPPEARANCES• ROSTERMOVES• PITCHER’SREST

5. ALL-STARGAME6. POSTSEASON

• PLAYOFFSTRUCTURE• PLAYOFFPLAYINGRULES

Updated January 5, 2016

Page 2: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

ADMINISTRATION,SCHEDULE,IRREGULARITIESADMINISTRATION

1) TyWatermanistheGAFLCEO.Astheleaguefounderandchiefexecutive,heisultimatelyresponsiblefor:

a. Calculationofallplayercardsandtheproductionanddistributionofthem.b. Thepaymentofallexpenses,andthecollectionofannualduestounderwrite

thoseexpenses.c. Determiningtheteamsthatwillplayeachseasonandthestructureofeach

seasond. Recruiting,training,andsupervisingmanagerse. MakingnewcardsattheendofeachMLBseasonattherequestofmanagersf. Administratingtheleagueanditsday-to-dayoperationsincludingthe

schedule,deadlinesforplayingandreportinggames,collectingtheboxscores,compilingstatisticsandstandingsandotherreportsandcommunicationofinformation.

g. Determiningwhenareplaymightbeappropriateh. Adjudicatingdisputeswhenappropriate.

2) TheCEOcandelegateanyorallofhisresponsibilitiesforanylengthoftimeforanyreasontowhateverothergrouporindividualhetruststocarryoutthoseduties.

3) Arulescommitteewillclarifyandhelpadjudicatemattersrelatedtotherulesofplay.TheCEOhasinputintothecommittee'sdeliberations

4) Therulescommittee(5members)willhelpresolvemattersrelatedtoleaguepolicyorprocedures,includingappealsofgames(seeappeals,rule29).TheCEOhasinput,ifhechooses.

5) Theeligibilitycommittee(3members)willmakedecisionsonplayereligibilitymatterswithinputfromCEO.

6) TheCEOhasauthoritytocallforaleaguevoteonanymatter.AvotealsocanberecommendedbytherulescommitteeortheEligibilityCommittee

YEARLYSCHEDULEAND40-MANROSTERS

1) GameswillbeplayedfromlateNovemberthroughSeptember,withanoffweekorweeksfortheChristmasandThanksgivingholidays.Acomputerizedschedule,developedbyGaryMcIntosh,modifiedtoincludeinterleaguegames,willbeusedforGAFLSeasonThree.

2) PlayerswhohaveplayedallorpartoffiveMLBseasonswithanMLBclubwillbeeligibletoplayforthatteaminGAFL,aslongastheplayerhad140ormoreplate

Updated January 5, 2016

Page 3: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

appearance,50inningspitchedasastarter,or30inningspitchedasareliever,ineachyearwiththeMLBclub.

a. 1961-62expansionteamsareallowed4fouryearplayers;b. 1969expansionteamsareallowed5fouryearplayers;c. 1977expansionteamsareallowed7fouryearplayers;d. TheRockies,Diamondbacks,RaysandMarlinsareallowedunlimitednumber

offouryearplayers,butmustreplacefouryearplayersiffiveyearplayersareavailable.Fiveyearplayerscannotbedroppedforfouryearplayers.

3) ForSeasonThree,therewillbeanOriginal(8teams)andExpansion(7teams)ineachleague.InterleaguePlaywillincludetwogamesvs.eachteaminthesamedivision.

4) ThedesignatedhitterwillbeusedintheALbutnotintheNL.ThedesignatedhitterwillbeusedinanyinterleaguegamesplayedinanALpark,includinganyAll-StarGamesandpost-seasongames.TheDHcanneverbeusedinanNLhomepark.AnyteamcanoptoutofusingaDHatanytime.

WEEKLYSCHEDULEANDSCORING1) Eachteam’ssetofstartingpitchersshouldbeemailedtoTybeforeaseriesbegins.2) ChangesinstartingassignmentsareallowedduringeachseriesaslongasTyis

notifiedby8p.m.EasterntimeTuesday.3) Eachteam’slineupandinstructions(ifitisasolitairegame)shouldbeemailedto

theopposingteamandcopiedtoTybyThursdayofgameweek.4) Gamesshouldbeplayedandscoresheetsfaxed,mailedorscannedtoTyby8p.m.

Tuesday,Easterntime.a. FollowTy'ssystemforscoringascloselyaspossible.b. Markgreatfieldingplayswithredstars.ThesewouldincludeallCDchart

playsandafewothersspecifiedoncharts.Giveoneredstarforeachgreatplay.ThiswillcreatetheGAFLGoldenGloveswinners.

c. Marknotableoccurrencesofanysortin"Comments"section.d. IncludenamesofthethreeMVPse. HometeammustsendscoresheetstoTyandvisitingteammanagerASAP

withincompletionofthegame.f. Thecurrentmajorleaguesaverulewillbeused.

5) Hometeamshouldwriteasummaryofthegamehighlightsandpostongroupe-mailwithin24hoursofcompletionofthegamebutnolaterthan8p.m.EasterntimeTuesday.

6) Ifateamcannotplayitsscheduledhomegameduetovacation,illness,orotherpersonalreasons,thevisitingteammanagerwillplaythegame,andinthatcasehavealltherightsofahomemanager.Ifneitherthehomeorvisitingmanagercanplaythegame,Tyhastheauthoritytoplayit,asalastresort,ifbothmanagersprovidelineupsandinstructions.

Updated January 5, 2016

Page 4: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

GAMEPLAYINGERRORS1) Twotypesoferrorsaremostcommon(Bothkindsoferrorsarecommonandin

mostcasescanbecorrected.)a. Themanagerforgetstofollowarulecorrectly.b. Themanagerdoesnotcorrectlyfollowthevisitingteammanager’s

instructions.2) Ifamanagerplayingsolocatchesamistakeafterthefactbutbeforehehasturnedin

thegameresults,heshouldgobackandcorrectitandreplaythegamefromthatpoint,nomatterwhichteambenefitedfromthemistake.

3) Ifeithermanagerinahead-to-headgamecatchesamistake,thegameshouldbereplayedwiththeerrorcorrectedfromthepointatwhichtheerroroccurred.

4) Ifanerrorisdetectedafterthegameresulthasbeenannounced,andtheresultnegativelyimpactsthevisitingteam,thegamewillbereplayedfromthepointoftheerror,withtheresultcorrected.Butifthevisitingteamwinsbecauseofamistakebythehomemanager,thereisnoreplay.

5) Ifthereisadisputeabouthowthegamehasbeenplayed,itshouldbebroughtfirsttoTy’sattention.Inothercases,Tymayseeaproblemwhenexaminingtheboxscore.Ineithercase,Tywillattempttoadjudicate,withthegoalofmediatingadecisionwithoutaformalprotest.Hecanconsulttherulescommitteemembers.

6) IfBaltimoreisinvolvedinaprotest,rulescommitteechairmanSteveKreviskywillbrokertheissue,sendingitonforarulescommitteevoteonlyifthegameisofficiallyprotested.

7) Ifagamedisputecannotberesolvedby8p.m.EasterntimeonTuesday,Tycanextendthedeadlineto10p.m.Wednesday.Ifnotresolvedbythen,thegamemighthavetobesuspendedandcompletedatalaterdate.

8) Ifeitherteam’smanagerfeelsthedecisionisunfair,hecanfileanofficialappeal.Therulescommitteewillmakearuling.Anymemberoftheboardinvolvedinthegamemustexcusehimselffromthedecision.

9) Groundsforareplayincludetheuseofanineligibleplayer(aninjuredplayer,aplayernotonthecurrent25-manroster,oraplayerwhohasuseduphisavailableinnings,plateappearances,orisplayingapositionforwhichhehasuseduphisavailablegames).Butforfeitsshouldbeavoidedifatallpossible.Inmostcases,thehomemanagerwillreplaygamesfromthepointthatanineligibleplayerenteredthegame.

STATISTICSTywillreportteamandleaguestatisticsatregularintervals.

Updated January 5, 2016

Page 5: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

ROSTERMOVESAllrostermoves(sendingaplayerdownfromthe25-manroster,callups,DL)shouldbereportedimmediatelytoTy.RosterMoves/InjuryListswillbeannouncedweeklybyBarryMednick(A.L.)andJohnFerguson(N.L.)UPDATEDROSTERSEachOctober,managerswillhavetheopportunitytochangetheir40-manrosterstoaccommodatethereleaseofnewcardsorforotherreasons.

Updated January 5, 2016

Page 6: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

RULESFORPLAYINGTHEGAMEHANDLINGTHEFASTACTIONCARDS(FAC)

1) Beforegameplay,spreadeachdeckseparatelyonthefloorortable,flippingthemrandomly.Pickthemuprandomlyandmakeapilefromtopandbottom,turningcardsoversothattheyarenotallfacingthesamewayastheylandedonthefloor.Donotshuffle.

2) Whenyouhavemadethefirstdeck,placeacardboardcoverovertopcard,withthe"1"intheupperleftcorner.Lightlyputa"1"inpencilontheupperleftcornerofthetopcard,withoutrevealingthecardresults.Thenmakeaseconddeck,coverandmarka2inpencilintheupperlefthandcornerofthetopcard.

3) TWODECKSWILLBEUSEDFORGAMES.4) WhendeckNo.1isdepleted,pickupthediscardpile,flipitoverandtwist

ithalfway.Marka3inpencilintheupperlefthandcorner.Donotusesidethreeuntiltheseconddeckiscompleted.

5) Thenusetheseconddeck,markingatwointheupperlefthandcorner.6) Onthethirdandfourthtimesthroughthetwodecks,againflipover,markanumber

andtwistthediscardpile.PITCHER’SSTUFF

1) Beforebeginningplay:a. DrawacardandlookattheRandomNumber(RN)todeterminethevisiting

pitcher’sstuff.b. DrawanewRNtodeterminethehomepitcher’sstuff.c. DrawanewRNtodeterminestuffeachtimeapitchercomesintothegame.d. AstartingpitcherhasamaximumofPB:2-10andaminimumofPB:2-5to

startthegame.AreliefpitcheralsohasamaximumofPB:2-10andaminimumofPB:2-5whendeterminingstuff.

2) StuffDrawRangesa. RN11-14:Greatstuffforastartingpitcher.Add2tohisPBrating.Fora

reliefpitcher,addonetohisPBrating.Arelievercannothavegreatstuff...andcannotaddmorethanonetohisPBrating.Nopitchercanimprovehisstaminatobetterthan2-10.

b. RN15-18:Goodstuffforallpitchers.Add1tohisPBrating.c. RN21-78:Normalstuffforallpitchers.NochangetohisPBrating.d. RN81-84:Badstuffforallpitchers.Subtract1fromhisPBrating,butno

pitchercanfallbelowaPB-5fromdrawingbadstuff.e. RN85-88:Terriblestuffforallpitchers.Subtract2fromhisPBrating,butno

pitchercanfallbelowaPB-5tostarthisappearance.

Updated January 5, 2016

Page 7: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

3) IfastartingpitcherhasBadorTerribleStuff,hecannotberemoveduntilhecompletesfiveinnings,unlesshisstaminafallsbelowzero.

4) IfareliefpitcherhasBadorTerribleStuff,hecannotberemoveduntilhecompletestheinningheenteredthegame,unlesshisstaminafallsbelowzero.

a. EXCEPTION:Whenareliefpitcherisbroughtintothegame,themanagermayannouncethatheisbeingbroughtintothegametofaceonlyonebatter.Anyhomemanagercanmakesuchanannouncement,ascaneithermanagerinahead-to-headgame.Avisitingmanagementcanspecifyapitcherbesousedinhiswritteninstructions.

5) Pitcherscannotenterthegamewithouttheproperamountofrest.Iftheysurpasstheirrestlimitswhileinagame,theycanstayinthegamebuttheirPBdropsby2immediatelywiththenextbatteraftertheyreachtherestlimitsduringthegame.

NORMALPLAY

1) TurntheFACandcheckPBtodetermineifplaygoesontopitcher'sorbatter'scard.2) IfthePBisanumber(2-12),determinewhetherthebatterorpitchercontrols.The

pitchercontrolsanyPBthatfallswithinhiscurrentrange.Thebattercontrolsanythingoutsidethatrange.

3) PickanewFACandreadtheRandomNumber(RN).4) IftheRandomNumberiswithintheOutrangeonpitcher'sorbatter'scard,then

lookattheOutSequenceatthebottomoftheNEXTFACforthecorrecttypeofbatter(LN,LP,RN,RP,SN,SP).Refertotheappropriateoutchartforresultsoftheplay.

5) IfaWP(wildpitch)orPB(passedball)occursonapitcher’scardandnorunnersareonbase,startoverwithanewFACasin2.3.1.Ifanyoneisonbase,drawanewFACandcheckresultsunder“Pitch.”If“yes,”allrunnersadvanceonebaseontheWPorPB.If“no,”resumenormalplaywithanewFAC.

a. IfthepitcherhastwoPBorWPnumbersandthesecond(higher)ofthosenumbersisdrawn,anycatcherwithaCD-4makesagreatstopandplayresumeswithanewFAC..Forallothercatchers,checkfortheWPorPBasabove.

6) Iftheresultisafractionalnumber,useaRANDOMNUMBERGENERATOR(1to100)todeterminetheresultoftheplay.Iftheresultingnumberisabovethedecimalrange,theplayisanout;checkthenextFACfortheOutSequenceandcontinueasusual.

7) CheckingForErrorsa. Donotcheckforerrorsonhitsoffpitcher’scards,orforhitsonBD,CD,or

othercharts.b. Therearenoerrorsoninfieldhits

Updated January 5, 2016

Page 8: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

c. Ifthereisasingleoradoubleoffabatter’scard,getanewFACandcheckforanErrorbythefieldertheballwashitto.Ifthereisatriple,thehometeamwilldesignatethefieldertheballishittobeforethereisanerrorcheck.Anerrorismadeifthefielder’serrorratingfallswithinthenumberslisted.Ifitisanerror,lookatthenextFACandcheckforTYPEoferror.ThencheckErrorSequenceatthebottomoftheappropriateOutChartforthefinalresult.

d. IfthereisanasterisknexttotheplayontheOutSequence,drawanewFAC.IfErrorsays“none,”consulttheoutchartfortheresultoftheplay.Ifthereisanumberrange,anerrorismadeifthefielder’srangefallswithinthenumberslisted.

e. Ifthereisanerroronagroundball,getanotherFACandcheckforTYPEoferror.ThencheckErrorSequenceatthebottomoftheappropriateOutChartfortheresult.

f. Ifthereisanerroronaflyballtotheoutfield,donotpickanewFACtocheckforerrortype.Onadroppeddeepflyball(FD*toanyfield),consultERRORRULEchart:DROPPEDFLYBALLorLINEDRIVE.

g. Forerrorsoninfieldflies,linedrives,andfoulpop-upstocatcher,consultERRORRULECHART:DROPPEDFLYBALLSorLINEDRIVE.

8) IfthePBisaBDandnomenareonbase,itisafoulball.DrawanewcardandgetanewPB.IfaBDispickedwithmenonbase,getanewFAC,andcheckthenewRNnumberonthebattersBDratingsonhiscard.Ifnoactionoccurs,itisanotherfoulball.DrawanewPBandproceedfromthere.

9) IfthePBisaCDandnomenareonbase,ignoreanddrawanewPB.IfaCDisdrawnwithmenonbase,getanewFAC,andcheckthecardforwhatfielderisinvolvedintheCDplay.ThendrawanewFACandchecktheRNinClutchFieldingchart,usingthefielder’sCDrating.Ifitisafoulball,drawanewFACandproceedfromthere.

10) IfthePBisaZ,getanewFACanduseitsRNtofindtheresultontheZ-wildplaychart.FollowtheZ-chartinstructions.PickanewFACandnewRNifsenttotheZ-FieldingorZ-Injurycharts.

a. Ifplayinginadomedstadium,ignoreanyrainoutandresumeplay.Otherwisestoptheplayandreporttherained-outgame.ThedomedstadiumsincludeSeattle,Houston,TampaBay,Arizona,Milwaukee,butTorontoisplayinginExhibitionStadium.Anyteaminadomedstadiumcanannouncetheyareplayinginapriorstadiumthatisnotdomed,iftheysodesire,butmustannouncesuchbeforethegamestarts.

b. Ifaninjuryoccurs,pickanewFACandgettheRN.ConsulttheZInjuryChart.PickanewFACandnewRNtodeterminethelengthoftheinjury,usingtheinjuryratingsoftheplayer(s)involved.

Updated January 5, 2016

Page 9: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

11) Ifapitcherwhodoesnothaveabattingcardcomestobat,drawanFACandusethepitchersgenericbattingcard.Makecertainyouknowifthebatterisalefty,rightyorswitchhitter.

SPECIALADJUSTMENTSTORESULTS:PLUS&MINUSRATINGS

1) Ifthereisaminusstrikeoutonabatter’scard,subtractfromthehighendofthepitcher’sstrikeoutrange.IftheRNfallsoutsidetheadjustedstrikeoutrangetheresultisabattedout.Thepitcheralwayscontrolsthefirstwholenumberonhisstrikeoutrange,andthatcannotbetakenawaybyabatter’sminus-Krating.However,abatter’sKratingorBBratingcanbetakenawaybytheplushomerunratingofthepitcher.

2) Ifthereisaminuswalkonabatter’scard(rareformostbatters,verycommonforpitcherswhoarebatting),subtractfromthehighendofthepitcher’swalkrange.IftheRNfallsoutsidetheadjustedwalkrangeitisnotawalk.Thepitcheralwayscontrolsthefirstwholenumberonhiswalkrange,andthatcannotbetakenawaybyabatter’sminus-walkrating.

3) IfthepitcherhasaminusPHRrating,reducethehitter’sHRchancesbysubtractingthePHRfromthehighendofthebattersHomeRunrange.However,abatter’shomerunratingcannotbereducedbymorethanhalf.AhomerunthatistakenawaybecomesaDOUBLE,allrunnersscore,noerrorcheck.IfthedrawwouldhavebeenanoutbeforetheminusPHRratingreduction,itisstillanout,notaDOUBLE.

4) IfthepitcherhasaplusHRrating,increasethehighendofthebatter’shomerunchancesbythatamount.However,abatter’shomerunratingcannotbemorethandoubled.

5) Someveryweakhittingpitchershaveminussingles.IfapitcherwhoisbattinghasaMinus-1Bonhishittingcard,hecannotgetthathitonhisowncardandtheamountisdeductedfromthehighendoftheopposingpitcher’ssinglesnumbers.Thiswillresultinthepitchergivingupfewersinglesandturningthemintoouts.Asingletakenawaybyaminussingleturnsitintoanout;consulttheOutSequenceonthenextcard.

Updated January 5, 2016

Page 10: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

PITCHER’SSTAMINA1) Useaseparatesheettokeeptrackofpitcher'sstamina.2) Subtractonepointfromthepitcher'sstaminaratingforeach:

a. Singleb. Earnedrun

i. DoNOTsubtractforanyunearnedruns.Ifit'snotclearwhetherarunwillendupbeingunearnedornotbecauseofanerrorearlyinaninning,assumeitisunearnedforpurposesofcalculatingstaminauntiltheinningisover.

ii. InheritedrunnersdoNOTtakeoffapoint.c. Walk

i. IntentionalwalksdoNOTtakeoffapoint.d. Stolenbase

i. Multiplestolenbasesonthesameplayonlytakeawayonepointofstamina,whileastolenbaseandanerroronthesameplaytakeawaytwopointsofstamina.

e. Errorf. Wildpitchg. Hitbatsmanh. Passedball.

3) Subtracttwopointsforadouble.4) Subtractthreepointsforatriple.5) Subtractfivepointsforahomerun(4pointsforthehomerun;onepointforan

earnedrun).Exception:Iftherunisunearned,thehomerunis4points(nopointfortherun).

6) Unlessthevisitingmanagerinasolitaregameinstructsotherwise,visitingpitchersmustleavethegamewhenstaminafallsbelowzero.

7) Whenthepitcher’sstaminafallsbelowzero,eachpointbelowzeroisdeductedfromthepitcher’sPBrating.So,ifa2-8pitcher’sstaminadropstoMinus2,thepitcherwouldbepitchingasa2-6.

8) Staminacannotcausethepitcher’sratingtofallbelow2-2;inotherwords,eventhemosttiredpitcherstillcontrolsanyPBdrawsof2.

INFIELDPOSITIONINGIfthevisitingmanagerfailstospecifyotherwise,thevisitingteamplaysitsinfieldbackinallsituationsexceptthoseinwhichthescoreistiedandthego-aheadrunisonthirdintheseventhinningorlater.Playingtheinfieldinmeansallfourinfielderareplayingin.However,amanagermayplayhiscornerinfieldersinwhileleavingtheshortstopandsecondbasemanback.

Updated January 5, 2016

Page 11: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

RUNNERSADVANCINGONBASEHITS

1) DeterminethetypeofhitbycheckingtherandomnumberofthesameFACthatproducedthehit.Ifthenumberisdivisibleby12,it'saTexasLeaguer(Type#1).Ifdivisibleby4butnotby12,it'saBloop(Type#2).Ifit'sanoddnumber,it'sNormal(#3).Otherwiseit'saSmash(#4).

2) Runnersmaynevertakeanextrabaseoninfieldsingles.3) UseRunnersAdvancingonBaseHitschart.Crossreferencetherunnersspeed

(OBR)withtheoutfielder'sarmandcheckthetypeofhit.Ifattemptingtoadvance,drawanewFACandgetarandomnumbertoseeifrunnerisoutorsafe.Anynumberhigherthanthebaserunner’sadjustedsaferangeisout.

4) Withtwoouts,therunners’chancesareadjustedbyaddingtheamountsinTableVIaccordingtotypeofhit.

5) PitcherswithouttheirownoffensivecardsareOBRE.6) Unlessthevisitingmanagerspecifiesotherwise,runnerswillattemptstoadvance

anysafechanceof60orhigher.7) OBRA,B,orCrunnersonfirstautomaticallyadvancetothirdbaseonanythrow

home.However,amanagerofthedefensiveteamcanelecttolettherunscoreandtrytothrowtherunneroutatthird,usingtheruleabove,tocalculatethechances.Ifarunneristhrownoutatthird,therunstillscores.(Inagamethatisnotplayedhead-to-head,onlythehomemanagerhasthisoption.)

TRIPLESHomemanagerpickstheOFpositionthetripleishitto.Inhead-to-headgames,thedefensivemanagerpickstheoutfielder.DEFENSIVEOPTIONPLAYCHART

1) ThischartisusedwitharunneronthirdandtheinfieldinwhencalledforonanOutChart.Themanageroftheteamatbatdecideswhethertosendtherunnerhome.

2) Unlessthevisitingmanagerspecifiesotherwise,allOBRArunners,butnootherrunners,willattempttoadvanceontheDefenseOptionPlayChart.

ADVANCINGONFLYBALLS

1) ReferecetheproperTaggingUpOnFlyOutsChartandfigureaccordingtoinstructionsonchart.

Updated January 5, 2016

Page 12: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

STOLENBASECHART

1) Ifthemanagerattemptstosteal,pickanFACandusetheRNandtheStolenBaseJumpCharttodeterminewhethertherunnergetshisjump.Iftherunnercan’tattemptasteal,hemustwaitonebatterbeforetryingagain.Leftiesreducetherunnersjumpratingonelevel.

2) DrawasecondRNtodeterminewhetherthestealissuccessful,consultingtheStolenBaseChart,usingtherunner’sstealsuccessrating.

3) PitcherswithoutabattingcardareE/Ebasestealers.4) Foradoublesteal:

a. First,determinewhethertheleadrunnercangethislead.i. Ifhecannot,noonecansteal.

b. Iftheleadrunnercangethislead,nextdrawanewRNtoseeifthetrailrunnercangethislead.

i. Ifthetrailrunnerdoesnotgetalead,heisheldandonlytheleadrunnermayattempttosteal.

c. Ifbothrunnersgettheirleads,theopposingmanagercandeterminewhichbasetothrowto.

d. PickanewFACandRNanddeterminetheresult.Iftherearenoinstructionsbytheopposingmanager,theplayisontheleadrunner.

e. Ifaplayismadeontheleadrunner,thetrailrunnerautomaticallyadvances;iftheleadrunnerwasout,thetrailrunnerdoesnotgetcreditforastolenbase(andnostaminapointsaredeductedfromthepitcher).Iftheplayismadeonthetrailrunner,theleadrunnerautomaticallyadvancesandgetscreditforastolenbase.

HITANDRUNCHART

1) ThehitandruncanonlybeusedwitharunneronfirstorrunnersonFIRSTANDSECOND.

2) Whenahitandrunisdeclared,drawaPBtoseewhocontrolstheplay.a. Usethepitcher'sPBratingatthetimeofthehitandrun,MINUSTWO.(A

PB:9pitcherbecomesaPB:7;aPB:8pitcherbecomesaPB:6,etc,vs.thehitandrun.)

3) IfthePBisaZ,CD,orBD,theplayishandlednormally.4) IfthePBfallsintothepitcher'sPBrange,MINUSTWO,aRNisdrawnandtheresult

readoffthepitcher'scard,withthesemodifications:a. SINGLES:Allrunnersadvancetwobases;onebaseoninfieldsingles.Don’t

usebaserunningchart.Noerrorcheck.

Updated January 5, 2016

Page 13: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

b. STRIKEOUTS:Batterstrikesout.Baserunner(s)getanautomaticjumpandmustattempttosteal.Userunnersstealratingtodetermineastealattempt.Withrunnersonfirstandsecondthereisthepotentialforadoublesteal.

i. IFTHEBATTERTAKESAWAYTHESTRIKEOUT.Theresultisanout,asinnormalplay,anddrawanewFACandlookatOutSequence.

c. WALKS:Handlednormally.d. GROUNDOUTS:Remaingroundouts,butrunner(s)advanceonebase.Check

asterisksforerrors.Nodoubleplays.e. FLYOUTS:Batterout,runnercannotadvance.Checkasteriskforerrors.(Use

RunnerAdvanceonFlyBallOptionChartifyouwanttotrytoadvance.)f. LINEDRIVES:DoublePlaywiththeleadrunnercaughtoffbaseonlinersto

allinfieldpositions,includingthepitcher.Checkasteriskforerror.g. HBP:Handlenormally.Batterhitbypitch.h. WPandPB:Handlenormally.Ifitisa“pitch:No,”startoverwithanewFAC

(thehit-and-runcanbetriedagain,ornot.)Ifitisa“pitch:YES,runnersarecreditedwithastolenbase.

5) IfthePBisABOVEthepitcher'smodified(MinusTwo)range,THEBATTERCONTROLSTHEACTION.AnewRNisdrawn.TheBATTER’SHITANDRUNCHARTisusedinthiscase.

BUNTINGFORBASEHIT

1) AbatterwithanOBR-AorBratingcanbuntforabasehitonceagame.Nobuntingforabasehitisallowedwitharunneronthird.Asqueezeplaymustbeusedwitharunneronthird.

2) Thereisnorestrictiononsacrificeorsqueezeplays.FIELDERSFORCEDTOPLAYOUTOFPOSITION

1) Noplayercanplayapositionthatheisnotratedforexceptincaseofejectionorinjury.Aplayerplayingapositionheisnotratedfor,orapositionforwhichhehasexhaustedhiseligibilityisaCD-1withanerrorratingof10andtheworstpossiblethrowingarm.

2) Ifapitcherisusedinanotherdefensivepositionduetoaninjuryorejectiontothelastremainingpositionplayer,heisalsoaCD-1,E-10,T-2.

PLAYERUSAGE

1) Noreliefpitchermaypinchhit.Hemustalreadybeinthegametobatinthepitcher'sspotinthelineuptogarneraplateappearance.Reliefpitchersarelistedoneachteam'srosterandhavebeendesignatedassuchbyTy.

Updated January 5, 2016

Page 14: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

2) Startingpitchersmaypinchhit.NationalLeaguemanagershavebattingcardsavailableforallstartingpitchers.AmericanLeaguemanagerswhofeelthattheywouldlikeahittingcardforaplayer,askPaulandTytocreatethatplayercardforuse.Playercardsmustbecreatedbeforethegameinorderforthatplayertobeeligibleforuse.

3) Bothstartingandreliefpitchersmaypinchrun.

Updated January 5, 2016

Page 15: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

VISITINGMANAGERSINSTRUCTIONSHEADTOHEADGAMESHometeammanagersareencouragedhead-to-headgamesbyphone,instantmessaging,e-mail,orinpersonwhenevermutuallyagreeable.Thereisnolimittothenumberofgamesteammayplayhead-to-head.PLAYERSONBOTHTEAMSWhentwoteamsmeetwhohavethesameplayerontheirroster,thevisitingteamcannotusethatplayer.Thevisitorscanbringupaplayerforoneseriestoreplacehim.Attheendoftheseries,thetwo-teamplayerorthereplacementmustbereturnedtotheminorleagueroster,withoutusingthe10-daydemotionrule.RELIEFPITCHINGThevisitingmanagershouldsubmitalistofatleastthreerelieverstobeusedandinwhatorderinasolitairegame.

1) Thehomemanager,orthevisitingmanagerinahead-to-headgame,canchoosetoletapitcherfinishthegamewitharatingof2-2evenifotherpitchersareavailabletorelieve.

2) Undernocircumstancescanareliefpitcherstartagameunlessheisratedasastarter.

3) UndernocircumstancescanastartingpitcherwhohasaRR:0beusedinrelief.

Updated January 5, 2016

Page 16: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

ROSTERSELIGIBILITYRULES.

1) PlateappearancesincludeABs,walks,HBPsandsacrifices(fliesandbunts).2) Anytimeaplayerplaysasecondarypositioninagame,evenforaninning,itcounts

againsthisallowablegamesatthatposition.3) Whenplayerscompletetheirallowableinningsorplateappearancestheirregular

seasonisover.Theycannotbeusedinatie-breakergameforaplayoffspot,buttheycanbeusedintheplayoffs.

4) Ifapitcherexceedshisavailableinningsfortheseasonasaresultofadoubleortripleplay,thereisnopenalty.

5) Ifahometeammanageroravisitingmanagerinahead-to-headgameusesaplayerwhoisineligible,hemustreplaythegamefromthepointtheineligibleplayerenteredthegameifhewonthegame.Ineligibleplayersincludeinjuredplayers,thosenotonthemajorleagueroster,thoseonthedisabledlist,andthosewhohaveexhaustedtheiravailability.

6) Ifahometeammanagerusesanineligibleplayeronthevisitingteam,thereisnopenalty.

7) Inaforfeit,allstatisticsforthegameshallbeconsideredofficialuptothepointofdiscoveryoftheforfeit,exceptthefinalscoreshallbe9-0andthestartingpitcherswillbegiventhewinandloss,withnosavespossible.Replaysarepreferredoverforfeits.

ROSTERMOVES

1) Playerssenttotheminorsmustremaintheretendays(accordingtotheleagueschedule,includinganyoff-days),unlessnootherplayerisavailabletoplayapositiononthe25-manroster(becauseofinjuriesorexpirationofavailability)ortheplayerisineligiblebyappearingforbothteams.

2) Therearenorestrictionsonthenumberofrostermovesduringaseason.3) Playerswhoareinjuredcannotbesenttotheminors.Hecanbeleftontheactive

rosterorplacedonthedisabledlist.4) PlayerswhoareputontheDisabledListmustremainonthatlistforatleast15days

intheschedule,andcannotbebroughtbacktotheactivelistbeforethenumberofgamesinjured.

5) Rostersexpandto40playersonSept.1oftheschedule,andafterthatnorostermovesarenecessary.

6) Playersonthedisabledlistarenoteligibletobebroughtuptoreplaceaplayerontheactiverosterforbothteamsinagame/seriesunlesstheyhaveexceededthenumberofgamesinjured,andthusareeligibletoreturntotheactivelist.

Updated January 5, 2016

Page 17: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

PITCHER’SREST

1) Usepitchers'restcharttodetermineifastarterorrelieverissufficientlyrested.2) Astartermusthavethenecessaryrest(asonPitcher'sRestchart)beforeentering

anygameasareliever.3) Afterrelieving,apitcherhaveoneextradayofrestbeforebeingallowedtostart

again.4) Areliefpitcherpitchingonconsecutivedayswillhavealimitontheinningshecan

pitchbeforetiring.Ifheremainsinthegameafterthatlimit,heisimmediatelyreducedtwopointsregardlessofstamina.

5) Apitchercannotbeusedwithoutproperrest.Thepitcherrestrulesareprintedweekly.

a. Ifthereisnorestedpitcheravailableatthetimewhenapitcherisinjuredorejected,theunrestedreplacementpitcherwillhavehisPBreducedbytwoafterthedrawthatdetermineshisstuff,andisnotlimitedbythe2-5lowerlimit.

Updated January 5, 2016

Page 18: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

ALL-STARGAME

1) ThemanageroftheteamwiththebestrecordintheleagueattheAll-StarbreakwillmanagetheleagueAll-StarTeam.

2) Allmanagerswillvoteforplayersinthestartinglineups.3) Thegamemanagerswillpickallpitchersandreserves.4) Pitcherswillfollownormalrestrulesduring,andaftertheAll-StarGame.Any

inningspitchedintheAll-StarGamewillcountforpurposesofrestrules.5) ManagerscannotlettheirplayersrefusetoparticipateintheAll-StarGame.6) All-Starpitcherscannotpitchformorethantwoinnings.7) InjuriesoccurringintheAll-Stargamewillcarryoverintotheregularseason.8) Allstarinnings,plateappearancesandpositionplayedintheAll-Stargamedonot

countagainsttheirseasonallowablelimits.9) ThereisanoffdayforallteamsthedaybeforetheAll-Stargameandonlymake-up

gamesarescheduledthedayafterthegame...perMLBrules.10) TheSeasonThreeAll-StargamewillbeplayedinaNationalLeaguepark.

Updated January 5, 2016

Page 19: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

POST-SEASONPLAYOFFSTRUCTURE

1) Fiveteamsmaketheplayoffsineachleague.TheOriginalandExpansiondivisionchampsareratedthenumberoneandtwoseeds.Thenextthreeteamsmaketheplayoffsbasedonwinningpct.

a. Ifthereisatieforthe5thspotintheplayoffs...aonegameplayoffwilloccurthedayaftertheregularseasonends.Thestatscountintheleague...asdoaonegameplayoffforthechampionshipofadivision.

b. Ifthereisatieforeitherthe3rdor4thspotsintheplayoffs,itwillbedecidedbytheheadtoheadrecords.

2) The4thand5thteamsplayaWildcardPlaydown(best2of3).3) FirstRound:1vs.4or5(bestoffive)4) FirstRound:2vs.3(bestoffive)5) ALCSandNLCS:bestofseven.6) GAFLWorldSeries(bestofseven).7) Therewillbeonedayofrestintheplayoffworldseriesschedulebetweentheendof

theDivisionSeriesandthebeginningoftheChampionshipSeries,andonedayoffbetweentheendoftheChampionshipSeriesandthestartoftheWorldSeries....perMLBprocedure.

PLAYOFFPLAYINGRULES

1) Teamscansettheir25-manrosteranewatthebeginningofeachplayoffseries.2) Pitcherrestrulesremainthesameasintheregularseason,includingruleson

starter-relievers.3) Pitcherswhoarestartersonlycannotrelieve,andrelievers-onlycannotstart.

Starterrelieversarelimitedtostartingorrelievinginthepost-seasonforatotalofthesamenumberofgamestheyareallowedduringtheregularseason.

4) Rulesontwo-teamplayersarethesameasintheregularseason.Thevisitingteamforcedtositaplayercanreplacehimforawaygames.

5) Playerswhoareratedfor15ormoregamesatapositionduringtheseasoncanplaytherewithoutlimitsinthepost-season.Otherwise,playerscannotplaymoregamesatapositionduringtheentirepost-seasonthantheywereeligibletoplayduringtheseason.

IFANYTHINGISMISSEDINTHESERULES,TYWILLMAKEADECISIONWITHTHE

ADVICEOFTHERULESCOMMITTEEANDCOMMISSIONERS.

Updated January 5, 2016

Page 20: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

BASE  RUNNING  TABLES    Determine  the  hit  type  by  checking  the  random  number  of  the  hit.  Locate  the  correct  running  table  and  cross-­‐reference  the  runner’s  OBR  with  the  fielders  arm.  Look  under  the  hit  type  to  determine  “safe”  number.  Draw  another  card  and  check  random  number.  It  must  be  equal  to  or  less  than  “safe”  number  for  runner  to  be  safe.    Note:  In  a  solitaire  game,  with  no  previous  instructions,  the  base  runner  will  try  to  advance  on  a  safe  chance  of  60  or  higher.    All  runners  are  out  on  a  draw  of  88,  regardless  of  modifiers.    HIT  TYPES:       1  –  Texas  Leaguer:   Random  numbers  divisible  by  12.     2  –  Bloop:       Random  numbers  divisible  by  4,  but  not  12.     3  –  Normal:       All  odd  numbers     4  –  Smash  Hits:     All  even  numbers  not  divisible  by  4    TWO  OUT  MODIFICATIONS:       1  –  Texas  Leaguer:     Add  60  to  all  RN  draws  

2  –  Bloop:       Add  40  to  all  RN  draws     3  –  Normal:       Add  20  to  all  RN  draws     4  –  Smash  Hits:     Add  10  to  all  RN  draws        

Updated January 5, 2016

Page 21: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

TABLE  I  –  First  to  Third  on  Single  to  Left  T-­‐2   T-­‐3   T-­‐4   T-­‐5  

Hit  Type   Hit  Type   Hit  Type   Hit  Type  OBR   1&2  /  3  /  4   1&2  /  3  /  4   1&2  /  3  /  4   1&2  /  3  /  4  A   32  /  64  /  52   26  /  58  /  46   22  /  54  /  42   21  /  48  /  36  B   26  /  58  /  46   22  /  54  /  42   21  /  48  /  36   21  /  44  /  32  C   22  /  54  /  42   21  /  48  /  36   21  /  44  /  32   21  /  38  /  26  D   21  /  48  /  36   21  /  44  /  32   21  /  38  /  26   21  /  34  /  22  E   21  /  44  /  32   21  /  38  /  32   21  /  34  /  22   21  /  28  /  21  

TABLE  II–  First  to  Third  on  Single  to  Center  T-­‐2   T-­‐3   T-­‐4   T-­‐5  

Hit  Type   Hit  Type   Hit  Type   Hit  Type  OBR   1&2  /  3  /  4   1&2  /  3  /  4   1&2  /  3  /  4   1&2  /  3  /  4  A   52  /  72  /  42   46  /  66  /  36   42  /  62  /  32   36  /  56  /  26  B   46  /  66  /  36   42  /  62  /  32   36  /  56  /  26   32  /  52  /  22  C   42  /  62  /  32   36  /  56  /  26   32  /  52  /  22   26  /  46  /  21  D   36  /  56  /  26   32  /  52  /  22   26  /  46  /  21   22  /  42  /  21  E   32  /  52  /  22   26  /  46  /  21   22  /  42  /  21   21  /  36  /  21  

TABLE  III  –  First  to  Third  on  Single  to  Right  T-­‐2   T-­‐3   T-­‐4   T-­‐5  

Hit  Type   Hit  Type   Hit  Type   Hit  Type  OBR   1&2  /  3  /  4   1&2  /  3  /  4   1&2  /  3  /  4   1&2  /  3  /  4  A   62  /  82  /  52   56  /  76  /  46   52  /  72  /  42   46  /  66  /  36  B   56  /  76  /  46   52  /  72  /  42   46  /  66  /  36   42  /  62  /  32  C   52  /  72  /  42   46  /  66  /  36   42  /  62  /  32   36  /  56  /  26  D   46  /  66  /  36   42  /  62  /  32   36  /  56  /  26   32  /  52  /  22  E   42  /  62  /  32   36  /  56  /  26   32  /  52  /  22   26  /  46  /  21  

TABLE  IV  –  Second  to  Home  on  Single  to  Outfield  (note:  runner  on  1st  goes  to  3rd  if  OBR-­‐A,  B,  or  C.  Otherwise  stops  at  2nd.)  

T-­‐2   T-­‐3   T-­‐4   T-­‐5  Hit  Type   Hit  Type   Hit  Type   Hit  Type  

OBR   1&2  /  3  /  4   1&2  /  3  /  4   1&2  /  3  /  4   1&2  /  3  /  4  A   56  /  76  /  46   52  /  72  /  42   46  /  66  /  36   42  /  62  /  32  B   52  /  72  /  42   46  /  66  /  36   42  /  62  /  32   36  /  56  /  26  C   46  /  66  /  36   42  /  62  /  32   36  /  56  /  26   32  /  52  /  22  D   42  /  62  /  32   36  /  56  /  26   32  /  52  /  22   26  /  46  /  21  E   36  /  56  /  26   32  /  52  /  22   26  /  46  /  21   22  /  42  /  21  

TABLE  V  –  First  to  Home  on  Double  to  Outfield  T-­‐2   T-­‐3   T-­‐4   T-­‐5  

Hit  Type   Hit  Type   Hit  Type   Hit  Type  OBR   1&2  /  3  /  4   1&2  /  3  /  4   1&2  /  3  /  4   1&2  /  3  /  4  A   32  /  64  /  52   26  /  58  /  46   22  /  54  /  42   21  /  48  /  36  B   26  /  58  /  46   22  /  54  /  42   21  /  48  /  36   21  /  44  /  32  C   22  /  54  /  42   21  /  48  /  36   21  /  44  /  32   21  /  38  /  28  D   21  /  48  /  36   21  /  44  /  32   21  /  38  /  26   21  /  34  /  24  E   21  /  44  /  32   21  /  38  /  32   21  /  34  /  22   21  /  28  /  21  

Updated January 5, 2016

Page 22: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

HIT&RUN(PITCHERCONTROL)

ThehitandruncanonlybeusedwitharunneronfirstorrunnersonfirstANDsecond.Whenahitandrunisdeclared,drawaPBtoseewhocontrolstheplay.Usethepitcher’sPBratingforthatgame,MINUSTWO.

A) IfthePBisaZ,CD,orBD,theplayishandlednormally.B) IfthePBfallsintotherevisedpitchersrange,anewcardisdrawnandthe

resultisreadoffthepitcherscard,withthefollowingmodifications:a. SINGLES:Allrunnersadvancetwobases(oneoninfieldhits).Do

notusebaserunningchart.Donotcheckforerrors.b. STRIKEOUTS:Batterstrikesoutandbaserunner(s)mustattempt

stolenbase.Thejumpisautomatic,butthestealattemptmustbemadebyallbaserunnerswiththeirnormalstealrating.Thecatchermaytrytothrowouteitherrunner.NOTE:AbalkresulttakesprecedenceintheeventtheBalkresultisYES.

i. Ifthebattertakesawaythestrikeoutchance,theresultisanout.GototheOutSequenceontheFACtodeterminethetypeofout.

c. WALKS:Batterwalks.Allrunnersadvanceonebase.d. GROUNDOUTS:Batterisout,butallrunnersadvanceonebase.

Checkasteriskforerror.Nodoubleplays.e. FLYOUTS:Batterisout,butallrunnershavetoretreatbackto

originalbase.Checkasteriskforerror.(UseRunnerAdvanceonFlyBallOptionChartifyouwanttotrytoadvance.)

f. LINEDRIVES:Doubleplaywithleadrunnercaughtoffbaseonlinedrivestoallinfielders.Checkasteriskforerror.

g. HBP:Batterishitbypitch.Allrunnersadvanceonebase.h. WPandPB:Handleasnormal.Runnersarecreditedwithastolen

base,regardlessofstealrating,ifaWPorPBoccurs.(DonotcallitaWPorPB.Itisastolenbase.)

IfthePBisAOBVEthepitcher’smodified(MinusTwo)range,thebattercontrolstheaction.AnewRNisdrawn.TheHitandRun(BatterControl)chartisused.Note:Afterthehitandrunisresolved,thepitcherrevertsbacktopreviousPBrating

Updated January 5, 2016

Page 23: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

HITANDRUN(BATTERCONTROL)

CanonlybeusedwhenamanisonfirstorfirstANDsecond.Whenthebattercontrolsaction,drawanewrandomnumber.Readresultdirectlyfromchart.Usebatter’sH&Rrating.Noerrors.H&R:0 H&R:1 H&R:2 Result11-21 11-28 11-34 SingletoCF.Runnersadvancetwobases.22-25 31-35 35-42 Groundoutto2B.Allrunnersadvanceonebase.26-34 36 43-46 Runnerson1stor2ndmustattempttosteal.Runners

withjumpratingofBorhigherhasstealratingdroppedonelevel.RunnerswithjumpratingofCorlowerhasstealratingreducedtwolevels.Battertakespitchandisstillatbat.BalktakesprecedenceifgeneratedandresultisYES

35-42 37-42 47-52 Groundout,4-3.Runnersadvanceonebase.43-51 43-48 53-61 Groundout,3-unassisted.Runnersadvanceonebase.52-61 51-56 62-64 Batterstrikesout.Leadrunnergetsjumpfornext

base,butstealratingreducedtwolevels.BalktakesprecedenceifgeneratedandresultisYES

62 57-61 65-67 Runnerson1stor2ndwithjumpratingofCorhigherattemptstosteal.RunnerswithjumpratingofDorEhold.BalktakesprecedenceifgeneratedandresultisYES

63-67 62 68-71 LineouttoP.Leadrunnerdoubledoff.68-74 63-64 72-75 FlyouttoLF.Runnershold.75-81 65-74 76-83 FlyouttoCF.Runnershold.82-88 75-88 84-88 FlyouttoRF.Runnershold.Note:Afterthehitandrunisresolved,thepitcherrevertsbacktopreviousPBrating.

Updated January 5, 2016

Page 24: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

BUNTING  FOR  BASE  HIT    

This  can  only  be  used  ONCE  per  batter,  per  game  and  NEVER  when  a  runner  is  on  3rd  base.  The  batter  must  have  an  OBR  rating  of  A  or  B.  When  this  play  is  called,  ignore  PB  draw.  Draw  a  new  card  to  obtain  new  RN  and  use  this  chart.    Note:  “X”  is  the  number  after  the  last  number  of  the  hit  range.      -­‐  Also,  lead  runner  is  put  out  by  3B  if  runner  on  2nd  base,  by  SS  if  runner  on  1st  base,  or  by  1B  if  no  runners  on  base.    Draw   Result  

Hit  Range  

Batter  beats  out  bunt  for  hit.  Runners  advance  one  base.  (see  below  for  range)  

X-­‐35   Batter  out,  3B  –  1B.  Runners  advance.  No  sacrifice.  

36-­‐42   Batter  out,  1B  –  P  (covering  1st).  Runners  advance  one  base.  No  sacrifice.  

43-­‐48   Lead  runner  thrown  out  by  pitcher.  Batter  safe  at  first  on  fielder’s  choice.  Any  other  runners  advance  one  base.  

51-­‐52   Lead  runner  thrown  out  by  catcher.  Batter  safe  at  first  on  fielder’s  choice.  Any  other  runners  advance  one  base.  

53   Batter  misses  bunt.  A  runner  on  1st  is  picked  off  by  catcher  with  TA  or  TA+  arm.  All  other  runners  hold.  Batter  cannot  attempt  to  bunt  again.  

54   Batter  misses  bunt  and  all  runners  must  attempt  to  steal.  Batter  cannot  attempt  to  bunt  again  

55-­‐58   Batter  out  C  –  1B.  Runners  advance  one  base.  No  sacrifice.  

61-­‐64   Batter  out  1B-­‐unassisted.  Runners  advance  one  base.  No  sacrifice.  

65   Error  –  P.  Batter  safe  at  first.  Runners  advance  one  base.  

66   Error  –  1B.  Batter  to  second.  Runners  advance  two  bases.  

67   Error  –  2B.  Batter  safe  at  first.  Runners  advance  one  base.  

68   Error  –  3B.  Batter  safe  at  first.  Runners  advance  one  base.  

71   Catcher  makes  wild  throw  to  1B.  Batter  to  third.  All  runners  score.  

72-­‐74   Foul  out  to  C.  

75-­‐76   Foul  out  to  3B.  

77-­‐78   Foul  out  to  1B.  

81-­‐88   Bunt  try  goes  foul.  Batter  still  at  bat,  but  cannot  attempt  to  bunt  again.  

 BUNTER  RATINGS  

 To  obtain  the  hit  range  for  a  bunter,  use  the  following  chart.  Any  range  that  is  not  listed  on  this  chart  cannot  attempt  to  bunt  for  base  hit.  

 OBR   SAC   HIT     OBR   SAC   HIT  A   A   11-­‐34     B   A   11-­‐32  A   B   11-­‐32     B   B   11-­‐28  A   C   11-­‐28     B   C   11-­‐26  A   D   11-­‐24          

 Updated January 5, 2016

Page 25: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

SACRIFICE  CHART    

When  a  sacrifice  is  called,  ignore  PB  draw.  Draw  a  new  card  to  obtain  new  RN  and  use  this  chart,  using  the  SAC  rating  of  the  batter.    SAC:  A   SAC:  B   SAC:  C   SAC:  D   Result  

11-­‐18   11-­‐18   11-­‐15   11-­‐13   Batter  out,  P  –  2B  (covering  1st).  Runners  

advance.  Sacrifice.  

21-­‐27   18-­‐25   16-­‐23   14-­‐18   Batter  out,  C  –  1B.  Runner  advance.  

Sacrifice.  

28-­‐37   26-­‐34   24-­‐31   21-­‐24   Batter  out,  1B  –  P  (covering  1st).  Runners  

advance.  Sacrifice.  

38-­‐65   35-­‐55   32-­‐48   25-­‐41   Batter  out,  3B  –  1B.  Runners  advance.  

Sacrifice.  

66-­‐67   56       Batter  safe  on  bunt  base  hit.  Runners  

advance  one  base.  

68   57-­‐68   51-­‐68   42-­‐68   Lead  runner  tagged  out,  Catcher  to  lead  

base.  Batter  safe.  

71   71   71   71   Error  –  1B.  All  safe.  Sacrifice.  

72   72   72   72   Error  –  P.  All  safe.  Sacrifice.  

73   73   73   73   Error  –  3B.  All  safe.  Sacrifice.  

74   74   74   74   Error  –  C.  All  safe.  Sacrifice.  

75   75-­‐77   75-­‐82   75-­‐82   Batter  fouls  out  to  C.  Runners  hold.  

76-­‐77   78-­‐83   83-­‐85   83-­‐86   Double  Play.  Pop  out  to  C  who  throws  to  

lead  base.  

78-­‐88   84-­‐88   86-­‐88   87-­‐88   Batter  fouls  off  third  strike.  Strikeout.  

 

Updated January 5, 2016

Page 26: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

CD  CHART  **only  use  with  runners  on  base**    PITCHER    CD-­‐1   CD-­‐2   CD-­‐3   CD-­‐4   Play  Description  11   11-­‐13   11-­‐16   11-­‐18   Great  catch  of  foul  fly.  Runners  hold.  12   14-­‐15   17-­‐23   21-­‐26   Double  Play,  if  runner  on  first  (1-­‐4-­‐3).  If  no  runner  on  first,  lead  runner  thrown  out  

trying  to  advance,  batter  safe.  13-­‐18   16-­‐21   24-­‐25   27   Hard  shot  ricochets  off  pitcher  for  hit,  runners  advance  one  base.  OBR  A  advances  

two.  21-­‐25   22-­‐24   26-­‐27   28   Error  on  ground  ball  (E1).  Runners  advance  one  base.  26-­‐27   25-­‐26   28   31   Fields  grounder  but  throws  wildly  to  first  (E1).  Batter  to  first,  runners  advance  two  

bases.  28   27-­‐31   31-­‐36   32-­‐41   Great  catch  of  a  line  drive.  Lead  runner  is  doubled  out.  31-­‐38   32-­‐36   37-­‐38   42   Unable  to  field  slow  roller.  Single,  runners  advance  one  base.  41-­‐88   37-­‐88   41-­‐88   43-­‐88   Foul  ball.  Resume  normal  PB  play.    CATCHER    CD-­‐1   CD-­‐2   CD-­‐3   CD-­‐4   Play  Description  11   11-­‐13   11-­‐16   11-­‐18   Great  catch  of  a  foul  fly.  Runners  hold.  12   14-­‐15   17-­‐23   21-­‐26   Lead  runner  thrown  out-­‐batter  safe.  (If    man  on  third,  he  holds,  batter  out  2-­‐3.)  13-­‐18   16-­‐21   24-­‐25   27   Slow  roller  for  base  hit.  Runners  advance  one  base.  21-­‐25   22-­‐24   26-­‐27   28   Passed  ball.  Runners  advance  one  base.  26-­‐27   25-­‐26   28     Interference  (E2).  Batter  to  first,  runners  advance  if  forced.  28   27-­‐31   31-­‐36   31-­‐38   Lead  runner  picked  off  by  catcher.  31-­‐33   32-­‐33   37   41   Fumbled  dribbler.  Batter  safe,  runners  advance  one  base  (E2).  34-­‐38   34-­‐36   38   42   Wild  throw  on  pick  off  try  (E2).  Runners  advance  one  base.  OBR  A  and  B  advance  

two.       41-­‐42   43-­‐46   Handles  two-­‐strike  foul  tip  for  strikeout.       43-­‐44   47-­‐52   Frames  two-­‐strike  pitch  for  strikeout.       45-­‐46   53-­‐56   With  man  on  first,  second,  or  first  and  second,  catcher  calls  for  pitchout  and  nails  

lead  runner  trying  to  steal.       47-­‐48   57-­‐62   Goes  to  mound  to  confer  with  pitcher  and  dispenses  pearls  of  wisdom.  Add  two  to  

pitcher’s  PB  rating  ONLY  for  that  batter.  (max  of  PB:  2-­‐10)       51-­‐55   63-­‐78   Foul  by  stands.  Home  team  catcher  makes  play,  Visiting  team  catcher  must  survive  

random  number;  11-­‐78  makes  catch,  81-­‐88  goes  foul.  41-­‐88   37-­‐88   56-­‐88   81-­‐88   Foul  ball.  Resume  normal  PB  play.    FIRST  BASEMAN    CD-­‐1   CD-­‐2   CD-­‐3   CD-­‐4   Play  Description  11   11-­‐13   11-­‐16   11-­‐18   Great  catch  of  foul  fly.  12   14-­‐15   17-­‐23   21-­‐26   Double  play  if  runner  on  first  (3-­‐6-­‐3).  If  no  runner  on  first,  lead  runner  thrown  out  

trying  to  advance,  batter  safe.  13-­‐18   16-­‐21   24-­‐25   27   Hard  shot  down  line  for  double.  Runners  score.  21-­‐25   22-­‐24   26-­‐27   28   Error  on  ground  ball  (E3).    Batter  safe  at  first,  runners  advance  one  base.  26-­‐27   25-­‐26       Drops  throw  from  shortstop  (E3,  a-­‐6).  Batter  safe,  runners  advance  one  base.       28   31   Great  stretch  on  throw  from  shortstop,  batter  out,  runners  advance  one  base.  28   27-­‐31   31-­‐36   32-­‐41   Great  catch  of  a  line  drive.  Any  runner  on  first  is  doubled  off.  31-­‐38   32-­‐36   37-­‐38   42   Unable  to  field  grounder.  Single,  runners  advance  one  base.  41-­‐44   37-­‐41   41-­‐42   43   Bouncer  through  the  hole.  Single,  runners  advance  two  bases.       43-­‐45   44-­‐48   Foul  out  down  right  field  line.  Any  runner  may  attempt  to  advance  using  ADVANCE  

ON  FLY  OPTION.  Consider  arm  to  be  T2.       46-­‐48   51-­‐54   Line  out.  Runners  hold.         55-­‐56   Line  out.  Any  lead  runner  doubled  off.  45-­‐88   42-­‐88   51-­‐88   57-­‐88   Foul  ball.  Resume  normal  PB  play.    

Updated January 5, 2016

Page 27: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

SECOND  BASEMAN  OR  SHORTSTOP  

CD-­‐1   CD-­‐2   CD-­‐3   CD-­‐4   Play  Description  11   11-­‐13   11-­‐16   11-­‐18   Great  catch  of  shallow,  looping  fly  to  outfield.  Runners  hold  12   14-­‐15   17-­‐23   21-­‐26   If  first  base  occupied,  double  play  (4-­‐3  or  6-­‐3).  If  no  runner  on  first,  great  stop  on  

grounder.  Lead  runner  thrown  out.  Batter  safe  at  first.  13-­‐18   16-­‐21   24-­‐25   27   Hard  shot  over  bag  goes  through  for  single.  Runners  advance  two  bases.  21-­‐25   22-­‐24   26-­‐27   28   Error  on  ground  ball  (E4  or  E6).  Batter  safe  at  first,  runners  advance  one  base.  26-­‐27   25-­‐26   28   31   Fields  ground  ball,  but  throws  wildly  to  first.  Batter  to  first,  runners  advance  two  

bases.  28   27-­‐31   31-­‐36   32-­‐41     Great  catch  of  a  line  drive.  Any  runner  on  second  doubled  off.  31-­‐38   32-­‐36   37-­‐38   42   Unable  to  field  slow  roller.  Single,  runners  advance  one  base.  41-­‐44   37-­‐41   41-­‐42   43   Bouncer  through  the  hole.  Single,  runners  advance  two  bases.  

43-­‐45   44-­‐48   Foul  out  to  short  left  if  shortstop,  short  right  if  second  baseman.  Any  runner  may  attempt  to  advance  using  ADVANCE  ON  FLY  OPTION.  Consider  arm  to  be  T2  if  second  baseman,  T3  if  shortstop.  

46-­‐48   51-­‐55   Lineout.  Runners  hold.  51-­‐55   56-­‐64   Force  out  at  2nd  if  runner  on  1st.  With  no  runner  on  first,  ground  out,  (4-­‐3  or  6-­‐3).  

Runner  on  2nd  advances  to  3rd.  If  runner  on  3rd  with  less  than  two  outs,  out  at  home  (4-­‐2  or  6-­‐2).  

65-­‐78   Lineout,  lead  runner  doubled  off.  45-­‐88   42-­‐88   56-­‐88   81-­‐88   Foul  ball.  Resume  normal  PB  play.  

THIRD  BASEMAN  

CD-­‐1   CD-­‐2   CD-­‐3   CD-­‐4   Play  Description  11   11-­‐13   11-­‐16   11-­‐18   Great  catch  of  foul  fly.  Runners  hold.  12   14-­‐15   17-­‐23   21-­‐26   If  first  occupied  (5-­‐4-­‐3)  double  play.  (If  first  base  is  not  occupied,  great  stop  on  

grounder,  lead  runner  out  either  5-­‐unassisted  or  5-­‐2.  Batter  safe  if  less  than  two  outs.)  

13-­‐18   16-­‐21   24-­‐25   27   Hard  shot  down  the  line  for  double.  Runners  score.  21-­‐25   22-­‐24   26-­‐27   28   Error  on  ground  ball  (E5).  Batter  safe,  runners  advance  one  base.  26-­‐27   25-­‐26   28   31   Fields  ground  ball  but  throws  wildly  to  first.  Batter  to  first,  runners  advance  two  

bases.  28   27-­‐31   31-­‐36   32-­‐41   Great  catch  of  a  line  drive.  Any  runner  on  third  doubled  off.  31-­‐38   32-­‐36   37-­‐38   42   Unable  to  field  slow  roller.  Single,  runners  advance  one  base.  41-­‐44   37-­‐41   41-­‐42   43   Bouncer  through  the  hole.  Single.  Runners  on  2nd  or  3rd  score.  Runner  on  first  

stops  at  second  base.  43-­‐45   44-­‐48   Foul  out  down  left  field  line.  Any  runner  may  attempt  to  advance  using  ADVANCE  

ON  FLY  OPTION.  Consider  arm  to  be  T3.  46-­‐53   51-­‐61   Line  out.  Runners  hold.  54-­‐55     62-­‐76   Line  out.  Lead  runner  doubled  off.  

77-­‐78   Runner  on  1st:  5-­‐4-­‐3  DP  (or  5-­‐3  if  two  outs)  Runner  on  2nd:  Runner  out  in  rundown  5-­‐4-­‐6.  Batter  safe  at  first  (FC)  Runner  on  3rd:  Runner  out  in  rundown  5-­‐2-­‐6.  Batter  safe  at  first  (FC)  Runners  on  1st  and  2nd:  5-­‐4-­‐3  TRIPLE  PLAY  (or  5-­‐4-­‐3  double  play  if  one  out,  or  5-­‐3  if  two  outs)  Runners  on  1st  and  3rd:  5-­‐2,  runner  out  at  home,  runner  to  second,  batter  to  first  (FC)  Bases  loaded:  5-­‐4-­‐3  TRIPLE  PLAY  (or  5-­‐2-­‐3  double  play  if  one  out,  or  5-­‐3  if  two  outs)  

45-­‐88   42-­‐88   56-­‐88   81-­‐88   Foul  ball.  Resume  normal  PB  play.  

OUTFIELDER  

CD-­‐1   CD-­‐2   CD-­‐3   CD-­‐4   Play  Description  11   11-­‐13   11-­‐16   11-­‐18   Great  catch  of  a  shallow  fly.  Runners  hold.  12   14-­‐15   17-­‐23   21-­‐26   Super  catch  of  a  sinking  liner.  Batter  and  lead  runner  on  base  are  out.  13-­‐18   16-­‐21   24-­‐25   27   Shallow  fly  falls  for  double.  Runners  advance  two  bases.  21-­‐25   22-­‐24   26-­‐27   28   Drops  fly  for  error  (E7,  E8,  or  E9).  Batter  to  second,  runners  advance  two,  all  score  if  

two  are  out.  26-­‐27   25-­‐26   28   31   Misplays  drive  into  triple.  Runners  score.  28   27-­‐31   31-­‐36   32-­‐41   Routine  fly.  Any  runner  on  third  gunned  at  the  plate,  double  play  (7-­‐2,  8-­‐2,  or  9-­‐2).  31-­‐38   32-­‐36   37-­‐38   42   Unable  to  field  routine  fly.  Three  base  error  (E7,  E8,  or  E9),  all  runners  score.  

41   43-­‐44   Batter  singles  to  alley,  but  is  thrown  out  trying  to  stretch  it  if  OBR  B  or  less.  Runners  advance  two  bases.  OBR  A  gets  hustle  double.  

42-­‐55   45-­‐78   Tremendous  snag  in  the  gap.  Runners  may  tag  from  second  using  ADVANCE  ON  FLY  OPTION,  and  treating  as  deep  fly.  Runner  on  third  scores.  

41-­‐88   37-­‐88   56-­‐88   81-­‐88   Foul  ball.  Resume  normal  PB  play.  

Updated January 5, 2016

Page 28: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

STOLENBASERATING/JUMPCHARTFirst,drawarandomnumbertodetermineifyoucanattemptasteal.ConsultjumpratingfromtheletterontheLEFTsideoftherunnersSBrating.Jumpsdroponeratingwhenfacingalefthandedpitcher.

STEALATTEMPTSRATINGS(onleftside)40+attemptsperseason......(AA)30+attempts..............................(A)20-29attempts.........................(B)10-19attempts.........................(C)5-9attempts...............................(D)Below5attempts.....................(E)

Ifthebaserunnercan'tattemptastealhemustwaitONEBATTERbeforetryingagain.Whenthejumpisunsuccessful,thecurrentatbatmustbecompletedbeforeanybaserunnercantrytogetajumpagainforastealattempt.

UsetheletterontheRIGHTsideforstealresults.

STOLENBASERATINGS(onrightside)A+=80%orgreaterstealpct.A=75-79%stealpct.B+=70-74%stealpct.B=65-69%stealpct.C+=60-64%stealpct.C=55-59%stealpct.D=45-54%stealpct.E=Below45%stealpct.

Updated January 5, 2016

Page 29: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

JUMPCHARTS

Beforeabaserunnercanattemptastolenbase,hemustgetajump.DrawnextFACandconsultJUMPratingoftherunnerandthenewRNtodetermineifthejumpissuccessful.

(a) –Againstaleft-handedpitcher,allrunnersJUMPratingisreducedbyonelevel(AA

becomesA,BbecomesC,etc.).(b) –Againstaright-handedpitcher,allrunnersJUMPratingisreducedbyonelevel(AA

becomesA,BbecomesC,etc.).**Ateamcannotattempttostealmorethanonebaseinanyoneat-batexceptin

attemptingadoublestealundertheserules.**

DOUBLESTEALRULE

Adoublestealmaybeattemptedwithrunnerson1stand2nd,1stand3rdor2ndand3rd.Atriplestealmaybeattemptedwhenthebasesareloaded.

Bothrunnersmustgetajumpforadoublesteal.DrawanewRNforthejump

withtheleadrunner.Ifhegetsthejump,thendrawanotherRNforthetrailingrunner’sjump.Ifbothrunnersgetajump,thedoublestealison.

Theplayismadeontheleadrunnerinasolitairegame.Thedefensemay

choosewheretomaketheplayinahead-to-headgame.Usethecorrectstealchartoftheintendedrunner.

Ifarunneristhrownoutattemptingtosteal,allotherrunnersadvance,

assuminghe(they)hadajump.Nostealcreditwillbegiventotheadvancingrunnerinthissituation.

Asuccessfuldoubleortriplestealreducesapitcher’sstaminabyonepoint

evenifmultiplerunnerssteal.Ifarunscoresontheplay,itreducesapitcher’sstaminabyanadditionalpoint.

JUMPFORHOME(b)AA 11-24A 11-18B 11-14C 11D cannotstealE cannotsteal

JUMPFORSECONDBASE(a)AA 11-61A 11-51B 11-41C 11-31D 11-21E 11-17(vsRHP)E 11-14(vsLHP)

JUMPFORTHIRDBASEAA 11-41A 11-32B 11-23C 11-14D cannotstealE cannotsteal

Updated January 5, 2016

Page 30: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

STEALINGSECONDBASE

Oncethebaserunneronfirstgetsajump,drawnextFACandconsulttheSBratingofthebasestealerandthenewRNtodeterminetheoutcome.

11-14 Ifleft-handedpitcherisonthemound,basestealeriscaughtstealing

Ifright-handedpitcherisonthemound,allbasestealerssteal2ndbase.15-35 Allbasestealerssteal2ndbase.36-41 BasestealersratedA+thruDsteal2ndbase.Allothersarecaughtstealing.42-44 BasestealersratedA+thruCsteal2ndbase.Allothersarecaughtstealing.45-46 BasestealersratedA+thruC+steal2ndbase.Allothersarecaughtstealing.47-51 BasestealersratedA+thruBsteal2ndbase.Allothersarecaughtstealing.52-54 BasestealersratedA+thruB+steal2ndbase.Allothersarecaughtstealing.55-57 BasestealersratedA+andAsteal2ndbase.Allothersarecaughtstealing.58-61 OnlybasestealersratedA+steal2ndbase.Allothersarecaughtstealing.62-63 Allbasestealersarecaughtstealing.64 Wildthrowbycatcher.Stolenbaseanderror.Basestealertothird.Runner

onthirdscores.65 Wildthrowbycatcher.Stolenbaseanderror.OBR-Abasestealerscores.All

othersadvancetothird.Runneronthirdscores.66-67 Infielderdropsthrowfromcatcher.Error.Basestealerissafeat2nd.(Actual

definitioniscaughtstealing.Scorehowyouwish.)68 BALK–checknextFACforyes/noonbalk.Ifyes,allrunnersadvanceone

base.Ifno,continuenormalplayandrunnermustwaitonebatterbeforeattemptingtostealagain.

71 Pitcher*throwswildlytofirstbase..Chargeerrortopitcher.OBR-Abasestealerscores.OBR-BandOBR-Cbasestealeradvancestothird.OBR-DandOBR-Ebasestealerstopsat2nd.Nostolenbasecredit.Runneronthirdscores.

72 Pitcher*throwswildlytofirstbasewithrightfielderbackingupplay.Chargeerrortopitcher.OBR-Abasestealeradvancestothird.Allotherrunnersadvanceto2nd.Nostolenbasecredit.Runneronthirdscores.

73-74 BasestealeroutifcatcherhasTA+arm.Otherwise,allattemptsaresafe.75-77 BasestealeroutifcatcherhasTA+orTAarm.Otherwise,allattemptsare

safe.78-82 BasestealeroutifcatcherhadTA+,TAorTBarm.Otherwise,allattempts

aresafe.83-84 Runnerpickedofffirstbasebypitcher.85 Runnerpickedofffirstbasebycatcher.

86-88 Allrunnerscaughtstealing.Note–Theoutorerrorisgiventosecondbasemanwithright-handedhitterattheplate.Theoutorerrorisgiventoshortstopwithleft-handedhitterattheplate.*ifthisresultisreachedfromthehitandrunbatterorpitchercontrolcharts,thencatcherthrowswildlytoleadbaseandresultsareasotherwisestated.

Updated January 5, 2016

Page 31: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

STEALINGTHIRDBASE

Oncethebaserunneronsecondgetsajump,drawnextFACandconsulttheSBratingofthebasestealerandthenewRNtodeterminetheoutcome.

11-12 Ifleft-handedhitterisatbat,thenbasestealeriscaughtstealing.Ifbatteris

right-handed,basestealersteals3rdbase.13-33 Allbasestealerssteal3rdbase.34-37 BasestealersratedA+thruDsteal3rdbase.Allothersarecaughtstealing.38-44 BasestealersratedA+thruCsteal3rdbase.Allothersarecaughtstealing.45-46 BasestealersratedA+thruC+steal3rdbase.Allothersarecaughtstealing.47-51 BasestealersratedA+thruBsteal3rdbase.Allothersarecaughtstealing.52-54 BasestealersratedA+thruB+steal3rdbase.Allothersarecaughtstealing.55-57 BasestealersratedA+andAsteal3rdbase.Allothersarecaughtstealing.58-61 OnlybasestealersratedA+steal3rdbase.Allothersarecaughtstealing.62-63 Basestealercaughtstealing.64 Wildthrowbycatcher.Stolenbaseanderror.Basestealerscores.Anyother

runnersadvanceonebase.65 Catchercan’tgetballoutofmitt.Basestealersteals3rdbase.Allother

runnershold.66 Thirdbasemandropstheball.Error.Nostealcreditgiven.Allotherrunners

hold.67 Throwfromcatchersailshigh.Erroroncatcher.Basestealerscores,all

otherrunneradvanceonebase.68 BALK–checknextFACforyes/noonbalk.Ifyes,allrunnersadvanceone

base.Ifno,continuenormalplayandrunnermustwaitonebatterbeforeattemptingtostealagain.

71 Pitcher*throwswildlyonpickofftosecondbase.Erroronpitcher.Basestealertothird,allotherrunnersadvanceonebase.

72 Pitcher*throwswildlyonpickofftosecondbase.Erroronpitcher.OBR-AandOBR-Bbasestealersscore.Allotherbasestealersstopatthird.Anyotherrunnersadvanceonebase.

73-75 Basestealercaughtstealing.76-77 BasestealeroutifcatcherhasTA+arm.Otherwise,allattemptsaresafe.78-82 BasestealeroutifcatcherhadTA+orTAarm.Otherwise,allattemptsare

safe.83-85 BasestealeroutifcatcherhadTA+,TAorTBarm.Otherwise,allattempts

aresafe.86-88 Basestealercaughtstealing.Note–Allcaughtstealingarescoredcatchertothirdbaseman.*ifthisresultisreachedfromthehitandrunbatterorpitchercontrolcharts,thencatcherthrowswildlytoleadbaseandresultsareasotherwisestated.

Updated January 5, 2016

Page 32: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

STEALINGHOME

Oncethebaserunneronthirdgetsajump,drawnextFACandconsulttheSBratingofthebasestealerandthenewRNtodeterminetheoutcome.

11-12 Ifleft-handedhitterisatbat,thenbasestealeriscaughtstealing.Ifbatteris

right-handed,basestealerstealshome.13 Allbasestealersstealhome.

14-16 BasestealersratedA+thruBstealhome.Allothersarecaughtstealing.17-21 BasestealersratedA+thruB+stealhome.Allothersarecaughtstealing.22-24 BasestealersratedA+thruAstealhome.Allothersarecaughtstealing.25-27 OnlybasestealersratedA+stealhome.Allotherarecaughtstealing.28-37 Batterhitsfoulball.Runnerholds.DrawanotherPBandcontinuenormal

play.38-41 CD-3andCD-4ratedcatcherstagbasestealerout.CD-2andCD-1rated

catcherdropstheball.Error.Basestealersafeandallotherrunnershold.42 TA+andTAratedcatcherspickrunneroffthirdbase.Allotherrated

catchersforcerunnerbacktobag.Continuenormalplay.43-44 Basestealerpickedoffthirdbasebycatcher.45-46 Wildthrowbycatcher.Stolenbaseanderror.Basestealerscores.Anyother

runnersadvanceonebase.47 BALK–checknextFACforyes/noonbalk.Ifyes,allrunnersadvanceone

base.Ifno,continuenormalplayandrunnermustwaitonebatterbeforeattemptingtostealagain.

48 Pitcherrattledandthrowshomelate.Allratedstealersaresafe.51-88 Basestealercaughtstealing.Note–Allcaughtstealingarescoredpitchertocatcher.

Updated January 5, 2016

Page 33: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

SQUEEZE  PLAY    

This  play  is  used  when  third  base  is  occupied.  Ignore  PB  draw.  Draw  a  new  card  to  obtain  new  RN  and  use  this  chart,  using  the  SAC  rating  of  the  batter.    SAC:  A   SAC:  B   SAC:  C   SAC:  D   Result  

11-­‐28   11-­‐26   11-­‐21   11-­‐16   Batter  out,  P  –  1B.  All  runners  advance  one  

base.  Sacrifice.  

31-­‐32   27-­‐28   22-­‐25   17-­‐22   All  safe  on  FC.  Sacrifice.  

33-­‐38   31-­‐38   26-­‐38   23-­‐38   Runner  out  at  home,  P  –  C.  All  other  

runners  advance  one  base.    

41-­‐43   41-­‐43   41-­‐43   41-­‐43   Runner  out  at  home,  1B  –  C.  All  other  

runners  advance  one  base.  

44-­‐46   44-­‐46   44-­‐46   44-­‐46   Runner  out  at  home,  3B  –  C.  All  other  

runners  advance  one  base.  

47-­‐52   47-­‐52   47-­‐52   47-­‐52   Error  on  pitcher.  All  safe.  Sacrifice.  

53-­‐54   53-­‐57   53-­‐63   53-­‐71   Batter  misses  pitch.  Runner  out  caught  

stealing  P  –  C.  

55-­‐71   58-­‐71   64-­‐71   72-­‐78   Batter  fouls  out  to  catcher.  Runners  hold.  

72-­‐88   72-­‐88   72-­‐88   81-­‐88   Batter  pops  out  to  pitcher.  Runners  hold.  

 

Updated January 5, 2016

Page 34: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

TAGGING UP FROM THIRD ON OUTFIELD FLY This chart is used in any situation when there a runner is on third base with fewer than two outs and the result is an F or an FD. Follow the steps below and then consult the chart (if necessary). Step One (type of fly ball): If the fly ball is an FD, a runner on third tags up and scores without a throw, regardless of speed. Check other charts for possible advance by runners tagging up from second and/or first. If the fly ball is an F, check the RN of the current FAC card (i.e., don’t draw a new FAC card). If the RN is an odd number, the F is a routine fly ball. If the RN is an even number, the F is a fly ball that is more difficult for the outfielder to line up and make his best throw – in this case, the runner’s OBR is considered one faster than normal for purposes of this play (e.g., an OBR C becomes an OBR B, and an OBR A becomes an OBR A+). Step Two (arm of outfielder): To determine the correct column to use in the following table, start with the (modified) OBR of the runner on third. Then adjust based on the arm of the outfielder who caught the fly, as follows: T5= make runner’s OBR two columns slower T4= make runner’s OBR one column slower T3= no adjustment T2= make runner’s OBR one column faster T1= make runner’s OBR two columns faster Note: If result is faster than Column A, use Column A. Step Three (manager decisions): Once the correct column has been determined, the offense must decide whether to send the runner home. If the offense decides to send the runner, draw a new FAC and consult the chart below (but see Defensive Option below). If the defense throws home, the result for any other runner(s) is dictated by the chart (do not consult charts for runners tagging up from second or first). If the offense decides to hold the runner at third, see chart for runner tagging up from first, if applicable. Defensive Option: If the offense sends the runner to home, the defensive manager may choose not to make the throw home, conceding the run. In that case, other runner(s) may attempt to tag and advance (see charts for runners tagging up from second or first). Step Four: Draw a new FAC and use RN on chart below (unless runner held or run conceded). Solitaire Game: In a solitaire game without instructions otherwise: (1) on an FD, runner on third tags and scores, and (2) on an F, runner on third tags up and tries to score if Column A, B, or C, unless the runner’s team is more than two runs behind or unless sending the runner would be a clearly unwise baseball decision, in the judgment of the solitaire manager (e.g., runner on third only, 9th inning, team behind by two runs).

Updated January 5, 2016

Page 35: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

A+2 A+1 A B C D Result

11-12 11-12 11-12 11 11 11

Runner safe at third. If outfielder is E2-10, his throw to third sails into the dugout – runner awarded home, and runner on first advances one base (charge error to outfielder).

13-14 13-14 13-14 12 12 12 Same as above, but E3-10 outfielder makes wild throw. 15-16 15-16 15-16 13 13 -- Same as above, but E4-10 outfielder makes wild throw.

17-34 17-31 17-26 14-18 14 -- Runner safe at third. OBR A-B runner on first takes second on the play.

35 32 27 21 15 13

Runner safe at third. If outfielder is CD 1, his throw misses the cutoff man – runner on first takes second (no error charged). Otherwise, runner on first tries for second and is thrown out by cutoff man.

36 33 28 22 16 14 Same as above, but CD 1-2 outfielder misses cutoff man. 37 34 31 23 17 -- Same as above, but CD 1-3 outfielder misses cutoff man.

38 35 32-34 24-33 18-34 15-32 Runner out at third. OBR A runner on first takes second on the play.

41-65 36-61 35-52 34-45 35-36 33 Runner safe at third. Runner on first holds.

66 62 53 46 37 34 If third baseman is E0-3, runner out at third; otherwise, safe (error on third baseman, dropped the tag). OBR A-B runner on first takes second on the play.

-- 63 54 47 38 35 Same as above, but E0-4 third baseman makes the play. -- 64-65 55-63 48-63 41-62 36-61 Runner out at third. Runner on first holds.

67 66 64 64 63 62 Runner safe at third. Runner on first holds. Third baseman is shaken up on the play and must leave the game. Third baseman may return the next day.

-- 67 65 65-66 64-65 63-64 Runner safe at third. OBR A-B runner on first takes second; OBR C-D runner on first thrown out trying to advance to second. OBR E runner on first holds.

68 68 66 67 66 65 If third baseman is CD 4, he makes great play to tag runner out at third; otherwise, runner safe at third. Runner on first holds.

71 71 67 68 67 66 Same as above, but CD 3-4 third baseman makes great play.

-- 72 68 71 68 67 Same as above, but CD 2-4 third baseman makes great play.

72-87 73-85 71-82 72-76 71 -- Runner safe at third. OBR A runner on first takes second on the play.

88 86 83 77 72 68 Runner out at third. Runner on first holds. Runner is shaken up on the play at third and must leave the game. Injured runner may return the next day.

-- 87 84-87 78-86 73-86 71-86 Runner out at third. OBR A-B runner on first takes second on the play.

-- 88 88 87-88 87-88 87-88

Runner called safe at third. Runner on first holds. Defense appeals that runner left second early. Umpire upholds appeal and calls runner out at third. (Note: If runner scored from third on this play, the run counts).

95% 88% 70% 50% 25% 15% Approximate % chance that runner will be safe.

Updated January 5, 2016

Page 36: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

TAGGING UP FROM SECOND ON OUTFIELD FLY This chart is used in when there a runner is on second base (and no runner on third base) with fewer than two outs and the result is an FD or an F. It also is used in FD and F situations when the bases are loaded or runners are on second and third and the defensive manager chose not to throw to the plate (see Defensive Option on the Tagging Up from Third on Outfield Fly chart). Follow the steps below and then consult the chart (if necessary). Step One (type of fly ball): If the fly ball is an FD8 or FD9, the runner’s OBR is considered two faster than normal for purposes of this play (e.g., an OBR C becomes an OBR A, and an OBR B becomes an OBR A+). If the fly ball is an FD7, there is no change to the runner’s OBR. If the fly ball is an F7, the runner’s OBR is considered two slower than normal for purposes of this play (e.g., an OBR D becomes an OBR E-1). If the fly ball is an F8, there is no change to the runner’s OBR. If the fly ball is an F9, the runner’s OBR is considered one faster than normal for purposes of this play (e.g., an OBR A becomes an OBR A+). Step Two (arm of outfielder): To determine the correct column to use in the following table, start with the (modified) OBR of the runner on second. Then adjust based on the arm of the outfielder who caught the fly, as follows: T5= make runner’s OBR two columns slower T4= make runner’s OBR one column slower T3= no adjustment T2= make runner’s OBR one column faster T1= make runner’s OBR two columns faster

Note: If result is faster than Column A+2, use Column A+2. If result is Column E or worse, then runner must hold (too slow to attempt to tag up and advance).

Step Three (manager decisions): Once the correct column has been determined, the offense must decide whether to send the runner to third. If the offense decides to send the runner, draw a new FAC and consult the chart below (but see Defensive Option below). The result for a runner on first is dictated by the chart (do not consult charts for runner tagging up from first). Defensive Option: If the offense decides to send the runner to third, the defensive manager may choose not to make the throw to third, conceding the base. In that case, runner on first may attempt to tag and advance (see chart for runner tagging up from first). Step Four: Draw a new FAC and use RN on chart below (unless runner held or base conceded). Solitaire Game: In a solitaire game without instructions otherwise, runner on second tags up and tries for third if Column A, A+1, or A+2, unless the runner’s team is more than two runs behind or unless sending the runner would be a clearly unwise baseball decision, in the judgment of the solitaire manager (e.g., runner on second only, 9th inning, team behind by two runs).

Updated January 5, 2016

Page 37: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

A B C D E E -1 E-2 Result1 -- 11-12 11-15 11-22 11-27 11-32 11-34 Runner out at home. OBR A-B runner on second takes

third on the play. All other runners hold.

-- 13 16 23-35 28 33 -- If catcher is E0-1, runner out at home; otherwise, runner safe (error on catcher). Runner on second takes third; runner on first holds.

-- 134 17 36 31 34 35 Same as above, but E0-2 catcher makes the play. -- 145 18-25 37 32-51 35-56 36-61 Runner out at home. All other runners hold.

-- 16-17 26-31 38-45 52-61 57-67 62-75 Runner out at home. OBR A-B runner on second takes third; OBR C-D runner on second thrown out at third; OBR E runner on second holds. Runner on first holds.

11-12 18 32 46 62 68 76 Runner safe at home. If outfielder is CD 1, his throw goes over the cutoff man’s head -- all runners advance one base (no error charged). Otherwise, hold.

13-14 21 33 47 63 71 77 Same as above, but CD 1-2 outfielder misses cutoff man. 15-16 22 34 48 64 72 78 Same as above, but CD 1-3 outfielder misses cutoff man.

17 23 35 51 65 73 81 Runner safe at home. OBR A-D runner on first takes second. Catcher is shaken up on the play and must leave the game. Catcher may return the next day.

-- 24 36 52 66 74 -- If catcher is CD 4, he makes great play to tag runner out at home; otherwise, runner safe. All runners hold.

-- 25 37 53 67 75 82 Same as above, but CD 3-4 catcher makes great play. -- 26 38 54 68 76 83 Same as above, but CD 2-4 catcher makes great play.

18-21 27 41 55 71 77 84 Runner safe at home. If outfielder is E4-10, his throw is wild – all runners advance one base (charge error to outfielder if any trailing runner advances).

22-23 28 42 56 72 78 85 Same as above, but E3-10 outfielder makes wild throw. 24-25 31 43 57 73 81 -- Same as above, but E2-10 outfielder makes wild throw.

26 32 44 58-61 74-75 82-83 86-87 Runner called safe at home. All runners hold. Defense appeals that runner left third base early. Umpire upholds appeal and calls runner out (run does not count).

27 33 45 62 76 84 --

Runner safe at home. Throw to home is off line. If pitcher backing up the play is CD 1-2, all runners advance one base (error on outfielder). Otherwise, all runners hold.

28 34 46 63 77 85 88 Runner out at home. All runners hold. Runner is shaken up on the play and must leave the game. Injured runner may return the next day.

31-37 35-41 47-52 64-71 78-82 86 -- Runner safe at home. OBR A runner on second takes third; OBR B-C runner on second thrown out at third; OBR D-E runner on second holds. Runner on first holds.

38-74 42-78 53-78 72-82 83-85 87 -- Runner safe at home. OBR A-B runner on second takes third on the play. All other runners hold.

75-88 81-88 81-88 83-88 86-88 88 -- Runner safe at home. OBR A-C runner on second takes third on the play. OBR A runner on first takes second (if base is open). All other runners hold.

97% 85% 70% 50% 30% 21% 11% Approximate % chance that runner will be safe.

1 Example #1: OBR B runner on third – F8 to outfielder with T4 arm – FAC card shows RN 68. OBR B becomes OBR A for purposes of this play (because RN on current FAC card is an even number). Adjusting for outfielder’s arm, OBR A becomes one column slower. Use Column B on the chart below. Example #2: OBR D runner on third – F9 to outfielder with T5 arm – FAC card shows RN 57. No change to OBR based on type of fly ball (because RN on current FAC card is an odd number). Adjusting for outfielder’s arm, OBR D becomes two columns slower. Use Column E-1 on the chart below.

Updated January 5, 2016

Page 38: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

TAGGING FROM FIRST ON OUTFIELD FLY This chart is used in when there a runner is on first base (and no other runners) with fewer than two outs and the result is an FD. It also is used in FD situations with multiple runners, including a runner on first, and the defensive manager chose the Defensive Option, conceding the next base to the lead runner(s) (see preceding charts). Follow the steps below and then consult the chart. Note: An F is not deep enough for a runner on first to tag and try for second. Step One (difficulty of fly ball): Check the RN of the current FAC card (i.e., don’t draw a new FAC card). If the RN is an odd number, the FD is a routine deep fly ball. If the RN is an even number, the FD is a deep fly ball that is more difficult for the outfielder to line up and make his best throw – in this case, the runner’s OBR is considered one faster than normal for purposes of this play (e.g., an OBR C becomes an OBR B, and an OBR A becomes an OBR A+). Step Two (arm of outfielder): To determine the correct column to use in the following table, start with the (modified) OBR of the runner on third. Then adjust based on the arm of the outfielder who caught the fly, as follows: T5= make runner’s OBR two columns slower T4= make runner’s OBR one column slower T3= no adjustment T2= make runner’s OBR one column faster T1= make runner’s OBR two columns faster Note: If result is slower than Column A, runner must hold at first. Step Three (manager decision): Once the correct column has been determined, the offense must decide whether to send the runner to second. If the offense sends the runner, draw a new FAC and use RN on chart below. (If FD8 or FD 9, SS receives throw; if FD7, 2B receives throw). Solitaire Game: In a solitaire game without instructions otherwise, runner on first holds. A+3 A+2 A+1 A Result

-- 11-16 11-24 11-33 Runner out at second.

11 17 25 34 Runner safe at second. Fielder covering second is shaken up on the play and must leave the game. Fielder covering second may return the next day.

12-13 18-21 26-27 35-36 If fielder receiving the throw is CD 4, he makes a great play to tag runner out at second; otherwise, runner safe at second.

14-15 22-23 28-31 37-38 Same as above, but CD 3-4 fielder covering second makes great play. 16 24-25 32-33 41-42 Same as above, but CD-2-4 fielder covering second makes great play.

17 26 34 43 Runner out at second. Runner is shaken up on the play and must leave the game. Injured runner may return the next day.

18 27 35-36 44-45

Runner called safe at second. Defense appeals that runner left first early. Umpire upholds appeal and calls runner out at first. (Note: If runner scored from third on this play, the run counts. If runner advanced from second to third on this play, he stays at third.)

21-88 28-88 37-88 46-88 Runner safe at second. 92% 83% 72% 61% Approximate % chance that runner will be safe.

Updated January 5, 2016

Page 39: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

DEFENSE  OPTION  PLAY  CHART    

The  offense  decides  whether  to  send  a  runner  on  third  home.  If  this  a  potential  tie-­‐breaking  run,  in  the  7th  inning  or  later,  the  defense  (visitors  /  solitaire  game)  plays  the  infield  in  to  try  to  get  the  runner  at  home,  with  a  runner  on  third  and  less  than  two  outs.  Otherwise,  the  defense  (visitors/solitaire  game)  plays  the  infield  back  and  makes  the  play  at  first.  To  resolve  a  play  at  home,  draw  a  new  FAC  and  check  the  RN.      

Runner  Rating  

Runner  SAFE  at  home  

Runner  OUT  at  home  

OBR-­‐A   11-­‐48   51-­‐88  

OBR-­‐B   11-­‐42   43-­‐88  

OBR-­‐C   11-­‐35   36-­‐88  

OBR-­‐D   11-­‐32   33-­‐88  

OBR-­‐E   11-­‐28   31-­‐88  

   Note:  The  visiting  team  (in  a  solitaire  game)  will  attempt  to  score  ONLY  if  the  runner  on  third  is  rated  OBR-­‐A.  Otherwise,  visitors  must  hold  at  third.    The  Defense  Option  Play  is  only  used  when  called  for  on  the  Out  Chart.  The  home  team  (in  a  solitaire  game)  must  decide  where  to  play  the  infield  prior  to  the  play  whenever  a  man  is  on  third  base  and  less  than  two  outs.  

Updated January 5, 2016

Page 40: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

Z  PLAY  INJURY  CHART    

Use  this  table  when  referred  from  Basic  Z  chart.  Obtain  a  new  random  number  and  find  out,  first,  the  description  of  the  injury  and  second,  the  number  of  games  to  be  missed.  All  pitchers  are  considered  to  have  an  Injury  Rating  of  5,  unless  noted  otherwise.      

Inj  Rating   Games  to  be  Missed  

0   Remainder  of  this  game  only.  1   Remainder  of  this  game  and  following  game.  2   Use  first  digit  of  next  random  number.  Limit  of  5  games.  3   Use  first  digit  of  next  random  number.  4   Add  both  digits  of  next  random  number.  Limit  of  10  games.  5   Add  both  digits  of  next  random  number.  6   Multiply  digits  of  next  random  number.  Limit  is  20  games.  7   Multiply  digits  of  next  random  number.  Limit  is  30  games.  8   Use  next  random  number.  

   Note:  In  instances  of  a  collision,  the  one  that  has  the  higher  injury  rating  is  the  one  that  is  hurt.  If  they  have  the  same  rating,  check  both  fielders.  The  one  that  misses  more  games  is  the  one  that  is  hurt.  The  other  is  shaken  up  and  removed  for  this  game  only.    For  example,  if  collision  between  LF  and  CF.    If  the  LF  would  miss  10  games  and  CF  would  miss  15  games,  the  LF  is  out  for  this  game  and  the  CF  is  hurt  for  15  games.        DESCRIPTION  OF  INJURIES    RN   Description  

11   Batter  hits  a  slow  groundout  to  SS  and  pulls  muscle.  Check  injury  on  batter.  Batter  may  still  play  during  injury,  but  only  as  DH  or  pinch  hitter.  His  OBR  and  SB  ratings  are  reduced  two  categories  for  the  duration  of  the  injury.  Runners  advance  one  base.  

12   During  the  at-­‐bat,  pitcher  starts  rubbing  his  shoulder.  Trainer  comes  out  and  the  pitcher  is  removed  from  the  game.  Check  injury  of  pitcher.  Injury  rating  of  pitcher  is  5.  

13   Batter  brushed  back  with  pitch.  Dugouts  empty  in  all  out  brawl.  Both  batter  and  pitcher  are  ejected.  Check  batter  and  pitcher  for  injury.  Player  with  more  games  injured  is  hurt,  the  other  is  shaken  up,  but  is  ok.  Give  pitcher  an  injury  rating  of  6.  

14   Batter  hits  a  sizzling  liner  off  the  third  baseman’s  chest  for  a  single.  Runners  advance  one  base.  Check  3B  for  injury.  

Updated January 5, 2016

Page 41: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

15   Pitcher  lands  wrong  on  follow  through  and  talks  to  pitching  coach  at  half  inning  and  cannot  continue  in  this  game.  

16   Groundball  in  the  hole  to  second  baseman.  He  leaps,  spins  and  throws  out  batter  but  twists  his  back.  Runners  advance  one  base.  Check  for  injury  on  2B.  

17   Groundball  to  1B.  Ball  takes  bad  hop  and  hits  fielder  in  the  face.  Batter  safe  at  first  on  single.  All  runners  advance  one  base.  Check  injury  on  1B.  

18   Sailing  fastball  hits  batter  in  the  head.  Change  injury  rating  of  batter.  21   High  fly  into  short  left.  Crowd  noise  prevents  SS  and  LF  from  hearing  each  other  

and  they  collide.  Give  batter  credit  for  double  and  all  runners  score,  except  OBR-­‐D  and  OBR-­‐E  from  first  stop  at  third.  Check  injuries  to  SS  and  LF.  

22   High  fly  into  right-­‐center  field.  CF  and  RF  collide.  Give  batter  credit  for  double  and  all  runners  score,  except  OBR-­‐D  and  E  from  first  stop  at  third.  Check  collision  injuries  to  CF  and  RF.  

23-­‐25   Pitcher  develops  arm  trouble.  Check  for  injury,  giving  pitcher  injury  rating  of  6.  26-­‐28   Foul  tip  hits  catcher.  Check  injury  on  C.  31   Third  baseman  falls  into  dugout  chasing  foul  pop  up.  CD-­‐3  or  4  makes  catch,  

otherwise,  foul  ball.  Check  injury  on  3B.  32   First  baseman  falls  into  stands  chasing  foul  pop  up.  CD-­‐3  or  4  makes  catch,  

otherwise,  foul  ball.    Check  injury  on  1B.  33   Pitcher  hit  by  line  drive.  Single.  All  runners  advance  one  base.  Check  for  injury,  

giving  pitcher  injury  rating  of  5.  34   Line  drive  to  left  field.  LF  takes  one  step,  grabs  his  hamstring.  Batter  safe  at  first.  

Runners  advance  one  base.  Check  injury  on  LF.  35-­‐36   Batter  fouls  pitch  off  his  foot.  Check  injury  on  batter.  37   CF  runs  after  long  fly  and  crashes  into  fence.  OBR-­‐A,  inside  the  park  home  run,  

OBR-­‐B  &  C,  triple.  OBR-­‐D  &  E,  double.  Check  injury  to  CF.  Runners  advance  three  bases  except  OBR-­‐D  &  E  who  advance  two  bases.  

38   Catcher  chases  high  pop  foul  and  falls  into  dugout.  CD-­‐3  or  4  makes  catch,  otherwise,  foul  ball.  Check  injury  on  C.  

41   Pitcher  develops  blister.  Must  be  removed  from  game.  Check  for  injury.  Injury  rating  of  pitcher  4.  

42   Line  drive  down  right  field  line.  RF  catches  cleat  and  stumbles.  Ball  rolls  into  RF  corner  for  a  triple  for  OBR-­‐A  &  B.  Double  for  others.  All  runners  score.  Check  injury  on  RF.  

43   LF  wrenches  knee  diving  for  low  liner.  Double,  two  base  advance.  Check  injury  on  LF.  

44   CF  twists  ankle  cutting  off  single.  Runners  advance  two  bases.  Check  injury  on  CF.  45   RF  jars  shoulder  attempting  a  diving  catch.  Double.  Runners  advance  two  bases.  

OBR-­‐A  runner  scores  from  first.  Check  injury  on  RF.  46   Batter  pulls  muscle  striking  out.  Check  injury  on  batter.  47   Batter  hits  slow  roller  to  1B  who  flips  to  P  covering.  Batter  and  pitcher  collide  and  

ball  knocked  loose.  Single.  Runners  advance  one  base.  Both  pitcher  and  batter  are  injured.  Check  injury  on  pitcher  and  hitter.  

48   Routine  grounder  to  SS  who  throws  for  lead  runner,  who  is  hurt  sliding.  Check  injury  on  runner.  If  no  one  base,  batter  out  at  first.  

51   Routine  grounder  to  SS.  If  less  than  2  outs,  runner  on  1st  takes  out  2B.  Runner  out,  batter  safe.  Check  for  injuries  on  fielder  and  runner.  One  with  greater  injuries  is  the  one  hurt.  Other  is  shaken  up  and  leaves  the  game.  Runners  advance  one  base.  If  no  one  on  base,  batter  out  at  first.  

Updated January 5, 2016

Page 42: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

52   LF  and  CF  collide.  Check  collision  injuries  to  LF  and  CF.  Batter  and  runner(s)  rated  OBR-­‐A  or  B  speed  advance  two  bases,  all  others  advance  one.  

53   If  game  is  in  8th  inning  or  later,  RF  loses  liner  in  the  sun  and  is  hit  in  the  face.  Scored  a  double.  OBR-­‐A  &  B  runners  advance  two  bases.  All  others  advance  one  base.  Check  injury  on  RF.  

54   Groundball  in  the  hole  to  shortstop.  He  leaps,  spins  and  throws  out  batter  but  twists  his  back.  Runners  advance  one  base.  Check  for  injury  on  SS.  

55   With  runner  on  2nd,  batter  hits  single  to  CF.  Play  at  the  plate.  Runner  and  catch  collide.  Check  collision  injury  on  both  runner  and  catcher.  

56   Batter  hits  long  foul  drive  into  the  stands.  While  running  to  first,  batter  comes  up  lame  grabbing  his  hamstring.  Check  injury  on  batter.  

57   C  hurt  diving  for  foul  pop  up.  CD-­‐3  and  CD-­‐4  catcher  makes  catch.  Check  for  injury  on  C.  

58   Slow  grounder  to  SS.  Batter  tries  to  beat  out  the  hit,  spikes  the  1B,  trips  and  falls.  Credit  batter  with  single.  Check  batter  AND  1B  for  injury.  One  with  longer  injury  time  is  hurt,  the  other  leaves  for  the  remainder  of  the  game.  OBR-­‐A  base  runner  advance  two  bases,  all  others  advance  one.  

61   Ground  ball  to  first  baseman.  He  steps  on  the  bag  wrong  and  rolls  his  ankle.  Batter  is  out.  First  baseman  is  out  for  the  remainder  of  this  game  only.  

62   Ground  ball  to  second  baseman.  Tries  to  barehand  the  ball  and  jams  his  finger  but  still  completes  the  play  at  first.  Second  baseman  is  out  of  the  remainder  of  this  game  only.  

63   Ground  ball  to  shortstop.  Ball  takes  a  bad  hop  and  hits  fielder  in  the  throat.  Batter  safe  at  first  on  single.  All  runners  advance  one  base.  Shortstop  is  out  of  the  remainder  of  this  game  only.  

64   Ground  ball  to  third  baseman.  He  takes  the  ball  off  this  chest  but  still  completes  the  play  at  first.  Third  baseman  is  out  of  the  remainder  of  this  game  only.  

65   Batter  hits  slow  roller  in  front  of  home  plate.  Catcher  grabs  the  ball  and  throws  out  runner,  but  steps  in  his  mask  and  falls  awkwardly.  He  is  out  for  the  remainder  of  this  game  only.  

66   Fly  ball  to  left  fielder.  He  back  pedals  into  a  divot  and  steps  awkwardly.  Catches  the  ball,  but  is  removed  from  this  game  at  the  half  inning.  He  misses  the  remainder  of  this  game  only.  

67   Fly  ball  to  center  fielder.  While  drifting  to  his  right,  he  steps  on  cup  thrown  on  field.  He  catches  the  ball,  but  is  removed  from  this  game  at  the  half  inning.  He  misses  the  remainder  of  this  game  only.  

68   Fly  ball  to  right  fielder.  While  chasing  ball,  fielder  steps  into  drainage  ditch,  twisting  his  ankle,  but  still  makes  catch.  He  misses  the  remainder  of  this  game  only.    

71-­‐88   No  action.  Play  resumes  as  normal.    

Updated January 5, 2016

Page 43: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

BASES EMPTY OUT CHART

G1: Ground out P - 1B G2: Ground out C - 1B G3: Ground out 1B - u G4: Ground out 2B - 1B G5: Ground out 3B - 1B

G6: Ground out SS - 1B

GX1: Ground out P - 18 GX2: Ground out C - 1B

GX3: Ground out 18 - u GX4: Ground out 2B - 1B GX5: Ground out 3B - 18 GX6: Ground out SS -18 G1A: Ground out P - 18 G2A: Ground out C - 1B G3A: Ground out 18- u G4A: Ground out 213 - 18 G5A: Ground out 3B - 1B

G6A: Ground out SS - 1B G3-1A: Ground out 1B - P F7: Fly out LF

F8: Fly out CF F9: Fly out RF FD7: Fly out Deep LF FD8: Fly out Deep CF FD9: Fly out Deep RF L1:

Line out P L3: Line out 18.

L4: Line out 213

L5: Line out 38

L6: Line out SS Fl:

Pop out P F2: Foul out C F3: Foul out 18

F4: Pop out 28 F5: Foul out 38 F6: Pop out SS

ERROR SEQUENCE Error 1: Fielder bobbles ball. Batter safe. Error 2: Wild throw to 1st. Batter to 2nd if OBR-A or B

Error 3: Booted groundball. Batter safe.

Error 4: Hit gets past outfielder. SINGLE: Batter to 2nd

DOUBLE: Batter to 3rd. OBR-A scores

TRIPLE: Batter scores

Error 5: OF cannot pick up ball. Batter takes extra base.

No error if OBR-D or E as he doesn't advance.

MAN ON FIRST OUT CHART

G1: Double play groundout, P-2B-1B. OBR-A safe at 1st. G2: Double play groundout, C-SS-1B. OBR-A safe at 1st. G3: Double play groundout, 1B-SS-1B. OBR-A or B safe at 1st. G4: Double play groundout, 28-55-1B. G5: Double play groundout, 38-28-1B. OBR-A safe at 1st G6: Double play groundout, 55-28-1B GX1: Force out at 2nd, P-2B. Batter safe. GX2: Force out at 2nd, C-SS. Batter safe. GX3: Force out at 2nd, 18-SS. Batter safe. GX4: Force out at 2nd, 2B-SS. Batter safe. GX5: Force out at 2nd, 38-28. Batter safe. GX6: Force out at 2nd, SS-2B. Batter safe. G1A: Ground out P -1B. Runner to 2nd.

G2A: Ground out C - 18. Runner to 2nd. G3A: Ground out 1B - u. Runner to 2nd. G4A: Ground out 213 - 113. Runner to 2nd. G5A: Ground out 38- 1B. Runner to 2nd.

G6A: Ground out SS - 1B. Runner to 2nd. G3-1A: Ground out 18- P. Runner to 2nd. F7: Fly out to LF. See Tagging Up From First on OF Fly F8: Fly out to CF. See Tagging Up From First on OF Fly F9: Fly out to RF. See Tagging Up From First on OF Fly FD7: Flyout deep LF. See Tagging Up From First on OF Fly FD8: Flyout deep CF.. See Tagging Up From First on OF Fly FD9: Flyout deep RF. See Tagging Up From First on OF Fly L1: Line out P. Runner holds. L3: Line out 18. Runner holds. CD-4 doubles off runner L4: Line out 28.

L5: Line out 3B

L6: Line out SS Fl: Pop out P. Runner holds

F2: Pop out C. Runner holds. F3: Pop out 1B. Runner holds. F4: Pop out 28. Runner holds. F5: Pop out 38. Runner holds. F6: Pop out SS. Runner holds.

ERROR SEQUENCE

Error 1: Grounder mishandled. Batter safe. Runner to 2nd. Error 2: Wild throw. Batter safe, runner to 3rd

Error 3: Muffed ground ball. Batter safe. Runner to 2nd. Error 4: Outfielder kicks ball. Runner scores, batter gets

extra base.

Error 5: Ignore. No error occurs

MAN ON SECOND OUT CHART

G1: Ground out P - 1B. Runner holds. OBR-A runner to 3rd. G2: Ground out C - 1B. Runner holds. G3: Ground out 1B - u. Runner to 3rd. G4: Ground out 28- 1B. Runner to 3rd. G5: Ground out 38 - 1B. Runner holds. G6: Ground out SS - 18. Runner holds. GX1: Ground out P -18, Runner holds. OBR-A runner to 3rd. GX2: Ground out C - 1B. Runner holds. GX3: Ground out 18 - u. Runner to 3rd. GX4: Ground out 28- 1B. Runner to 3rd. GX5: Ground out 38 - 1B. Runner holds. GX6: Ground out SS- 18. Runner to 3rd. G1A: Ground out P - 1B. Runner to 3rd. G2A: Ground out C - 1B. Runner to 3rd.

G3A: Ground out 18- u. Runner to 3rd. G4A: Ground out 28 -1B. Runner to 3rd. GSA: Ground out 38- 1B. Runner to 3rd. G6A: Ground out SS - 1B. Runner to 3rd.

G3-1A: Ground out 1B - P. Runner to 3rd. F7: Fly out LF. See Tagging Up From Second on OF Fly F8: Fly out CF. See Tagging Up From Second on OF Fly F9: Fly out RF. See Tagging Up From Second on OF Fly FD7: Fly out deep LF. See Tagging Up From Second on OF Fly FD8: Fly out deep CF. See Tagging Up From Second on OF Fly FD9: Fly out deep RF. See Tagging Up From Second on OF Fly L1: Line out P. Runner holds. L3: Line out 1B. Runner holds. L4: Line out 213. Runner holds. CD-4 at 213 doubles off runner L5: Line out 38. Runner holds. L6: Line out SS. Runner holds. Fl: Soft pop out P. Runner holds. F2: Foul out C. Runner holds. F3: Foul out 113. Runner holds. F4: Pop out 28. Runner holds. F5: Pop out 313. Runner holds. F6: Pop out SS. Runner holds.

ERROR SEQUENCE

Error 1: Ground ball through fielder legs. Batter safe. Runner to 3rd. OBR-A runner scores if two outs.

Error 2: Wild throw. Batter to 2nd. Runner scores. Error 3: Ball rolls up fielder arm and can't make play. Batter

safe. Runner holds. If 2 outs, runner advances to 3rd.

Error 4: Outfielder drops ball. Batter takes extra base. Runner

scores.

Error 5: Runner scores, batter takes extra base, thrown out if

outfielder is T5

Updated January 5, 2016

Page 44: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

MAN ON THIRD OUT CHART

G1: INFIELD IN: Ground out P - 1B. Runner holds.

INFIELD BACK: Ground out P - 18. Runner holds.

G2: IN: Ground out C - 1B. Runner holds.

BACK: Ground out C - 18. Runner holds.

G3: IN: Consult Defensive Option Chart

BACK: Ground out 1B - u. OBR A or B scores. C, D or E holds

G4: IN: Consult Defensive Option Chart

BACK: Ground out 2B - 1B. OBR A, B or C scores. D or E holds

G5: IN: Consult Defensive Option Chart

BACK: Ground out 3B-1B. OBR A scores. Others have Def Option

G6: IN: Consult Defensive Option Chart BACK: Ground out SS - 1B. OBR A, B or C scores. D or E holds

GX1: IN: Ground out P - 1B. Runner holds.

BACK: Ground out P - 1B. Runner holds.

GX2: IN: Ground out C - 1B. Runner holds. BACK: Ground out P - 18. Runner holds.

GX3: IN: Ground out 1B - u. Runner holds with Def Option for A or B

BACK: Ground out 1B - u. OBR-A, B or C scores.

GX4: IN: Ground out 2B - 18. Runner holds.

BACK: Ground out 28 - 1B. OBR-A, B or C scores.

GX5: IN: Ground out 38 - 1B. Runner holds.

BACK: Ground out 38- 1B. OBR-A, B or C scores.

GX6: IN: Ground out SS - 1B. Runner holds.

BACK: Ground out SS - 1B. OBR-A, B or C scores.

G1A: IN: Ground out P - 113. OBR-A or B scores.

BACK: Ground out P - 11 Runner scores.

G2A: IN: Ground out C - 18. Runner holds.

BACK: Ground out C - 18. OBR A scores

G3A: IN: Single thru infield. Runner scores.

BACK: Ground out 1B - u. Runner scores.

G4A: IN: Single thru infield. Runner scores.

BACK: Ground out 2B - 1B. Runner scores.

G5A: IN: Single thru infield. Runner scores.

BACK: Ground out 38 - 113. Runner scores.

G6A: IN: Single thru infield. Runner scores.

BACK: Ground out SS - 1B. Runner scores.

G3-1A: Ground out 1B - P. Runner scores, except OBR-E.

F7: Fly out LF. See Tagging Up From Third on OF Fly F8: Fly out CF. See Tagging Up From Third on OF Fly F9: Fly out RF. See Tagging Up From Third on OF Fly

FD7: Fly out deep LF. See Tagging Up From Third on OF Fly FD8: Fly out deep CF. See Tagging Up From Third on OF Fly.

FD9: Fly out deep RF. See Tagging Up From Third on OF Fly

L1:

Line out P. Runner holds.

L3: Line out 1B. Runner holds. L4: Line out 2B. Runner holds. L5: Line out 3B. Runner holds. CD-4 at 38 doubles off L6: Line out SS. Runner holds.

Fl:

Pop out P. Runner hold. F2: Pop out C. Runner hold.

F3: Pop out 1B. Runner hold. F4: Pop out 28. Runner hold. F5: Pop out 38. Runner hold.

F6: Pop out SS. Runner hold.

ERROR SEQUENCE

Error 1: Ground ball off fielder's chest. Batter safe. Runner scores. Error 2: Wild throw. Batter to 2nd. Runner scores.

Error 3: outs. Batter safe.

Ball sticks in fielder's glove. Runner scores IF two

Ball booted away. Batter to third on single, scores

Error 4: on double or triple. Runner scores. Outfielder drops ball. Runner scores. Batter out

Error 5: . trying for additional base. OBR-A or B safe in

MAN ON FIRST AND SECOND OUT CHART

G1: Double play ground out, P-SS-1B. Runner on 2nd advances. G2: Double play ground out, C-3B-1B. Runner on 1st advances. G3: Double play ground out, 1B-SS-1B. Runner on 2nd advances. G4: Double play ground out, 28-1B. Runner on 2nd advances. G5: Double play ground out, 3B-2B-1B. Runner on 2nd advances. G6: Double play groundout, SS-1B. Runner on 2nd advances. GX1: Force out at 2nd, P-2B. Batter safe. Runner on 2nd advances. GX2: Force out at 3rd, C-3B. Batter safe. Runner on 1st advances. GX3: Force out at 2nd, 1B-SS. Batter safe. Runner on 2nd advances. GX4: Force out at 2nd, 2B-SS. Batter safe. Runner on 2nd advances. GX5: Force out at 3rd, 38-u. Batter safe. Runner on 1st advances. GX6: Force out at 2nd, SS-2B. Batter safe. Runner on 2nd advances. G1A: Ground out, P-1B. Runners advance.

G2A: Ground out, C - 1B. Runners advance.

G3A: Ground out, 18- u. Runners advance.

G4A: Ground out, 213 - 1B. Runners advance.

G5A: Ground out, 38- 1B. Runners advance.

G6A: Ground out, SS - 1B. Runners advance.

G3-1A: Ground out, 18- P. Runners advance. F7: Fly out LF. See Tagging Up From Second on OF Fly F8: Fly out CF. See Tagging Up From Second on OF Fly F9: Fly out RF. See Tagging Up From Second on OF Fly FD7: Fly out deep LF. See Tagging Up From Second on OF Fly FD8: Fly out deep CF. See Tagging Up From Second on OF Fly FD9: Fly out deep RF. See Tagging Up From Second on OF Fly L1:

Line out P. Runners hold. CD-4 at P doubles runner off 1st. L3: Line out 18. Runners hold. L4: Line out 28. Runners hold. LS:

Line out 38. Runners hold. L6:

Line out SS. Runners hold. CD-4 at SS doubles runner off 1st. Fl:

Pop out P. Runners hold. F2: Pop out C. Runners hold.

F3: Pop out 18. Runners hold. F4: Pop out 28. Runners hold. F5: Pop out 3B. Runners hold. F6: Pop out SS. Runners hold.

ERROR SEQUENCE

Error 1: Fielder can't control ball. Batter safe. Runners advance.

Error 2: Wild throw. Batter to 2nd, runners advance 2 bases.

Error 3: Muffed grounder. Batter safe. Runners advance.

Error 4: Outfielder over runs ball. Batter gets extra base. Runners score.

Error 5: No error. Ignore.

Updated January 5, 2016

Page 45: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

MAN ON FIRST AND THIRD OUT CHART

G1: INFIELD IN: Runner on 3rd out P - C. Runner to second. Batter safe

G4A: IN: Single thru the infield. Runners advance two bases. INFIELD BACK: Double play P - SS - 1B. Runner scores. BACK: Batter out 2B-1B. Runners advance one base.

G2: IN: Batter out C-1B. Runner on 1st to 2nd. Runner on 3rd holds. GSA: IN: Single thru the infield. Runners advance two bases. BACK: Batter out C-1B. Runner on 1st to 2nd. Runner on 3rd holds. BACK: Batter out 3B-1B. Runners advance one base.

G3: IN: Consult DEFENSE OPTION CHART

G6A: IN: Single thru the infield. Runners advance two bases. BACK: Double play 1B-SS-1B. OBR-A safe at 1st. Runner scores. BACK: Batter out 55-1B, Runners advance one base.

G4: IN: Batter out 2B-1B. Runner on 1st to 2nd. Runner on 3rd holds. G3-1A: Ground out 1B - P. Runners advance one base. BACK: Double play 2B-SS-1B. Runner on 3rd scores.

F7:

Fly out LF. See Tagging Up From Third on OF Fly G5: IN: Batter out 3B-1B. Runner on 1st to 2nd. Runner on 3rd holds. F8:

Fly out CF. See Tagging Up From Third on OF Fly

BACK: Double play 3B-2B-1B. Runner on 3rd scores. F9:

Fly out RF. See Tagging Up From Third on OF Fly

G6: IN: Batter out SS-1B. Runner on 1st to 2nd. Runner on 3rd holds. FD7: Fly out deep LF.See Tagging Up From Third on OF Fly BACK: Double play SS-2B-1B. Runner on 3rd scores. FD8: Fly out deep CF. See Tagging Up From Third on OF Fly

FD9: Fly out deep RF. See Tagging Up From Third on OF Fly GX1: IN: Batter out P-1B. Runner on 1st to 2nd. Runner on 3rd holds.

BACK: Batter safe. Runner at 1st forced at 2nd C-SS. Runner on 3rd scores. L1:

Line out P. Runners hold. L3: Line out 1B. Runners hold. CD-4 at 1B doubles off runner on 1st.

GX2: IN: Runner on 3rd in rundown C-3B-C. Runner on 1st to 3rd. Batter to 2nd. L4:

Line out 2B. Runners hold. BACK: Batter safe. Runner forced at second C-SS. Runner on 3rd scores. L5:

Line out 3B. Runners hold.

L6:

Line out SS. Runners hold. GX3: IN: Batter out 1B - u. Runner on 1st to 2nd. Runner on 3rd holds.

BACK: Batter safe. Batter forced at 2nd 1B-SS. Runner on 3rd scores. Fl:

Pop out P. Runner hold. F2: Foul pop up near stands. CD-3 or 4 makes great catch for out.

GX4: IN: Runner out at home 2B-C. Batter safe. Runner on 1st to 2nd. F3:

Foul pop out 1B. Runners hold. BACK: Batter safe. Runner on 1st forced at 2nd 2B-u. Runner on 3rd scores. F4:

Pop out 2B. Runners hold.

F5:

Pop out 3B. Runners hold. GX5: IN: Batter out 3B-1B. Runner on 1st to 2nd. Runner on 3rd holds. F6:

Pop out SS. Runners hold.

BACK: Batter safe. Runner at 1st forced at 2nd 3B-2B. Runner on 3rd scores. ERROR SEQUENCE

GX6: IN: Batter out SS-1B. Runner on 1st to 2nd. Runner on 3rd holds. Error 1: Misplayed. Batter safe. Runners advance one base. BACK: Batter safe. Runner at 1st forced SS-2B. Runner on 3rd scores. Error 2: Wild throw. Batter to 2nd. Runners score except

OBR-D or E runner on first stops at third. G1A: IN: Batter out P-1B. Runner on 1st to 2nd. Runner on 3rd scores. Error 3: Booted grounder. Batter safe. Runner on 1st to 2nd.

BACK: Batter out P-1B. Runner on 1st to 2nd. Runner on 3rd scores. Runner on 3rd scores IF two outs. Error 4: Outfielder kicks ball. Batter and base runners advance

G2A: IN: Batter out C-1B. Runner on 1st to 2nd. Runner on 3rd holds. one extra base. BACK: Batter out C-1B. Runner on 1st to 2nd. Runner on 3rd scores. Error 5: Outfielder relays wildly. Batter holds base hit to. Runners

advance one extra base. G3A: IN: Single thru the infield. Runners advance two bases.

BACK: Batter out 1B-u. Runners advance one base.

UNUSUAL PLAYS (Z CHART)

11: Catcher argues balls and strikes. Ejected from game. 12: Pitcher argues balls and strikes. Ejected from game. 13: Batter argues balls and strikes. Ejected from game. 14: Batter hits slow roller to 1st. Pitcher covers, but batter is

rules safe. Argument results and first baseman ejected. 15: Batter hits long fly ball, ruled foul. Batter argues and is ejected. 16: Pitcher is doctoring the ball. Ejected from this game. 17: On a full count, pitcher goes to mouth. Called ball four. 18: Batter called out for using illegal bat. Catcher gets putout 21: Skies open and Biblical rain begins. Game called. 22: Storm warnings issued and game halted for fan safety. 23: April Only: Game called because of cold. 24-25: April Only: Spring showers. Game called. 26: Rain delay. Draw new RN for minutes of delay.

If over 28, each pitcher PB is reduced by ONE. 27: Applies with at least a runner at 1st, if no runner at 1st, draw new PB.

If less than two outs, the batter hits a bloop single to RF but passes the runner. The batter is out first unassisted and all runners advance one base. If two outs, play as a bloop double to RF.

28: Batter swings at 2 strike pitch. Catcher misses ball and batter safe at first. Runners advance one base.

31: Batter doubles down RF line, but misses first base. OUT on appeal. Runners score if not third out. If 3rd out, inning over.

32: ONLY WHEN MAN ON FIRST: Runner steals second. SS argues call and is ejected.

33: ONLY WHEN MAN ON FIRST: Runner out stealing second. Argues call and is ejected.

34: ONLY WHEN MAN ON FIRST: Runner caught off first and out 1-3-4-3. Any runner on 3rd scores.

35: ONLY WHEN MAN ON FIRST: Runner picked off and out P-1B. Any runners on 2nd or 3rd advance one base.

36: ONLY WHEN THIRD OCCUPIED: Runner picked off base, C-3B-C. Other runners hold.

37: Catcher drops third strike. Batter safe at first, runners advance but man on 3rd holds unless forced ahead.

38: Batter singles to RF and runners advance two bases. Batter turns wrong way and is picked off base, RF - 1B.

41: Batter checks swing, but hits slow roller to first, but runs into ball. Called out. Putout to catcher. Runners hold except man on 1st.

42: ONLY WHEN FIRST AND SECOND: Ground ball hits runner on first. Batter gets single, runner called out. Runner on second holds.

43: Catcher interference. Batter to first, runners advance. Error on C. 44: Fan interference on foul into stands. Batter out. Runners

hold. Putout to SS. 45-78: CONSULT Z FIELDING CHART 81-88: CONSULT Z INJURY CHART

Updated January 5, 2016

Page 46: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

MAN ON SECOND AND THIRD OUT CHART Z FIELDING CHART

G1: INFIELD IN: Batter out P-1B. Runners hold. G4A: IN: Single thru the infield. Runners advance two bases. This chart is used when referred to from Z chart. Obtain a

G2:

INFIELD BACK: Batter out P-1B. Runners hold.

IN: Batter out C-1B. Runners hold.

BACK: Batter out 2B-16. Runners advance one base.

GSA: IN: Batter out 3B-1B. Runners hold.

new random number and apply below. NOTE: 11-34 are

used ONLY WHEN A RUNNER IS ON FIRST BASE. If 1st not

BACK: Batter out C-1B. Runners hold. BACK: Batter out 3B-1B. Runners advance one base. occupied, ignore and play on.

G3: IN: Consult DEFENSE OPTION CHART G6A: IN: Single thru the infield. Runners advance two bases.

BACK: Batter out 1B-u. OBR-A, B or C on 3rd scores. BACK: Batter out 55-1B. Runners advance one base. 11-14: Grounder to first. If 1B is CD-3 or 4, double play 1B-SS-1B.

If 1B is CD-1 or 2, batter out 1B - u. Runner advances G4: IN: Consult DEFENSE OPTION CHART G3-1A: Ground out 1B - P. Runners advance one base. 15-18: Grounder to second. If 2B is CD-3 or 4, double play 2B-SS-1B.

BACK: Batter out 2B-1B. OBR-A, B or C on 3rd scores. If 2B is CD-1 or 2, batter out 2B-1B. Runner advances. F7: Fly out LF. See Tagging Up From Third on OF Fly 21-24: Grounder to short. If SS is CD-3 or 4, double play SS-2B-1B.

G5: IN: Consult DEFENSE OPTION CHART F8: Fly out CF. See Tagging Up From Third on OF Fly If SS is CD-1 or 2, batter out 55-1B. Runner advances. BACK: Batter out 3B-1B. OBR-A on 3rd scores. F9: Fly out RF. See Tagging Up From Third on OF Fly 25-28: Grounder to third. If 3B is CD-3 or 4, double play 3B-2B-1B.

If 3B is CD-1 or 2, batter out 3B-1B. Runner advances. G6: IN: Consult DEFENSE OPTION CHART FD7: Fly out deep LF. See Tagging Up From Third on OF Fly 31-34: Grounder to pitcher. If P is CD-3 or 4, double play P-SS-1B.

BACK: Batter out 55-1B. OBR-A, B or C on 3rd scores. FD8: Fly out deep CF. See Tagging Up From Third on OF Fly If P is CD-1 or 2, batter out P-1B. Runner advances. FD9: Fly out deep RF. See Tagging Up From Third on OF Fly

GX1: IN: Batter out P-1B. Runners hold. BELOW APPLY IN ANY BASE SITUATION:

BACK: Batter out P-1B. Runners hold. L1: Line out P. Runners hold. 35-38: Difficult grounder to first. CD-3 or 4, batter out, runners adv. L3: Line out 1B. Runners hold. If CD-1 or 2, infield single. Runners advance one base.

GX2: IN: Batter out C-1B. Runners hold. L4: Line out 2B. Runners hold. 41-44: Difficult grounder to second. CD-3 or 4, batter out, runners BACK: Batter out C-1B. Runners hold. L5: Line out 3B. Runners hold. advance. If CD-1 or 2, infield single. Runners adv. one base.

L6: Line out SS. Runners hold. 45-48: Difficult grounder to short. CD-3 or 4, batter out, runners GX3: IN: Batter out 1B-u. Runners hold. advance. If CD-1 or 2, infield single. Runners adv. one base.

BACK: Batter out 1B-u. OBR-A, B or Con 3rd scores.; A or B on 2nd advances Fl: Foul pop out P. Runners hold. F2: Foul pop up C. Runners hold.

51-54: Difficult grounder to third. CD-3 or 4, batter out, runners

advance. If CD-1 or 2, infield single. Runners adv. one base. GX4: IN: Batter out 2B-1B. Runners hold. F3: Pop out 1B. Runners hold.

BACK: Batter out 2B-1B. OBR-A, B or Con 3rd scores; A or B on 2nd advances F4: Fly out 2B near RF line. OBR-A on 3rd scores.

F5: Pop out 3B. Runners hold.

55-63 Difficult fly to left. CD-3 or 4, batter out, runners

hold. CD-1 or 2, double to LF, all runners score GX5: IN: Batter out 3B-1B. Runners hold. F6: Pop out SS. Runners hold. 64-74: Difficult fly to center. CD-3 or 4, batter out, runners hold. If

BACK: Batter out 3B-1B. OBR A or B on 3rd scores CD-1 or 2, double off CF wall. All runners score. ERROR SEQUENCE 75-83: Difficult fly to right. CD-3 or 4, batter out, runner on 3rd

GX6: IN: Batter out 55-1B. Runners hold. Error 1: Booted ground ball. Batter safe. Runners advance one scores. If CD-1 or 2, double to RF, all runners score. BACK: Batter out 55-1B. Runner on 3rd scores. Runner on 2nd holds. base.

Error 2: Wild throw. Batter to 2nd and both runners score. 84-87: Difficult pop foul to catcher. CD-3 or 4 makes catch, runners

hold. CD-1 or 2 ball drops into seats. Batter still up. G1A: IN: Batter out P-1B. OBR-A on 3rd scores. Error 3: Booted grounder. Batter safe. Runners advance one 88: TRIPLE PLAY

BACK: Batter out P-1B. OBR-A on 3rd scores. base if two out Men on 1st & 2nd: Line drive to SS, to 2B and to 1B. Error 4: Ball goes to wall. Batter and runners score. Men on 1st & 3rd: Line drive to 3B, steps on bag and to 1B.

G2A: IN: Batter out C-1B. Runners hold. Error 5: Ignore. No error. Men on 2nd & 3rd: Line drive to 2B, steps on bag and to 1B. BACK: Batter out C-16. Runners hold. Loaded: Liner to P, who throws to 3B and to 1B.

IF LESS THAN TWO MEN ON WHEN TRIPLE PLAY:

G3A: IN: Batter out 1B-u. OBR-A on 3rd scores.

BACK: Batter out 1B-u. Runners advance one base.

Score as line out 1B, runners hold except runner on 1st

is doubled off.

Updated January 5, 2016

Page 47: GREAT AMERICAN FANTASY BASEBALL LEAGUE RULES · PDF file · 2016-01-052016-01-05 · great american fantasy baseball league rules: season three 1.administration ... • stolen base

BASES LOADED OUT CHART

G1: INFIELD IN: Runner on 3rd out at home, P-C. Batter safe. Other runners adv.

INFIELD BACK: Runner on 3rd out at home, P-C. Batter safe. Other runrs. adv.

G2: IN: Runner on 3rd out at home, C-u. Batter safe. Other runners advance. BACK: Double play C-1B. Other runners advance.

G3: IN: Runner on 3rd out at home, 1B-C. Batter safe. Runners

advance. OBR-E batter is doubled at 1st, 1B-C-1B. BACK: Runner on 3rd out at home, 1B-C. Batter safe. Other

runners advance.

G4: IN: Runner on 3rd out at home, 2B-C. Batter safe. Other runners advance. BACK: Double play 2B-SS-1B. Runners on 2nd & 3rd advance.

G5: IN: Runner on 3rd out at home, 3B-C. Batter safe. Other runners advance.

BACK: Double play 3B-2B-1B. Runners on 2nd & 3rd advance.

G6: IN: Runner on 3rd out at home, SS-C. Batter safe. Other runners advance.

BACK: Double play SS-2B-1B. Runners on 2nd & 3rd advance.

GX1: Double play P-C-1B. Other runners advance.

GX2: Double play C-1B. Other runners advance.

GX3: IN: Runner on 3rd out at home, 1B-C. Batter safe. Runners advance.

BACK: Batter out at first 1B-u. Other runners advance.

GX4: IN: Runner on 3rd out at home, 2B-C. Batter safe. Other runners advance.

BACK: Force out at 2nd, 2B-SS. Batter safe. Runners on 2nd & 3rd advance.

GX5: IN: Runner on 3rd out at home, 3B-C. Batter safe. Other runners advance.

BACK: Force out at 2nd, 3B-2B. Batter safe. Runners on 2nd & 3rd advance.

GX6: IN: Runner on 3rd out at home, SS-C. Batter safe. Other runners advance. BACK: Double play SS-3B-1B. Runners on 1st and 3rd advance.

G1A: Runner on 3rd out at home P-C. Batter safe and other runners

advance. If catcher is CD-3 or 4, batter out at 1st. Double play. P-

C-1B.

G2A: Batter out C-1B. Runners advance.

G3A: IN: Single thru infield. Runners advance one base.

BACK: Batter out at first 1B-u. Other runners advance.

G4A: IN: Single thru infield. Runners advance one base.

BACK: Batter out 2B-1B. Runners advance.

GSA: IN: Single down LF line, all runners score. Batter stops at 1st.

BACK: Batter out 3B-1B. Runners advance.

G6A: IN: Single thru the infield. Runners advance two bases. BACK: Batter out 55-1B. Runners advance.

G3-1A: Batter out at 1st 1B-P. Runners advance.

F7: Fly out to LF. See Tagging Up From Third on OF Fly F8: Fly out to CF. See Tagging Up From Third on OF Fly F9: Fly out to RF. See Tagging Up From Third on OF Fly

FD7: Fly out deep LF. See Tagging Up From Third on OF Fly FD8: Fly out deep CF. See Tagging Up From Third on OF Fly FD9: Fly out deep RF. See Tagging Up From Third on OF Fly

L1:

Line out P. Runners hold. CD-4 pitcher also doubles runner off 3rd. L3: Line out 1B. Runners hold. L4: Line out 2B. Runners hold.

L5: Line out 3B. Runners hold. L6: Line out SS. Runners hold.

Fl:

Pop out P. Runners hold.

F2: Pop out C. Runners hold.

F3: Pop out 1B. Runners hold.

F4: Pop out 2B. Runners hold. F5: Pop out 3B. Runners hold.

F6: Pop out SS. Runners hold.

ERROR SEQUENCE Error 1: Fielder bobbles ball. Batter safe and runners advance one

base. If two outs, OBR-A or B on 2nd also scores. Error 2: Wild throw. Batter to 2nd and runners advance two

bases. If two outs, OBR-A or B on 1st also scores. Error 3: Fielder cannot get ball out of glove. Batter safe. Runners

advance one base. Error 4: Ignore. No error.

Error 5: Hit gets thru fielder, to wall. Runners and batter score. If

OF is CD-3 or 4 he makes proper play and runners

advance 1 for single, 2 for double and 3 for triple.

Updated January 5, 2016