Top Banner
2 [email protected] • 07791042372 STEVE PICKLES FLEX UK & EURO EDITIONS
77
Welcome message from author
This document is posted to help you gain knowledge. Please leave a comment to let me know what you think about it! Share it to your friends and learn new things together.
Transcript
  1. 1. s t e v e p i c k l e s 1 8 8 @ g m a i l . c o m 0 7 7 9 1 0 4 2 3 7 2 S T E V E P I C K L E S F L E X U K & E U R O E D I T I O N S
  2. 2. CAN ANYONE PHILHEATH?STOP LEADINGFIGURESINEUROPEAN ANDINTERNATIONALBODYBUILDING GIVETHEIRVERDICTSONTHEQUESTION EVERYBODYISASKING AndthewinnerisPHILHEATH!Ithasbecomeafamiliarendtoshowsinrecentyears.Infact,youhavetogo backto2010forthelasttimewhenTheGiftwasntannouncedinfirstplace.SincethenHeathhastwicewonthe OlympiaandtwicewontheSheruClassic.HeevenclaimedhissecondSandowlastyeardespitenotbeingatthetop ofhisgame.HisdominanceissuchthatifitcontinuesforanotheryearwecouldbetalkingaboutaHeatherabytheendof 2013.WiththenewproseasonsettokickoffwiththeArnoldClassicnextmonth,weaskedsomeofthebiggestnamesin EuropeanandAustralianbodybuildingtosaywhethertheythoughtanybodycouldtoppleHeathintheyearahead. 54 FLEX 55FLEX KEVINHORTONKEVINHORTON
  3. 3. ANTHBAILES UKchampion2012andnewIFBBpro Kai wasveryclosethisyear.ShawnRhoden, withalittlemoreupperbodythicknessand betterconditioning,couldalsopushPhil. LastyearhighlightedthatPhilisntas untouchableasmostpeoplethought. THOMASBENAGLI ItalianIFBBpro Nobody!The2013MrOwillbethegreat PhilagainIcantseeanyonewhocould possiblydethronehimnextyear.Ofcourse, Kai Greeneisafreak,butPhilisaheadofhim andImsurehellshowfurther improvementsnextyear. ALBERTBUSEK IFBBvice-presidentforEuropeand editoroftheGermaneditionofFLEX WithtwovictoriesunderPhilsbelt,theMr Olympiabonusmakesitmoredifficultfor anychallengerthisyear.ButIstronglybelieve thereisalwaysroomforasurprise.Shawn Rhodendeliveredthatsurprisesensationally in2012.Itverymuchdependsonwhichoneof theseoutstandingathletescanreach100% andholdthatlevelfortwodays.IfKaicando thathellmakePhilmorenervousthanhedid in2012.IfPhilistowinhisthirdSandowitwill dependverymuchonhisstrategy.Inmyview his2012strategywasntthemosteffective. Ilikedthe2011PhilHeathbetter.Philshould focustotallyonmusclequalityanddetails notmoremass.Inmyviewhisbonestructure cannotcarrymoremasswithouthimlosing hisuniquesymmetry.PhilHeathin100% shapeandwith100%musclequalityis almostunbeatable. RENECAMPBELL IFBBWomensWorldChampion2012 IdontthinkanyonewillbeatPhilHeath in 2013.Intermsofmasshehasreached his maxsoonlyreallyneedstoworkonthe kind ofconditionhepresentedin2011.His overall packagesize,symmetry,posingand then conditionwillensurethatheisunbeatable BERRYDEMEY LegendaryDutchformerbodybuilder Yes!Onthislevelyouhavetobecriticalinorder tojudge.PhilHeathdoesnothavetheperfect bonestructure:hisshouldersarenotaswide astheyshouldbe.InthatrespectKaiGreene hasbettergenetics.IfKaicomesinwithmuscle conditionlikeRonnieColemansin2002hewill bethemantowatchoutfor.Consideringhis conditionin2012,Kaiisonhisway. PETERFOUCAUX FrenchIFBBprointhe212lbclass NoonecandefeatPhilHeath.Hisincredible genetics,proportionsandlevelof conditioningarefarabovewhatallthe other contestantscanbringonstage.KaiGreene maysometimeslookbetterinsomeposes, butnottothepointofbeingableto challengeaMrOlympialikePhilHeath. WAYNEGALLASCH OwnerofGMVProductionsandamember oftheOlympiacamerateamsince1999 No,IdonotseeanyonebeatingPhilHeathin thenextthreeyears,aslongashemaintains hisgreatconditionanddoesnotdotoomany exhibitionsallovertheworldduringthefinal sixmonthspriortotheOlympia.Hisnatural superbshapeandproportionswillholdhimat thenumberonespotforaslongashehasthe desireandthewilltogetingreatshapeeach September.Iseethreeguyspushinghimand theyareShawnRhoden,KaiGreeneand BranchWarren,innoparticularorder. Ofthesethree,Rhodenhasthemost pleasingproportionssoisthebiggestthreat. MARKUSHOPPE 2011InternationalGermanChampion Inmyview,threeathletescouldwinthe2013 MrOlympia:ShawnRhoden,KaiGreeneand PhilHeath.Butevenifthosethreeathletes showup100%inshape,PhilHeathwillstillgo homewithhisthirdSandow.Tome,Rhoden hasthepotentialtobethemostdangerous contenderintheforseeablefuture.Im convincedthathimteamingupwithRonnie Colemanwilldelivergreatresults.Kaiisoneof myfavourites.Imverymuchimpressedbyhis unbelievablemassanduniquepresentation. IwouldliketoseehimasMrOlympia.Hislines UKIFBBpro OnlyPhilcanstopPhilrightnow.It allcomesdowntohispreparation anddesiretowin.Idontthinkhe wasasimpressivelasttimeashe waswhenhewonhisfirstOlympia buthewasstillgoodenoughtowin soitshistolose.Kaicamereally closeandlookedimprovedandI dontthinkanyonewouldhave complainedhadhewon FrenchIFBBPRO IfPhilcomesbackwiththesame conditionhehadduringthe2012 Olympiafinals,noonewillbeable tochallengehim.In2013,hewill competewithabiggerandmore shreddedphysique,foronesimple reason:heisthekingandheknows thatlotsofchallengerswanttotake thetitletoo 56 FLEX 57FLEX TAUSEEFASRI KEVINHORTON
  4. 4. arenotasaestheticasShawnsorPhilsbutif botharenotabsolutelyintopshapeKaiwill takethetitle. ERICHJANNER GeneralSecretaryDBFVe.V./ IFBB-Germany KaiGreeneandShawnRhodenareHeaths mostdangerouscontenders.Shawnsthird placeattheMrOlympiaandhisGrandPrix victoriesthatfollowedwillgivehimstrong momentumthisautumn.Withafewmore kilogramsofmusclemass(especiallyinhis upperbody),hisnicelinesandhisoutstanding overallimpression,Shawncouldcauseanother bigsurprisein2013.Becauseofhisstructure, PhilHeathhasreachedhislimitformuscle mass.Anymoredevelopmentwillnotresultin abetteroverallshape.Philshouldfocuson qualityandplayhisstrongestcards symmetryandproportion.KaiGreene,Phils strongestcontenderin2012,hasstructural flawsbuthehasamuchwiderupperbodyand incomparablemusclemass.IfKaicanimprove hisshoulderandbicepsdefinitionandmuscle separationhellbehardtobeat. LUCMOLINES FrenchIFBBprointhe212lbclass PhilHeathshouldnthavewonin2012.Kai Greenewasinmuchbettershapeinprejudging whileHeathlackeddetailandconditioning. Moreover,heactedweirdduringthecontest andeventhejudgesputhiminhisplaceon severaloccasions.KaiGreenecouldbeatPhil Heath,andsocouldnewcomerslikeCedric McMillan,ShawnRhodenandLionelBeyek. Theseguysarethebigthreat.BranchWarren andJayCutleraresufferingfromtoomany injuries,whileDennisWolflookslikehellnever beabletofillinhislowerbackandbringthe necessarypackagetowinacontestlikethe Olympia. PIERONOCERINO LeadingItalianbodybuilder Olympiahistoryteachesusthatakingsreign onlyendswhentherarecombinationoftwo factorsarises,thefirstbeingthechampions lowerstandards,fromaqualitativeand quantitativepointofview,andthesecond beingtheemergenceofagreatrival,oldor new.ThatswhyIthinkonlyHeathcanbeat Heath.HedbetterwatchoutforRhoden, though! MIKEOMARA DirectorofIFBBWesternAustralia andeight-timeIFBBMrAustralia InlastyearsOlympiaIthoughtKaihadoverall betterconditioninganddefinition.Fromthe backKaislatswerewider,hislowerbackwas thickerandhisglutesmorestriated.Hewas outstandinginthefrontdoublebicepspose. Fromthesidehisarms,hamstrings,quadsand gluteslookedsharper.Philhadabetterupper chestandlookedbetterinthemostmuscular pose.Histrapsandshoulderslookedbigger UKIFBBpro Kaicameveryclosetodethroning Philthisyear.Withallthepros strivingformoresymmetrical packages,thisopensthefieldupto guyslikeShawnRhoden,Toney Freeman,myselfandEdNunn. Eachcompetitorwillneedtohave hisuniquesignature,likebackinthe goldeneraofbodybuilding.Soyes, asgoodasPhilis,hesnoColeman, YatesorHaney.Thoseguyswere yearsaheadofthefieldrealfreaks TopGermanIFBBpro Atthe2011MrOlympiaPhilHeath shockedeverybody.Fromthe momenthewalkedonstage,itwas beyondanydoubtthathewouldbe thenewMrOlympia.In2012he couldnotliveuptotheveryhigh expectations.Hewasgreatand super-hard,buthedidntlooklikethe undisputedwinner.InmyviewKai Greenehadanadvantageoverhim in2012,butthereisalwaysaMr Olympiabonus.Ofcourse,thereare bigdifferencesinbodystructure betweenPhilandKai,butifthejudges hadgiventhe2012titletoKai,itwould havebeenfinewithme.IfKaiisableto improvejustalittlebithewillbethe numbertitlecontenderin2013 andfuller.Forme,KaiGreenewinsthedouble bicepsfromthefrontandback,aswellasthe rearlatspread,sidechestandabdominalsand thighposes.PhilHeathstrapslookedbetterin themostmuscularpose. DANIELESECCARECCI IFBBproathlete Kai Greene could be a legitimate challenger for the Mr Olympia title in 2013,as he was in 2012,but to beat the reigning Mr O you need to show that you really are superior to the champion.Shawn Rhoden is a rising bodybuilding star,although hes not so young,and is a legitimate contender. I think he needs to improve his back overall if he wants to have a chance of winning a title as important as the Mr Olympia.In order to win the Mr O,an athlete has to appear unbeatable,the absolute best. FLEX 58 FLEX 59FLEX GARYPHILLIPS PAVELYTHJALL MATTMARSH
  5. 5. THE ONETOWATCH BY JOHN PLUMMER PHOTOGRAPHY BY LEE ARCHER 212starShaunJoseph- Taverniercamefrom nowheretofinishfifth attheOlympiain2011 thenvanished. Nowhesback 104 FLEX 105FLEX
  6. 6. Butnowhesback.Joseph-Tavernier,39, returnedtothestageforthefirsttimein threeyearsin2014,finishingsecondto SamiAlHaddadattheBodyPowerProin Birmingham,andhehasbigplansfor2015. Hiscomebackprovidedareminderofhow muchthesporthadmissedhishardcore, ultra-thicklymuscledlook,buthewasnt quite100percentandthereisstillasense thatthebestisyettocome. TheOne,asheisknown,istrainingto makethathappenin2015.Whenwespoke hewashopingtoreceiveaninvitationto competeattheArnoldClassicinOhiofrom March5thto8thandtousethatasa springboardbacktothetop. Myplansfor2015aretoplaceinthetop threeattheArnold,wintheBodyPower showandplaceinthetopthreeatthe Olympia,hesays.Imkeenondoingthe ArnoldbecauseIwanttomakeastatement. Ihaventbeenaroundforthepastcoupleof years,soIwanttoputmynamebackinthe mixwhereitrightlybelongs.Myfellow212 athleteshavesetthestandardandIwantto beamongstthem,bringinghomewinslike IknowIcan. Whywasheawaysolong?Eightweeks outfromtheOlympiain2011Itoremy adductorwhilstsquatting,hesays.Itwas ahorribleinjurytodealwithandtookalot ofrehabilitation.Ialsohadanongoing shoulderproblem,whichwasreallygetting medownasIcouldntperformtheexercises Ineededto.NowImback,healthyand readytogo.MyphysioBruceMcCallhas beeninstrumentalinmegettingbacktofull fitness;Icantthankhimenough. SecondatBodyPowerwasthebestresult achievedbyaBritishprolastyear,besides Lewis.Washesatisfiedwiththat?Yes,toa certainextent,hesays.Iwenttheretowin ofcourse.Secondplaceisnevernicebut Ialsohavetobalanceitoutandlookatwhat Imanagedtoaccomplishagainstsomegreat athletes.Mypackagewasdecent;Ijustcould havebeentighterincertainareas. SHAUN JOSEPH- TAVERNIER TRAINING SPLIT Monday Chestandcalves Tuesday Quadricepsand hamstrings Wednesday Shoulders Thursday Backandcalves Friday Arms Ifasurveywereconductedto findthebestBritishbodybuilder sinceFlexLewisturnedproeightyears ago,ShaunJoseph-Tavernierwould probablygetthemostvotes.Fromthe momenthefirstwalkedonstage, obliteratingeverybodyinalocalbeginners contest,itwasapparentJoseph-Tavernier hadthekindofstructurethatseparates thebestfromtherest.Hisdense,compact muscularity,solidlegsandoverallshape wereastonishingandsooneverybodyin thecountrywasravingabouthim. It didnt take long for him to make a similar impact abroad.He turned pro in 2011,after winning three British titles, and in only his second pro contest won the Toronto Supershow in Canada. That victorythe first in an IFBB pro show by an Englishman since Dorian Yates 14 years earlierqualified him for the Olympia,where he finished fifth,three places behind Welshman Lewis in the final year of the 202 lb division. Joseph-Tavernier was named FLEX Rookie of the Year and appeared to have the world at his feet.But he then disappeared off the radar,leaving the coast clear for the likes of Lewis,David Henry,Kevin English,Jose Raymond and Eduardo Correa to battle for 212 suprem- acy since then. 106 FLEX 107FLEX
  7. 7. ITRAIN UNTILIVE WORKED THEMUSCLE ISTOPPED COUNTING SETS&REPS YEARSAGO 108 FLEX
  8. 8. Itsdifficulttopinpointweaknesseson Joseph-Taverniersphysique.Heisoneof themostthicklymuscledmenontheplanet andalsohasgoodlinesandsymmetry. Whenhenailsit,nobodyissafe. HecertainlywasntoffatBodyPowerbut hecouldhavebeenslightlytighter.Itseasy toforget,however,thatalthoughhehas beenaroundforeightyearshehasnt competedthatoften. Hewascontestpreparationexpert NathanHarmansfirstmalebodybuilder client.Thetwohavebecomegoodfriends andJoseph-Taverniersayshehaslearnta lotfromthemanknownasTheWizard. Suchas? Ivelearntnottostarvemyself. Ivelearnttotakemytime,dietfor nolessthan20weekswithplenty ofcardio,whichiswhatIlove anyway,Ilovefeelingfitsocardioisno problem.Dietingformedoesnthaveto beasdraconianasitoncewas. Harmanisrenownedforrecommending highcalories,evenwhendieting.Itworks wellforme,saysJoseph-Tavernier.Once mymetabolismgetsgoingitsdifficultto keepupwith,soalotofthetimewehave toincreasemyfoodintake.ForBodyPower Iwaseating6,000caloriesadaythats justwhatmybodyneeded.Noteveryoneis thesamethough. Atypicaldayseeshimdevourabout onekiloofchicken,500gramsofsteak, 220gramsoffishandonekiloofpotatoes. Thatssomeappetite. Ieattowin,hesays.Ieatadecent amountoffoodbutitsvaried.Thereare quiteafewproteinandcarbsources.Idont dothelowcarbthing;IdocarbcyclebutIm notafanofstarvingyourselfofcarbs. Allthosecaloriesfuelsometough workouts.Itrainwithalotofvolumeand highintensity,hesays.Wevelistedhis 110 FLEX GARYPHILLIPS
  9. 9. currenttrainingsplitbutitwouldbe impossibletoprovideafullbreakdown ofhistrainingbecauseitsvariedand instinctive. Ilistentomybody,anditusuallytells mewhatitneeds,hesays.Itrainuntil Iveworkedthemuscle.Istoppedcounting setsandrepsyearsago.Ijusttraintofailure. IvetrainedforsomanyyearsthatifIdont knowmybodynow,theressomething wrong. Joseph-Tavernierhasdonecardioallyear roundforthelastcoupleofyears.Off- seasonIdo45minutesaday;pre-contest Idoasmuchastwohoursperday. Withthisworkethic,hesconfidenthecan getbacktothetopofthevibrant212scene. Howdoesheappraisehisrivals?Thebestis mostcertainlyFlexandmyhomeboyJose (Raymond).Therestarephenomenal athletes.Everyonebringsanaddedbitof spicetothetable.Imabigfanofallthe topfiveorsix212guys:IloveSamislines, Eduardoscrazyconditionandsoon. Joseph-Tavernier,whothanksPatrick Grant,DaveBeattie,RaiGarcia-Singhand BruceMcCallforhelpinghim,turns40on NewYearsDaysohedoesntenvisagemany moreyearsinthesport.Iseemyselfretired infiveyears,healthyandfulloflife,hesays. Fornowitsaboutwinningtrophies althoughhisaspirationsextendbeyond that.Myambitionistoinspirepeoplein thesportandtohelppeopleachievetheir dreams,hesays.Ihavequiteafewunder- studies,suchasRicardoCorreia.Iwanttosee guyslikehimreachthetop. FLEX SHAUN JOSEPH- TAVERNIER Age:39 Birthplace:London Lives:London Height:157cm(5ft2ins) Weight:100kg(220lbs) CareerHighlight:5that2011 MrOlympia202lbdivision Ambition:TobethebestIcanin everythingthatIdo Trainingadvice:Consistency Sponsors:DNALean,Muscle-Meat andHarlequin Contact: shaunjosephtavernier.co.uk 112 FLEX
  10. 10. 217FLEX WER NICHT KMPFT, HAT SCHON VERLOREN! Mit diesem Leitsatz holte sich MANUEL BAUER den Gesamtsieg bei der Internationalen Deutschen Meisterschaft (DBFVe.V./IFBB) FOTOS: OLIVER RINK, MANFRED ZANKER VON OLIVER RINK 216 FLEX FLEX PORTRT Manuel nach dem Sieg bei der Int. DM 2006, fotografiert von Oliver Rink.
  11. 11. 219FLEX zum Training ins Muscle & Fitness- center Grafenwhr. Die ersten zwei Jahre lief das Training an den Gewich- ten neben seinen anderen sportlichen Aktivitten, bis ihn eines Tages der Inhaber des Studios, James Allen, auf seine Entwicklung ansprach. Diesem schien Manuels genetisches Talent zum Muskelaufbau aufgefallen zu sein und auf dessen Ansprache hin intensivierte Manuel sein Training. Nach recht kur- zer Zeit war es dann um ihn geschehen der Virus Bodybuilding hatte von ihm Besitz ergriffen und nach und nach gab er seine anderen Sportarten auf, um fr das Bodybuilding mehr Zeit zu haben. Damals trainierte Jeff Box Long im Muscle & Fitnesscenter, da er dort bei der US-Army stationiert war. Er war der erste richtige Bodybuilder, mit dem Manuel in Berhrung kam und dieser kam ihm damals, seinen Worten nach, wie ein Monster vor. Jeff wurde in der Zeit gerade Profi und ging dann in die Staaten zurck. Das Ideal eines Krpers konkretisierte sich. Wie das bei allen Bodybuildern so ist, erweiterte er sein Wissen um Ernh- rung und Trainingslehre stetig. Alles, was er an Literatur und sonstigen Infor- mationsquellen bekommen konnte, wurde von ihm aufgenommen. Mit 20 Jahren kam Manuel nach Regensburg zur Bundeswehr. Vorher informiert, wusste er, dass dort die Bodystation von Xaver Islinger war und es war schon beschlossene Sache, dass er whrend seines Grundwehrdienstes dort trainie- ren wollte. Manuel hatte sich schon diverse Meisterschaften angesehen und hatte immer bewundert, wie viele Ath- leten aus diesem Gym auf den Meister- schaften vertreten waren. Leider verlie- fen die ersten zwei Monate seiner Graundausbildung nicht ganz so, wie er sich das erhofft hatte. Statt Training gab es jeden Tag Ausbildung, vom Wecken bis 21 Uhr, und Ausgang war sowieso gestrichen. Am Wochenende ging es zwar nach Hause, aber da war dann essen und schlafen angesagt. Nach sei- ner Grundausbildung wurde Manuel glcklicherweise im Dezernat fr mili- trisches Geowesen eingesetzt, wo ihm die allseits beliebten Spe wie Biwak und 24-Stundenbungen erspart blie- ben. Schon gleich am ersten Tag beschloss er, seiner neuen Trainings- sttte einen Besuch abzustatten. Zu die- ser Zeit noch ohne Auto blieb also nur der Bus. Im Klartext 35 Minuten ein- fach, inklusive mehrmaliges Umsteigen. Mit etwas Herzklopfen stand er dann vor der Tre. Sollte er in diesem Studio auf Athleten treffen, die er bisher nur aus Zeitschriften kannte, wie z.B. Lambert Bhm oder Ingo Fischer? Und so sollte es sich ergeben, dass gerade an diesem Tag die beiden Besag- ten am trainieren waren, als er dort auf- tauchte und das beeindruckte ihn schon sehr. Der Chef, Xaver Islinger, stand persnlich an der Theke und nach wenigen Stzen war die Aufregung ver- flogen und Manuel war erstaunt ber die offene und freundliche Art von Xaver, der ihm sofort anbot, dort zu trainieren. Es herrschte eine tolle Atmosphre und es zeigte sich, dass es kein Problem war, dass dort ein Rent- ner neben einem Deutscher Meister sein Training absolvierte. Nach ein paar NACH DEM AUFSTEHEN 6Kapseln BCAAs 10 g Glutapure (Glutamin) FRHSTCK 70 g Haferflocken (Haferflocken ersetze ich zum Ende hin durch Reiswaffeln oder Reis). 60 g Proteinpulver 1 TL Lachsl 2 g Vitamin c 50 mg Zink VOR DEM TRAINING 1Portion Intensity Nox 10 g Glutapure (Glutamin) NACH DEM TRAINING: 1Ampulle Aminobolan 10 g Glutapure (Glutamin) 6Kapseln BCAAs 40 g Ultra Carb 40 g Iso Tech CA. 1 STUNDE SPTER 75 g Vollkornreis 250 g Hhnerbrust oder Rindersteak, Broccoli, Spinat ZWISCHENMAHLZEIT 250 g Hhnerbrust oder Rindersteak, Broccoli, Spinat ZWISCHENMAHLZEIT 200 g Hhnerbrust oder Rindersteak 75 g Vollkornreis, Broccoli, Spinat ABENDESSEN 400 g Rindersteak 1 groe Schssel Salat mit 1 EL Olivenl und Essig, Broccoli, Spinat VOR DEM SCHLAFENGEHEN 60 g Eggprotein 1 EL Walnussl 1 TL Lachsl 10 g Glutapure (Glutamin) 2 g Vitamin C 50 mg Zink Tglich ca. 7-8 Liter Flssigkeit (Wasser und Pepsi light). Je nach Form werden zum Ende hin die Kohlenhydrate reduziert. Das geht dann soweit, dass ich nur noch 1 Packung Reiswaffeln im Anschluss an das Training esse. MANUEL BAUER ERNH- RUNGSPLAN DITPHASE Manuel bei der Int.DM 2006 mit Gaststar Ronny Rockel. 218 FLEX MANUEL BAUER ERNH- RUNGSPLAN IN DER OFFSEASON FRHSTCK 150 g Haferflocken 60 g Whey Protein (Haferflocken mit Wasser in eine Schssel und kurze Zeit in die Mikrowelle, danach mit Sstoff und Whey Protein zu einem Brei vermengen), hochdosiertes Multivitamin-Multimineral- stoffprparat 2 g Vitamin C 50 mg Zink 1 TL Lachsl VOR DEM TRAINING 10 g Glutapure (Glutamin) 1 Portion Intensity Nox NACH DEM TRAINING 60 g Ultra Carb 6Kapseln BCAAs 10 g Glutapure (Glutamin) 2Kapseln Kre-Alkalyn 1Ampulle Aminobolan 40 g Iso-Tech CA. 1 STUNDE SPTER 150 g Basmatireis oder Nudeln 200 g Hhnerbrust, Rinderhack oder 1 Dose Thunfisch mit Tomatensoe ZWISCHENMAHLZEIT 500 g Magerquark mit Ananas oder Natreen Ditapfelmus und Sstoff ZWISCHENMAHLZEIT 3 Vollkornbrtchen belegt mit 200 g Lachs- oder Putenschinken, 200 g Httenkse, Gurke, Tomate ABENDESSEN 150 g Basmatireis oder Nudeln 200 g Pute, Rind oder Thunfisch mit Tomatensoe VOR DEM SCHLAFENGEHEN 80 g Proteinpulver 2 EL l (Walnuss- und Rapsl) 1 TL Lachsl 10 g Glutapure 2 g Vitamin C 50 mg Zink Dies ist nur ein Beispiel, wie ein typischer Offseasontag aussehen kann. Kalorien zhle ich in der Aufbauphase nicht. Zwischendurch esse ich auch ab und an einmal Eiweiriegel als Ersatz fr Sigkeiten. In erster Linie achte ich darauf, dass die tgliche Proteinzufuhr gesichert ist. Kohlenhydrate und Fett sind mir in der Offseason nicht so wichtig. anuel Bauer wurde am 23.11.1976 in Weiden in der Oberpfalz im Sternzeichen des Scht- zen geboren, 3 Jahre nach seinem Bruder. In Grafenwhr besuchte Manuel die Grundschule und Hauptschule und wechselte danach fr vier Jahre auf eine Wirtschaftsschule. Nach der Schule absolvierte er eine Ausbildung als Offsetdrucker in Gra- fenwhr. Schon seit frhester Kindheit war Manuel sportlich aktiv und auf der Suche nach seiner Sportart. Auf die- sem Weg probierte er einige Sachen aus Handball, Judo, Tennis, Tischtennis und Leichtathletik. Mannschaftssport war zwar nicht schlecht, aber die Leis- tung des Einzelnen ging in der guten oder schlechten Leistung der Mann- schaftskameraden unter. Sportarten, in denen man auf sich selber gestellt war, gefielen ihm schon besser. Im Alter von 15 Jahren bekam er von seinem Bruder, der schon das Training an Gewichten fr sich entdeckt hatte, einen Gutschein zum Besuch eines Fitness-Studios. Zu dieser Zeit wog er 57 Kilo und hatte eine sportlich-schlanke Statur. Nach ein paar Wochen begleitete er seinen Bruder Manuel Bauer, fotografiert von Oliver Rink. M
  12. 12. Dieses Erlebnis ist ihm bis heute in Erinnerung geblieben - das erste Mal auf der Bhne, Gesamtsieg und zusammen mit Vince Taylor auf einer Bhne zu ste- hen! Aber das sollte es fr das Jahr 1997 noch nicht gewesen sein. Manuel zog seinen Siegeszug bis zur Deutschen Meisterschaft durch und errang bis dahin noch: Int. Sddeutsche Meister- schaft Junioren II 1. Platz, Int. Bayeri- sche Meisterschaft Junioren II 1. Platz + Gesamtsieg, Int. Deutsche Meisterschaft Junioren II 1. Platz. Nachdem sein Wehrdienst abgeleistet war, beschloss Manuel noch eine Berufsausbildung anzugehen und machte seinen Abschluss als Industrie- kaufmann. Eine geeignete Stelle fand er dann bei der Firma Holzmann in Grafenwhr. Nach seiner Rckkehr aus Regensburg trainierte er wieder im Muscle&Fit- nesscenter. Da seine Junio- renzeit vorbei war, musste er sich einen guten Einstig in die Mnnerklassen erarbeiten und machte 2002 bei der Int. Sddeutsche Meisterschaft in Ger- mering den ersten Versuch und belegte Anstellung umgesehen hatte, beschloss er, es zu versuchen und sich einen Traum zu erfllen: ein eigenes Studio und somit sein Hobby zum Beruf zu machen. Das Gebude des Muscle&Fitnesscenter, dem Beginn seiner eigenen Bodybuildinglaufbahn, stand damals schon 2 Jahre leer und wurde komplett umgebaut und im Dezember 2006 als Get Fit neu erff- net. Nach all den privaten Wirren und der Neugrndung der eigenen Existenz beschloss Manuel im Herbst 2005, wie- der aktiv ins Wettkampfgeschehen einzugreifen. Erster Wett- kampf war der Int. Donau Cup, wo er den ersten Platz in der M III belegte. Es folgte die Int. Bayrische, die er ebenfalls mit einem ersten Platz in der M III beenden konnte. Auf der Int. Deutschen in Wiesloch wurde er Dritter. Zu Beginn des Jahres 2006 verletzte sich Manuel im unteren Rcken, ein Bandscheibenvorfall wurde diagnostiziert. Dieser hatte Lhmungserscheinungen bis herunter in die Wade zur Folge. Zu Manuel Bauer bei der Int. DM 2006. Manuel in einer Fotostudie von Oliver Rink. in der Mnnerklasse III den zweiten Platz. Bei dieser Meisterschaft traf er ein weiteres Vorbild, er lernte Peter Trenz kennen. Dieser hatte ihn schon immer durch seine Masse beeindruckt und er bewunderte ihn immer in Zeitschriften. Ebenso traf er dort Dr. Martina Herget. Beides Personen, die ihm noch viele ntzliche Tipps in seiner zuknftigen Laufbahn geben sollten. Wie das Leben so spielt, verschlug es ihn durch eine Beziehung weg von der Heimat nach Niedersachsen, genauer gesagt nach Oldendorf. Dort trainierte er im Fitsport in Stade oder er fuhr zu Olaf Peters ins Universum nach Ham- burg. Er arbeitete zu dieser Zeit bei Airbus, aber so richtig glcklich sollte er dort nicht werden und nach ca. einem Jahr trat er wieder die Heimreise an. In dieser Zeit lernte er auch seine heutige Lebenspartnerin Patricia kennen, der er nach eigenen Worten sehr viel zu ver- danken hat aber dazu spter mehr. Das Muscle&Fitnesscenter war nach seiner Rckkehr geschlossen. Da er sich noch nicht weiter nach einer neuen FLEX 221 Tagen des Trainierens kam Xaver auf Manuel zu und fragte ihn, ob er nicht Lust htte, mal an einem Wettkampf teilzunehmen, er wrde im Herbst des Jahres 1997 einen solchen ausrichten. Auf Manuels Einwnde bezglich sei- ner Masse und Form entgegnete Xaver, dass bei entsprechender Vorbereitung ein Deutscher Meistertitel bei den Junioren drin sei, auch wenn da noch genug Fett drber wre. Diese Aussage lste bei Manuel zwar Verwunderung aus, aber der Gedanke an eine Deutsche Meisterschaft hatte ja doch was. Das Problem Bundeswehr und Dit wurde mit der Devise: Wenn man etwas will, dann geht das auch, die Dit wird dann halt recht ein- fach ausfallen gelst. So sah dann der Tages- ablauf in etwa aus: um 6 Uhr aufstehen, Reis mit Thunfisch plus gratis dumme Kommentare der Kameraden, Dienst bis 16:30 Uhr (dazwischen wieder einige Portionen Reis mit Thunfisch oder Magerquark ohne alles und wieder dumme Sprche). Dann ab zum Bus, whrend der Fahrt 35 Minuten relaxen und dann ins Trai- ning, oft bis das Gym zugesperrt wurde, mit dem Bus zurck und gegen 23 Uhr wieder dumme Sprche anhren, weil er zur Ein- nahme der letzten Mahlzeit (Ihr wisst sicher, was es gab! ) das Licht ein- schaltete und seine Kameraden weckte. Um dies in Zukunft zu umgehen, beschloss er, das Nachtmahl mit Taschenlampenschein einzunehmen. Im weiteren Verlauf bereitete Xavers Frau jeden Tag fr Manuel Pute zu, da er keine Mglichkeit hatte, dies auf der Stube zu tun und Dosenthunfisch auf die volle Zeit der Dit war wohl doch etwas zu einfach. Manuels Krper zeigte Vernderungen. Die anfng- lichen 100 Kilo schmolzen lang- sam dahin und unter ihnen zeigten sich Bauchmuskeln. Das erste Mal, dass bei Manuel Bauchmus- keln zu sehen waren das war ein toller Moment! Abends wurde im Aerobic- raum gepost und ab und an warf auch mal einer wie Lambert einen Blick hinein und selbst diese erfahrenen Wettkmpfer sprachen Manuel nun auf sein Poten- zial an, was natrlich noch zustzlich Motivation gab. Sein Trainer und er beschlossen, dass sein erster Wettkampf die Int. Ober- pfalz-Niederbayern Meisterschaft 1997 sein sollte. Bei besagter Meisterschaft konnte er mit einem Wettkampfgewicht von 79 Kilo den Sieg in der Junioren II und den Junioren-Gesamtsieg errei- chen. Die Mhe und Qual hatten sich also gelohnt und Xaver hatte Recht behalten. 220 FLEX Manuel als Baby. Manuel Bauer 1983. Manuel beim Foto-Shooting mit Oliver Rink im XXL Bodytown Frankfurt/M. Manuel beim Foto-Shooting mit Oliver Rink im XXL Bodytown Frankfurt/M. Manuel bei der Int. DM 2006.
  13. 13. 222 FLEX alles glatt gelaufen und trotzdem hatte es nicht zum Sieg gereicht. Es bedurfte zwei Tage der berlegung und einiger Telefonate und dann war klar, dass nun noch mal zum Angriff bergegangen werden sollte. Es sollte sich herausstellen, dass diese Entscheidung genau die rich- tige war. In Top Form trat Manuel zur Int. Deutschen Meisterschaft in Wiesloch an. Er konnte sich nicht nur gegen die sehr harte Konkurrenz in der M III durchset- zen, er gewann auch das Stechen um den Gesamtsieg! Dies war der bisherige Hhepunkt seiner Karriere! EINIGE FRAGEN AN MANUEL BAUER: DEINE VORBILDER IM BODYBUILDING? Als ich anfing zu trainieren, haben mich Athleten wie Jeff Long, der ja im glei- chen Gym wie ich trainiert hat, oder Gary Strydom inspiriert. In den letzten Jahren waren es Athleten wie Peter Trenz, dessen Masse ich immer bewundert habe, und Ronny Rockel, dessen ruhige und beschei- dene Art ich sehr schtze. Auerdem Markus Rhl, der fr mich der massigste Bodybuilder auf unserem Planeten ist. versucht, da ich mich mit dieser Trai- ningsart stetig verbessert habe. Oft trainiere ich auch einfach nach Instinkt. HAST DU EINEN TRAININGSPARTNER ODER TRAINIERST DU ALLEIN UND WARUM? Ich trainiere meistens alleine. Frher hatte ich mal eine Zeitlang verschiedene MONTAG Brust, Bauch DIENSTAG Rcken MITTWOCH Beinbeuger,Adduktoren, Abduktoren,Waden DONNERSTAG Schultern, Bauch FREITAG Bizeps, Trizeps SAMSTAG Oberschenkel SONNTAG Pause Cardiotraining ca.4-mal die Woche. 40Minuten mit relativniedriger Intensitt oder 20Minuten hochintensives Intervalltraining im Anschluss ans Krafttraining.Je nach Form wird das Cardiotraining zum Ende der Dit gesteigert.Meist zustzlich drei-bis viermal die Woche 30Minuten am Abend.Sonst ndere ich am Trainingsstil und den bungen nichts,ich versuche die ganze Dit ber weiter mit schweren Grundbungen zu trainieren.Zum Ende hin trainiere ich nicht mehr ganz so schwer aufgrund der Verletzungsgefahr und der reduzierten Kohlenhydrate.Hier achte ich aufkorrekte Ausfhrung. MANUEL BAUER TRAININGS- PLAN DIT- PHASE Bodybuilding ist fr mich eine absolute Lebenseinstellung. GIBT ES EINEN LEITSATZ FR DICH? Gott hat jedem Menschen ein Talent geschenkt. Ich bin mir sicher, bei mir war es das Bodybuilding und ich bin froh, es fr mich entdeckt zu haben. WAS IST DAS BESONDERE AM SPORT BODYBUILDING DEINER MEINUNG NACH? Jeder Athlet kann alles fr sich selbst bestimmen und ist fr seine Leistung selbst verantwortlich. Die Faszination, auf ein Ziel hinzuarbeiten und zu sehen, wie man seinen Krper formen und verndern kann. NACH WELCHEN TRAININGSPRINZIPIEN TRAINIERST DU, ES GIBT JA MITTLER- WEILE SEHR VIELE NEUE METHODEN? Ich trainiere, seit ich begonnen habe, Volumentraining und dabei mglichst schwer. Ich habe noch nichts anderes Manuel Gesamtsieger bei der Int. DM 2006 mit DBFV-Vizeprsident Thomas Augste. diesem Zeitpunkt kam ihm zum ersten Mal der Gedanke, vielleicht nie wieder richtig trainieren zu knnen. Diese Phase dauerte ca. 8 Wochen und direkt im Anschluss daran verletzte er sich auch noch am Trizeps, so dass wieder 6 Wochen Zwangspause folgten. Inner- halb einer Woche wurde er von Mathias Ritsch dreimal unter Vollnarkose ope- riert und das Ergebnis war sehr gut. Alles zusammen hatte er nun 3 Monate nicht trainieren knnen und dabei gut 10 Kilo verloren. Das Jahr war eigentlich abgehakt. Aber schon nach wenigen Wochen hatte er seine alte Form wieder erlangt und ein paar Wochen spter war er mit 106 Kilo so schwer wie noch nie. Diese Tatsache veranlasste ihn, es im Herbst doch noch einmal zu versuchen. Die weitere Vorbereitung verlief dann zumindest ohne weitere Verletzungen. Probelauf sollte der Int. Donau Cup werden, bei dem Manuel in der Mnner IV startete, und den ersten Platz belegen konnte. Angepeilte Klasse war natrlich die Mnner III bis 90 Kilo, in der er dann auch auf der Int. Bayerischen Meister Meisterschaft antrat. Trotz guter Form und Hrte musste er sich dort aber Richard Leitner geschlagen geben und belegte nur Platz zwei. Nach diesem Dmpfer machten sich Zweifel breit, ob die Teilname an der Deutschen berhaupt noch Sinn machen wrde, war doch seiner Meinung nach
  14. 14. 224 FLEX 227 Trainingspartner. Das bringt sicherlich einige Vorteile aber auch Nachteile. Durch meine Selbstndigkeit kann ich nicht zu festen Zeiten trainieren bzw. trainiere ich meistens dann, wenn das Studio offiziell geschlossen ist. Auer- dem trainiere ich viel nach Instinkt und kann so mein Training gestalten wie ich gerade will und bin von niemandem abhngig. Obwohl ich hufig ganz allein im Studio bin, versuche ich trotzdem, so schwer wie mglich zu trainieren und kann mich auch selbst dazu motivieren. HAST DU KONTAKT ZU ANDEREN WETTKAMPFATHLETEN? Ja, zum Beispiel Markus Becht, der mein bester Freund ist und seiner Part- nerin Monika Jhlen; Werner Glzer und Pit Trenz, der mich auch mit vorbe- reitet und von dem ich viele gute Tipps bekommen habe; Helmut Schardt, Petra Welker, Achim Weitz, Daniel Hill, Tobias Rssle und Felix Decker, um einige zu nennen. HAST DU VON DEINER FAMILIE UND DEINEN DIR NAHESTEHENDEN PERSONEN UNTERSTTZUNG BEI DEINEN VORBEREITUNGEN? Meine Eltern haben mich diesbezglich immer untersttzt und mir auch bei meinem groen Traum von eigenem Studio sehr viel geholfen. Auch jetzt, wenn ich auf Wettkmpfen oder bei anderen Bodybuildingevents unterwegs bin, helfen sie oft im Studio aus. Meine Partnerin Patricia steht voll hinter mir MONTAG Brust/Bizeps 4 Stze Kurzhanteldrcken WH 12-6 4 Stze Schrgbankdrcken an bilateraler Maschine WH 12-6 4 Stze Schrgbankdrcken an Multipresse WH 12-6 4 Stze KH fliegende WH 12-6 4 Stze KH Hammercurls WH 12-6 4 Stze Scottcurls an Maschine WH 12-6 4 Stze Langhantelcurls am Kabelzug WH 12-6 DIENSTAG Beinbeuger/ 4 Stze Beinbeuger liegend WH 15-8 Waden/Bauch 4 Stze gestrecktes Kreuzheben WH 12-8 8 Stze stehendes Wadenheben WH 20-6 4 Stze Beinheben hngend WH bis zum Versagen 4 Stze Crunches WH bis zum Versagen MITTWOCH Rcken/Trizeps 4 Stze Klimmzge WH bis zum Versagen 4 Stze Kreuzheben WH 10-6 4 Stze Langhantelrudern vorgebeugt oder KH Rudern WH 10-6 4 Stze Rudern sitzend am Kabelzug WH 12-8 4 Stze einarmiges Trizepsdrcken mit UG am Kabelzug WH 15-8 4 Stze Trizepsdrcken liegend mit SZ-Stange WH 10-6 4 Stze Dips WH bis zum Versagen DONNERSTAG Schultern/Nacken 4 Stze Frontdrcken an Multipresse WH 12-6 4 Stze KH Seitheben WH 12-6 4 Stze Butterfly revers (hintere Schultern) WH 15-8 3 Stze Seithebemaschine WH bis zum Versagen 4 Stze Nackenheben mit KH oder Langhantel WH 12-6 FREITAG Oberschenkel 6 Stze Langhantelkniebeugen WH 15-6 4 Stze Beinpressen WH 15-10 4StzeAusfallschrittemitLanghantelaufParkplatzWHbiszumVersagen 4 Stze Beinstrecker WH 15-10 SAMSTAG UND SONNTAG Pause Dreimal die Woche Cardio, hochintensives Intervalltraining (bevorzugt Laufband oder Crosstrainer) MANUEL BAUER WOCHENTRAININGSPLAN OFFSEASON Manuel Sieger bei der Int. DM 2006, Mnnerklasse III.
  15. 15. 226 FLEX Beruflich hoffe ich, dass ich den Erfolg meines Studios festigen und noch etwas weiter ausbauen kann. WIE SEHEN DIE SPORTLICHEN ZIELE AUS? Ich strebe es an, einmal international zu starten. Fr die Zukunft wre es ein Traum, mich international etablieren zu knnen und irgendwann einmal eine Medaille auf einer WM zu gewinnen. Ein ganz groer Traum ist es, einmal mit den Profis auf einer Bhne zu stehen. WO LIEGEN DEINER MEINUNG NACH DEINE STRKEN UND WIE ARBEITEST DU AN DEINEN SCHWCHEN? Mein Strken sind meine dicke, kom- pakte Muskulatur, insbesondere Schul- tern, Arme, Waden und Oberschenkel. Meine Schwchen sind mein Rcken, Bauch, und meine Prsentation. Ich werde meinen Rcken in Zukunft nur noch mit schweren Grundbungen bearbeiten, sprich: Kreuzheben, vorgebeugtes LH Rudern, KH Rudern und Klimmzge. Meinen Bauch werde ich in Zukunft hufiger trainieren. Das habe ich in der Vergangenheit vernachlssigt. Fr die Prsentation muss ich mir in Zukunft einfach mehr Zeit vor einem Wettkampf nehmen. WAS SIND DEINE LIEBLINGSBUNGEN UND DEINE BESTLEISTUNGEN? KH-Schrgbankdrcken 65 kg/10 Wiederholungen, Frontdrcken Multi- presse 135 kg/10 Wiederholungen, Knie- beugen 215 kg/8 Wiederholungen FLEX Schardt sowie Jrgen Stickelbrock bedanken. Mein Dank gilt auch allen, die ich hier nicht genannt habe, die aber immer an mich geglaubt und mich so untersttzt haben. WELCHE EIGENSCHAFTEN BRAUCHT MAN ALS BB DEINER MEINUNG NACH UNBEDINGT? Genetik ist das A und O und zwar sowohl krperlich als auch psychisch. Ausdauer, Leidensfhigkeit, eine gewisse Portion Egoismus, einen eiser- nen Willen und die Fhigkeit, sich immer wieder aufs Neue zu motivieren. Gewisse Dinge mssen einem einfach gegeben sein, die kann man nicht ler- nen. Ich bin berzeugt, dass es sehr viele Athleten gibt, die zwar die krper- lichen Voraussetzungen mitbringen, aber nicht die psychische Strke besit- zen, um eine Wettkampfdit durchzu- stehen hier trennt sich die Spreu vom Weizen. WIE LANGE DAUERT BEI DIR BLICHER- WEISE EINE VORBEREITUNG? In der Regel dauert eine Dit bei mir ca. 4 Monate. WIE SIEHT DEINE ZUKUNFT AUS? Privat mchte ich mit meiner Partnerin Patricia glcklich bleiben und natrlich wnsche ich mir, gesund zu bleiben. Manuel im Muscle&Fitnesscenter mit Besitzer Jeff Long (rechts). und dem Sport. Sie ist selbst Bodybuil- ding verrckt. Ich bin der Meinung, dass es anders ber lngere Zeit nicht funktionieren wrde. Ich mchte dabei die Gelegenheit wahrnehmen und ver- schiedenen Leute Danke sagen, auch wenn ich sicher nicht alle nennen kann: Ganz vorn, wie gesagt, meine Freundin Patricia, die es in der Dit sicher nicht immer einfach mit mir hat, da ich in die- ser Phase doch sehr auf den Wettkampf fixiert bin. Sie hat groen Anteil an mei- nem Erfolg, da sie einfach immer fr mich da ist. Ebenso meinem Freund Markus Becht und seiner Freundin Monika Jhlen, die mich immer wieder motiviert haben, wenn ich mich mal auf- gegeben hatte und auch fr Patricia immer ein offenes Ohr hatten, wenn sie es mal wieder schwer mit mir hatte. Pit Trenz, Wolfgang Kockroff, Martina Herget fr ihre Hilfe und fachliche Untersttzung in der Vorbereitung, natrlich meinem Sponsor Bodystuff (http://www.bodystuff.de), der mich mit allem, was ich brauche, untersttzt. Auerdem begleiten sie mich zu mei- nen Wettkmpfen und ich knnte mir keinen besseren Sponsor vorstellen. Des Weiteren mchte ich mich bei Oliver Rink, Daniel Hill, Dora und Helmut
  16. 16. BY JOHN PLUMMER PHOTOGRAPHY BY MATT MARSH OverallChampion RicardoCorreia 26 FLEX 27FLEX
  17. 17. The2013 UKBFF British Championships wasthebiggestphysique contesteverheldinBritain, with456menandwomen onstageovertwodays.Itsonlya fewyearssincethenumberof competitorsbrokethe200markso holdingashowofthissizeinanew venuewasalwayslikelytobe challengingandsoitproved.The speedofjudgingandlackof spacebackstagewere amongtheconcernsbut overallthiswasafitting endtoarecord-break- ingyear. The physiques were sensational:thereweresomewonder- ful champions,most notably Ricardo Correia, Ryan Terry,Nina Ross and Ria Ward; emerging superstars,such as Sasan Heirati,Anita Bekus and Andrew Scott; an amazing comeback by Irina Cotton; and,as always,plenty of controversy,particularly Tony Mount not making the top six in the light-heavyweights. By the time Harrogate International Centre had emptied,what had we learned? THELIGHT-HEAVYWEIGHTSWEREUNREAL Theunder-90kgclasswasthebestintheshow.Infact,itwasoneofthebestofalltime.Thetop fourRicardoCorreia,DeanLesiak,TonyBaileyandChrisJoneswereallformerBritish championsandtheywereallonfire.FifthplaceShaunBlackwoodwasintheshapeofhislifeand sixthplaceEdwinNarnorhasoneofthebestfront-onphysiques.TonyMountsfailuretocrack thetopsixcausedalotofcontroversy.Mount,whowasinthefirstcallout,wassecondtononefor muscularitybuthismidsectionandpresentation,andthequalityoftheopposition,costhim. RICARDOISTHEREALDEAL Everyone had known for a couple of years that Ricardo Correia was one of the most genetically gifted bodybuilders in Britain. But did he have the extra qualities that make a champion? He was devastated in 2012 when he won the light-heavyweights but lost the overall to Anth Bailes.He was on the floor again one week before this years national championships when he only finished sixth at the Arnold Classic Europe.But he sucked it up, learned from his mistakes by tightening his midsection and looked his best when it mattered most.Most people agreed and in a sport like bodybuilding you never get everyone agreeingthat he deserved his victory.Now an IFBB pro,the Portuguese- born Peterborough-basedRude Boyneeds a year to grow and harden for the 212 class. Britainslightheavyweightswillbegladtosee thebackofCorreia,whoisnowanIFBBpro Narnur Jones Lesiak Correia Bailey Blackwood 28 FLEX 29FLEX
  18. 18. THEWOMENAREBACK Little more than a decade ago,female numbers at the finals had shrunk to about 20.This year there were more than 120.The tall bikini class alone had 42 entrants. Bodyfitness and bikini have revived the womens side and its not inconceivable that female numbers will exceed male ones in a few years.Bodyfitness-turned-bikini competitor Nina Ross became the first woman ever to win two different categories and there was a fantastic top 6 in the womens bodybuilding.Silvana Imbrogno, the winner,was perhaps the best-condi- tioned athlete in the entire show.She was also one of the brightestshes a high-flying city banker. BikiniChampion NinaRoss BikinTallbodyfitness(fromleft)2ndCaroline Kane,1stEszterPati,3rdMarinScotland Silvana Imbrogno- shredded BikinTallbodyfitness(fromleft)2ndCaroline Kane,1stEszterPati,3rdMarinScotland 30 FLEX
  19. 19. RYANTERRYASUPERSTAR Mens physique is just a year old in the UK but it has shaken bodybuilding to its core by bringing an army of super-quiffed,super- conditioned twenty-somethings into the sport.Every new movement needs a figurehead and this class has it in the shredded shape of Ryan Terry.In the space of three weeks he appeared on the cover of our sister title,Muscle & Fitness,won the overall mens physique title at the Arnold Classic Europe,won the British short class title (there was no overall) and got his IFBB pro card. Bobby Khan made a big splash in the classic class when that kicked off but even he couldnt match what Terry has achieved by the age of 25. WantaphysiquelikeRyanTerry's? Getthisvideoandlearnhowtodoit. http://myvideopt.com/plan/cover-model-conditioning32 FLEX
  20. 20. RIAHASTHELOOK Just as mens physique couldnt have a better poster boy than Ryan Terry,neither could womens physique have a better inaugural champion than Ria Ward.Stunning, approachable and covered in shapely muscle, she is the ideal standard bearer for this popular new class.Yet her success was built on shaky foundations: she entered the bodyfitness class on her UKBFF debut in April and didnt place because she was too muscular so she re-emerged in the womens physique division and the rest is history. Expect this class to flourish in 204. 34 FLEX
  21. 21. THEJUNIORSARENTSKIPPINGLEGDAY More than a decade has passed since Flex Lewis made his name as junior British champ but he remains the standard against which his successors are judged.Some individuals,such as Nathan De Asha,Lewis Breed and James Hollingshead,have come close but usually theyve stuck out like sore thumbs in their line-ups.This year the overall quality of the top six was spectacular,with their leg development particularly impressive for guys no older than 23. SASANSTHEMAN Newcomer Sasan Heirati lived up to the hype by winning the heavyweights despite being nowhere near his best.He could have been tighter and needs more muscle maturity but the fact that he beat the best heavyweights in the land,in his first national finals,without being anywhere near his potential says everything.The early favourite for 2014or will Dave Titterton finally do it? Or Dean Lesiak? Stay tuned here and to flexonline. co.uk IRINAISAMAZING When Irina Cotton won her third British fitness title in her fifties it seemed a fitting end to a remarkable career.But the ex-gymnast doesnt know how to stop.She was back in Harrogate, a month before her 54th birthday,and seven months after a serious ankle injury,with shredded quads and a still sensational routine to beat women up to 30 years her junior.Later she partied until the early hours.What chance this inexhaustible woman still being the champ at 60? ROLLOFHONOUR MENOVERALLCHAMPIONANDNEWIFBBPRO Ricardo Correia SUPER-HEAVYWEIGHT Dave Titterton HEAVYWEIGHT Sasan Heirati MIDDLEWEIGHT Cliff Benton LIGHTWEIGHT Gordon Singh CLASSICOVER175CM Zack McGuirk CLASSICUNDER175CM Richard Dickinson INTERMEDIATESOVER90KG Michael Urban INTERMEDIATESUPTO90KG Lee Chambers INTERMEDIATESUPTO80KG David Henderson BEGINNERS Wayland Agliotti OVER40S Zak Pallikaros OVER50S Alfie Noda JUNIORS Andrew Scott PHYSIQUEOVER178CM Ashley Grant PHYSIQUE UPTO178CM Ryan Terry ATHLETICFITNESS Jason Harding WOMENBODYBUILDING Silvana Imbrogno PHYSIQUE Ria Ward BODYFITNESSOVER163CM Eszter Pati BODYFITNESSUPTO163CM Karolina Botkova BIKINIOVER163CM Nina Ross BIKINIUPTO163CM Anita Bekus FITNESS Irina Cotton ATHLETICFITNESS Amy Porter Juniors(lefttoright)2ndMattTownsend, 1stAndrewScott,3rdDaveYoung Heavyweights(fromleft)2ndDanJumaa, 1stSasanHeirati,3rdDotusDiya Fitness(fromleft)2ndCeeOliver,1stIrinaCotton,3rdLeighPurcell 36 FLEX 37FLEX
  22. 22. NATHANDESERVES SOMELOVE Hes bodybuildings Marmite character,a flamboyant Londoner who loves to laugh and wind people up.But Nathan Harman showed there is more to him than that by preparing. the mens overall champion Ricardo Correia and female bodybuilding champion Silvana Imbrogno.How many other gurus have done that in the same year? 10HARROGATEWASAHIT OK,FLEX is biased because were based in the North Yorkshire town.But it was great to see the biggest event of the year back on a proper stage after last years multi-sport experiment in Manchester,and Harrogate International Centre is a superb venue,worthy of such an occasion.It may have been cramped backstage but Nottingham isnt very big either and competitor numbers have doubled since it was last held there.Harrogate has good media facilities too that enabled flexonline.co.uk to provide live coverage,with galleries of some classes being online while competitors were still on stage. Returning to Nottingham would be a backward step. Visit flexonline.co.uk to see hundreds of photos of all the classes HarmanstrengthensCorreiasfacemuscles 38 FLEX
  23. 23. 2nd Mohamed Makkawy (Egypt) InLondonthepreviousyearMakkawynearly stoletheshowwithhismagnificentshape, conditioningandcharisma.Somechampions justhavetheXfactor,andMakkawywasone ofthem.In1983hewasconsideredoneofthe favouritesandwhenhegracefully commencedposingtoChariotsofFireitwas evidentwewerelookingatthepossible winner.Allhismagnificentqualitieswere there:colour,separation,balanceand proportion.Hadhebeenjustatriflesharper thetitlemighthavebeenhis.Butintheend hewasnomatchfortheunequalled developmentofSamirBannout. 1st Samir Bannout (Lebanon) Inthedaysbeforethecompetition,Bannout braggedthathewas25%betterthanthe previousyearandthetitlewouldbehis.Most ofuswereusedtothiskindofself-promotion anddiscountedit,asheneverseemedtoback uphisclaims. HowwrongwewereastheLionofLebanon finallygotittogetherandstoodonstagein thebestconditionofhislife. Ironically,hisquesttobecomeMrOlympia almostdidnthappenashecamedownwith seriousstomachpainsjustbeforetheevening show.Fortunately,withhelpfromFranco ColumbuandDrLudekNosek,thejudgethat Bannouthadearliercalledout,hegotsorted outandlandedonstageevensharperthanhe wasatthemorningprejudging. Bannoutwasadeservingwinner.He combinedthesizeofFoxandHaneywiththe shapeandsymmetryofZaneandMakkawy. Whenyouaddjusttherightamountof conditioningtothemix,youhaveadeserving MrOlympia.Evenifeverythingwasequalfrom thefront,Bannoutblewthefieldawayfrom theback. A NEAR RIOT Sadlythe1983Mr.Olympiaisnotremembered forBannoutsoutstandingvictorybutthe controversialdecisiontoplaceFoxfifth.In30 yearsofcoveringtheMrOlympiaIhavenever witnessedsuchgenuineandhostileangeras thatwhichfollowedFoxsfifthplace announcement. Itgotsoloudandunrulythatitbecame intimidating.Thecrowdrefusedtoacceptit anddemandeditbechanged.Itwasclearthe judgeswerescaredtothepointofconsidering achangeastheloudbooing,whistlingand aggressiveshoutingbecamesointenseaariot becamepossible.Itwasafullsixminutes beforethecrowdeventuallysettleddownand allowedtherestoftheplacing announcementstobemade. ShouldFoxbeendeclaredMr.Olympia? Theanswerisno.Itwasnotacontesttopick themostmuscularmanandinspiteofhis superiormassandcrowdpopularityhefailedto matchthetotalpackagethatBannout presented.In1983posingplayedamuchmore importantpartinthescoringthanitdoestoday. Foxwasawkwardanduneasy.Thosethat finishedabovehimweremastersofphysique display.Buthisawesomephysicaldevelopment couldhaveseenhimfinishashighas2ndor3rd. The 1983 Mr.Olympia set a new standard and marked the end of the era of smaller, shapelier athletes as nobody weighing less than 200 lbs has ever won the title again.It was Bannouts only Olympia triumph and set in motion the dominant reign of the larger, more heavily muscled titans,beginning with eight-time winner Lee Haney and then Dorian Yates,Ronnie Coleman and Jay Cutler.FLEX The booing, whistling and aggressive shouting became so intense a riot became possible ArnoldcheersforBertilFox, muchtotheamusementof Franco(rightofArnold), RickWayne(leftofArnold) andRobertKennedy (sittingbehindArnold) Samirsavours themoment SamirBannoutposesforthe cameras,includingthatof FlexsChrisLund,left. 96 FLEX TRAININGFLEX DIMINISHING SETS Learnhow lesscanequal morewhen itcomesto packingon slabsof muscle BYSHAWNPERINE PHOTOSBY CHRISLUND DennisJameswilloftenpushhis setspastthe10-reprange,acore requirementofanyonewillingto trytheDiminishedSetsProgramme 136 FLEX 137FLEX
  24. 24. out17.Thatsfine.Justmakesuretokeepa runningtallyofthetotalnumberofrepsyou performonyourpathto70. Itslikelythatinweekoneyoullneed approximatelysevensetstocompletethose 70reps,eveniftheexactbreakdownofreps divergesslightlyfromourtemplate.Asthe weeksprogress,youllincreasetheintensity ofyourworkoutsbyshoehorningthosesame 70repsintofewersets.Thismeansincreasing thenumberofrepspersetwhilekeepingthe restperiodbetweensetsattwominutes. Remember,youraimistocomplete70reps total,notsurpassthatnumber.Evenifyou havetheenergytoknockoutafewmorereps forthelastsetoftheroutine,sticktothegoal. Remember,yourprioritiesarecompletely differentnow.Yourmindsetshouldbe,too. BURNBABY,BURN Youknowhow,whenyoufirststartedtraining, yourmusclesburnedafteralmostevery workout,buthow,afterafewmonthsofsteady bombing,thatbittersweetfeelingbeganto IFSOMEONEWALKEDUPTOYOURIGHTNOWandasked howmanysetsyouusuallyperformfor,say,yourback,youcould probablygivehimananswerfasterthanyoucansayWeiderPeak ContractionPrinciple.Whatif,though,someoneaskedyouhowmany repsyouknockoutinatypicalbackroutine?Ummm...yeah,we thoughtso. Factis,sincedayone,wevebeentaughttodivvyupourworkouts intosetsfirstandforemost,andthensubdividethosesetsintorepeti- tions.Why?Itsasimplematterofthewayourbrainsfunction.We like tocreatehierarchiesbyorderofsimplicity.Asanexample,youwouldnt listyourheightasbeing,11,5.Youre511,andproudofit (although6straightwouldbenice). Soitiswhenwethinkabouttraining.Untilnowthatis.Wereabout toturnthenaturalhierarchyofexerciseonitshead,andgiveyouthe kindofresultsthatmightmakeyouwonderwhyyoudidntconsider keepingtrackofyourrepsalongtimeago. DIMINISHING SETSROUTINE NOTE:Rest two minutes between sets. * You should reach failure on the last rep. Stop at repetition number 70. SETS REPS WEEK1 1 20* 2 16* 3 12* 4 9* 5 6* 6 5* 7 2 WEEK2 1 22* 2 17* 3 13* 4 10* 5 6* 6 2 WEEK3 1 23* 2 18* 3 14* 4 10* 5 5 WEEK4 1 24* 2 19* 3 15* 4 10* 5 2 WEEK5 1 24* 2 20* 3 16* 4 10 THELAWOF DIMINISHINGRETURNS Theresanewparadigminexercisephilosophy beingspearheadedbyFLEXSeniorScience EditorJimStoppanithatnotonlybreaksthe rulesoftheconventionalset-rephierarchy, butcanprovideyouwithunprecedentedgains inmusclemassandtrainingendurance. Incontrastwithourcurrenthierarchical trainingsystem,diminishingsetsputs repetitionsatthetopofthefoodchain. Theobjectistoperformaspecifiednumber ofrepsofanexerciseduringaworkout,while progressivelydecreasingthenumberofsets requiredtoreachthatrepgoal,whichhappens tobe70,overthecourseoffiveweeks. Anothermarkeddifferencebetween standardtrainingprotocolanddiminishingsets isthatwenolongergiveprecedenceto increasingweightovertime.Withdiminishing sets,weusethesameweightforanexercise notonlywithinasingle70-repsession,butalso throughouteachfive-weektrainingcycle. Thiscanbeatime-saveraswell:whenyourein acrowdedgymvyingforweights,youneednt worryaboutwhetherthenextheavier dumbbellsarewaitingforyou. Youincreasetheweightineachsubsequent five-weektrainingcycle,whichalternateswith yourmoreconventionalsystemoftrainingfor sixtoeightweeks.Thisperiodisationschemeof switchingtrainingprotocolsensuresthatyour musclesdontadapttoaspecifictypeofstress. 70ISAMAGICNUMBER Threeconstantswillspaneachfive-weekcycle oftheDiminishingSetsProgramme:agoalof 70repsperexerciseperworkout,arestperiodof twominutesbetweensetsand,asmentioned, theweightyouuseforeachexercise.Therewill be,however,twovariablesintheroutineasyou progress:thetotalnumberofsetsinyour workoutsandthenumberofrepsineachset. Theideaistofitthose70repsintoprogressively fewersets,eachbeingahighernumberofreps. Keepinmindthattheset-repschemewere outlininginthisprogrammeistobetakenmore asaguidelinethananabsolute,sincethegoalis toreachpositivefailureineachset.Positive failureisachievedwhenyoucannotperform anotherrepwithoutassistance.Itmaytakea fewtrialsetstodeterminetheweightthat bringsyoutofailureonthe20threp,thetarget forthefirstsetofweekone,butitsimportant thatyoutraintofailureforthisprogrammeto work.Stoppingat20repsforthesakeofhitting thenumber20wontcutit,souseaweight thatsheavyenoughtoproducemuscularfailure bythatlastrep. Afteryourfirstset,restfortwominutestolet yourheartratedropbackintoagoodworking rangebeforebeginningyoursecondset.Thisis whereyoumayfindthattherepnumberswe suggestdontnecessarilymatchyourpersonal strengthlevels.Again,whatsimportantisnot thatyoumeetournumbers,butthatyoufully workyourmusclesduringeverysingleset. So,youmayfindthatinsteadof16,youcan performonly14repsforthesecondsetyoudo duringweekoneormaybeyoucansqueeze Althoughdiminishingsetscan makeforgruellingworkouts,its safetosaytheywontbequiteas brutalasoneofSilvioSamuels Asacompoundmovement, legpressesareagreatexer- ciseonwhichtoapply diminishingsets.Here, MustafaMohammadshows howtheyredone. 138 FLEX 139FLEX
  25. 25. dissipate?Well,getready,causeyoureaboutto feeltheburnonceagain. Ifyouvebeentrainingforanyappreciable lengthoftime,yourmuscleshaveprobably grownaccustomedtothespecificworkvolume youvebeenplacinguponthem.Inotherwords, yourbodyhasdevelopedaningrained physiologicalresponsetohandle,say,threesets ofeightto12repswith185-225poundsforthe benchpress.Changeoneofthevariablesinthat equationandyourmusclesaregoingtonotice. Changeallofthemandyourwholebodyisgoing jumptoattention.Allofasuddenitsbeing facedwithnew,unusualstressesandhasto releaseabrewofhormonesandbodychemicals tohandlethedamageitsdonetothe microfibresofyourmuscles.Thistranslatesinto strengthandmusclegains,whichisprettymuch thereasonyoureinthegyminthefirstplace. Asifthepromiseofanewgrowthspurt werentenoughtoconvinceyoutogive diminishingsetsatry,howaboutthefactthat anancillaryeffectoftheroutineisimproved hearthealth?Yourheart,whenfacedwith performing70repsoverthecourseofan exercise,ratherthanthetypical40,willadapt bybecomingmoreefficient.Amoreefficient heartmeansbetterstamina,betterhealthand longerlife,whichisnttheworstthingyoucould askfromyourtrainingroutine. GOFORIT Werecommendworkingdiminishingsetsinto yourownroutinebyapplyingittotwoexercises perbodypartonlytoavoidtheriskofovertrain- ing,whichcaneasilyhappenwithsuchan advancedtechnique.Forexample,atriceps routinemightconsistofdiminishingsetsof pushdownsandoverheadextensions(French curls).Forchest,youmightdoinclinebench pressesanddips.Forthighs:squatsandleg presses.Youcandeviseyourowncombinations, butitsimportanttolimitthistrainingmethod toonlytwoexercisesperbodypartperworkout. Onceyouvecompletedafive-weekcycle, periodiseyourtrainingbyreturningtoyourold systemforsixtoeightweeks.Thengobackto thediminishingsetsmethod,thistimeusing slightlyheavierweightsthanyouusedduring thelastcycle.Youshouldfindthatyourstrength andyourphysiquehavemadedramatic improvementsintheinterim,andthatyoure morephysicallyfitthanyouhadbeenbefore givingthisinventivesystematry. FLEX GOFORTHAND DIMINISHThechartshowsasamplefive-weekcycleof adiminishingsetsroutine.Useitforuptotwo exercisesperbodypartperworkout.Finda weightforeachexercisethatallowsyouto complete20repsonthefirstsetinweekone. Dontfixateontherepswelistinallother setsofthissampleprogramme.Thisisjust anexampleofhowyourbodymayadaptto theprogramme.Everyonewillprogress differently,andyouronlyfocusshouldbeon completing70repstotalinfewersetsthanit tookyoutocomplete70repsinweekone. Remember,theweightyouusestaysstatic fromthefirstsettothelast.Thisisntabout increasingresistance,rather,itsabout decreasingtimespentperforminga workload.Tovisualise,imagineyourea contractoranditnormallytakesyou100days tobuildahouse.Yourealise,however,thatif youcangetahousebuiltinonly80days,you canmoveontothenexthouseandperhaps makeextraprofitbytheendoftheyear.By gettingthesameworkdoneinashortertime, you,likethecontractor,willreaptherewards. Ratherthanmoney,however,therewardswill comeintheformofdense,powerfulmuscles, whichissomethingmoneycantbuy. Stoppingat20repsforthesakeofhittingthe number20wontcutit,souseaweightthatsheavy enoughtoproducemuscularfailurebythelastrep. 140 FLEX
  26. 26. PROFILEFLEX MAKINGA NAMEFOR HIMSELFShaunJoseph-Tavernieristheonly Englishmanthiscenturytowinan IFBBproshow.Hereherevealshow hediditinjusthissecondprocontest. PHOTOSBY MATT MARSH BY JOHN PLUMMER 170 FLEX 171FLEX
  27. 27. In May 2007 a newcomer named Shaun Joseph-Tavernierwalkedonstageinthefirst timers class at the London and South-East Championships.Hedidnthaveanyambitions inthesport.Infact,hedidntthinkhewould evercompeteagain:hewasonlytheretowin a bet against a guy at his gym who wagered that he would not do a contest. Shaun, a former rugby union player, was working for the council at the time and thought his life would return to normal as soon as he got off stage at the Beck Theatre in Hayes and scrubbed off his fake tan. He walked out with the other first timers, did his compulsory poses, comparisons and routine and was thrilled to be awarded first place. It had, he thought, been a good day and now he could claim his bet and get on with his life. But it soon began to dawn on himthatlifewouldneverbethesameagain. Themomenthesteppedoffstageeveryone was telling him how good he was. Within 24 hourstheBritishbodybuildingforumswere alive with talk about this outstanding first timerwiththeincrediblemuscularity,condi- tion and most of all shape. Shortly afterwards FLEX ran an article on Shaun titled A Star is Born and gradually it began to dawn on him that maybe he had afutureintheirongame.Hedecidedtotake itseriouslyandhasbeendoingsoeversince. It turned out to be wise move. Four years later, in June this year, Shaun, 35, flew to Canada to compete against a dozen other professional bodybuilders in the 202 pound class at the IFBB Toronto Supershow. Insomewaysitwasabitlikehisfirstshow alloveragain:nobodyinthecrowdknewhim whenhewalkedoutbutwhenheblewthefield apart to take first place and become the first EnglishmansinceDorianYatestowinanIFBB proshow,everyonewantedasliceofhistime. Microphones were thrustinhisface,peo- ple approached him with various business propositions and leg- ends like Shawn Ray came up to him asking how he managed to packsomuchmuscleon his frame. He was no longer the talk of Brit- ish bodybuilding he was the talk of world bodybuilding. Canada was absolutely amazing, says Shaun. I was blown away by it all. The resultqualifiedhimforthisyearsMr.Olym- pia and earned him his first decent pay chequeyethestillregardshisvictoryinhis firstshowinfrontofafewhundreddiehard fans in London as his greatest moment in thesportsofarbecauseofthewayitchanged his life. What happened that day was so unex- pecteditsurprisedevenme,hesays.Idid it as a bet and didnt expect anything to come from it. I was working for a local authority at the time and probably would have done that for the rest of my life. I had a solid pension and council jobs were thought to be jobs for life at the time. That show gave me a new direction, something toaimforandapurpose.Thatswhyitmeant so much to me. Since that fateful day his career has pro- gressed with dizzy haste and bodybuilding hasbecomehislife.Afterthebrouhahathat followedhisfirstshowsomepeopleadvised him to forget the first timers and try to win a weight class at the UK Championships in Nottingham in his debut year but he stuck tohisgunsandtookthefirsttimerstrophy at a canter. The following year he did step up to the light-heavyweights and, in his third ever show, beat the hard-charging Barny du Plessis for the national title but missed out on the overall title and pro card to middleweight James Llewellin. FivemonthslaterheflewtoColumbus,Ohio, to represent the UK at the amateur Arnold Classic.Heledafterprejudgingbuteventually finishedsecond.HereturnedtoNottingham for show number five where he retained his light-heavyweighttitletobecomeatwo-time UKchampion.Buthewasonceagainbeaten intheoverall,thistimebyZackKhan. It seemed that he would have to wait at least a year for another shot at his pro card butthentheUKBFFrelaxeditsrulesbysaying that national weight class winners who fin- ished in the top five at the following years amateur Arnold Classic would be eligible to apply for their pro cards. ThatwasallthemotivationShaunneeded eventhoughitmeantdietingforanothersix months after already doing so for almost a yearandahalf.HewasntathisbestinColum- bus but he still finished third to turn pro in just his sixth contest. Hetookawell-deservedyearofftoprepare forhisprofessionaldebutattherevivedBrit- ishGrandPrixinMarch.Butthebreakdidnt do much good: Shaun recorded his lowest ever placing fifth at the ExCel arena and wasbeatenbythreeofhisfellowBritsJames Flex Lewis, John Hodgson and James Llewellin. Most people would have been happy with fifthintheir first pro showbut Shaunwould like to forget the day. My package at the GrandPrixwasdismal,hesays.Hiscondition was excellent but he was utterly flat and lackedfullnessandsize.Ilookedawfuland I felt awful, he says brutally. Shaunweighedjust178poundsandsome people wondered whether at 5 2 tall he would be able to pack enough muscle on his body without ruining his lines to be able to compete with the top guys. He,however,drewstrengthfromhisdisap- pointment.Itaddedfueltothefire,hesays. IknewIhadtodoalotbetterandwasdeter- minedIwould.Theproblemwashehadonly threemonthstoprepareforhisnextshowin Toronto surely not enough time to make significant gains? But then he started working with Nathan Harman, a former international cyclist who SHAUNJOSEPH-TAVERNIERS CONTESTRECORD 2007:London and South-East Championships, First Timers,1st 2007: UK Championships,First Timers,1st 2008:UK Championships light-heavyweights,1st 2009: Amateur Arnold Classic light-heavy- weights,2nd 2009: UK Championships light-heavyweights,1st 2010: Amateur Arnold Classic light-heavyweights, 3rd 2011: British Grand Prix 202 pounds,5th 2011: Toronto Supershow 202 pounds,1st 172 FLEX 173FLEX
  28. 28. nowrunsProBodeez.com.Nathanhasnever competedinbodybuildingbuthedoesknow alotaboutnutrition.HehadhelpedShauns partner,internationalbodyfitnesscompeti- tor Jayne Tingle, prepare for the amateur ArnoldClassic.NowShaunaskedifhecould do the same for him. Shaun is generally sceptical about gurus. Heshunsallthevarioustrainingsystemsfor a more instinctive type of training based on whathethinkshisbodyneeds.Hestilltakes careofhisowngymworkbutNathanoversees his diet. Nathan is going to be the next big thing,hesays.Youdontneedtobeabody- builder to prepare a bodybuilder you need to know about nutrition and he does. Nathan told Shaun he could put on lots more size without getting blocky. He bumped up my food big time, says Shaun. I was eating big and my protein went through the roof. He ate almost 4,500caloriesaday,including450 g to 500 g of carbohydrates and 300gto350gofproteinspread across eight or nine meals in the run-up to Toronto. It didnt feel like dieting, he says. Nathan, he says, differs from other gurus because he tailors his knowledge to individuals needs ratherthanexpectclients to work to a predesigned programme.Somepeople think their system works for everybody but Nathan develops a system that works for you and he is always there for you, says Shaun. When Shaun weighed in at Toronto he was 198 pounds 20 pounds heavier than he had been attheBritishGrandPrix.Hewasjust assharpbutmuchfuller.Hewasready torumblebutthepressurewasonthis was the big time. He had twice competed abroadattheamateurArnoldinAmericabut hesoonlearnedtheproscenewassomething else. Bodybuilding legends were every- where in the crowd, on the judging table and in the media. All that only made victory taste better. Its sweeter going over there and beating them on their own turf, says Shaun. You knowifyougotoAmericaorCanadayoucant just be good; you have to be outstanding to get noticed. When he flew home he had just twelve weeks to prepare for the Olympia so he was back on his diet within days. His ambition is to finish in the top eight in Las Vegas this yearandwinthelightweightOlympiainthree years. At least two other Brits Flex Lewis and James Llewellinwillbeamong thosestandinginhisway this month in Sin City. Flexisinaleagueabove me right now, says Shaun, who movedfromLondontoBoltonthisyeartobe withJayneandnowrunssportssupplement shopBioFlexNutritioninthetown.Iwont say Ill never beat him but he is in a position right now where he can totally dedicate his lifetohistrainingandnutrition.Hesworked hard for that and deserves it. I still have a day job. Im a big fan of James Llewellin but I know I can beat him. Shaun seems relaxed about the 202poundclassbecominga212 pound class in November even thoughitcouldputpressureon him to add yet more size to a frame that already carries a ridiculous amount of muscle. Shawn Ray told him afterwards he had enough mass and Shaun agrees. I need to play to my strengths rather than just keep trying to add size, 174 FLEX
  29. 29. he says. His strength is undoubtedlyhisstruc- ture. Shaun,adyed-in- the-wool Lon- doner,isenjoying life up north. Everyone has been friendly and accommodating, he says. I didnt believetheweatherwould be so different though. Thats the only downside.Hetrainswithanex-competitor called Karl Davidson and still mixes things up in the gym. I have always maintained I dontbelieveindifferenttrainingsystems, he says. You have to know your body and train accordingly. I train with a decent amount of weight and do as many reps as I can. It doesnt matter if its six to eight, 12 to 15 or 25 to 30. Itdoesntmatterifitsheavyweightsand low reps or light weights and high reps. You have to know when to switch and change it. Goodlucktoguyswhocomeupwithtraining systemsthataresupposedtobethenextbig the signs are it will continue to go in that direction for some time to come. FLEX Shaun will perform a guest posing routine at the FLEX-supported UKBFF Yorkshire and North-East Championships at Leeds Town Hall on October 2nd. For ticket details visit ukbffnortheastchamps.co.uk or call 01423 877057. thing and manage to get gullible people to buy them but theyre not for me. WhetherShaunwillstayinBoltonthough is debatable. With his bodybuilding career takingoffhewouldliketofollowFlexLewis exampleandmovetoAmerica.Iddefinitely like to live there, he says. His victory in Toronto could open doors but unlike Flex, who is an assiduous networker, Shaun is a quietguywholikestokeephimselftohimself. Thatsjustmypersonalityandsometimes it can be my downfall because people can mistake it for arrogance, he says. I dont market myself very well and I wont sell my soul.MuscletalkownerJamesCollierishelp- ing to promote Shaun. Bodybuilders are not always the most marketable athletes but Shaunsstockhasshotupinrecentyearsand 176 FLEX 177FLEX
  30. 30. dissipate?Well,getready,causeyoureaboutto feeltheburnonceagain. Ifyouvebeentrainingforanyappreciable lengthoftime,yourmuscleshaveprobably grownaccustomedtothespecificworkvolume youvebeenplacinguponthem.Inotherwords, yourbodyhasdevelopedaningrained physiologicalresponsetohandle,say,threesets ofeightto12repswith185-225poundsforthe benchpress.Changeoneofthevariablesinthat equationandyourmusclesaregoingtonotice. Changeallofthemandyourwholebodyisgoing jumptoattention.Allofasuddenitsbeing facedwithnew,unusualstressesandhasto releaseabrewofhormonesandbodychemicals tohandlethedamageitsdonetothe microfibresofyourmuscles.Thistranslatesinto strengthandmusclegains,whichisprettymuch thereasonyoureinthegyminthefirstplace. Asifthepromiseofanewgrowthspurt werentenoughtoconvinceyoutogive diminishingsetsatry,howaboutthefactthat anancillaryeffectoftheroutineisimproved hearthealth?Yourheart,whenfacedwith performing70repsoverthecourseofan exercise,ratherthanthetypical40,willadapt bybecomingmoreefficient.Amoreefficient heartmeansbetterstamina,betterhealthand longerlife,whichisnttheworstthingyoucould askfromyourtrainingroutine. GOFORIT Werecommendworkingdiminishingsetsinto yourownroutinebyapplyingittotwoexercises perbodypartonlytoavoidtheriskofovertrain- ing,whichcaneasilyhappenwithsuchan advancedtechnique.Forexample,atriceps routinemightconsistofdiminishingsetsof pushdownsandoverheadextensions(French curls).Forchest,youmightdoinclinebench pressesanddips.Forthighs:squatsandleg presses.Youcandeviseyourowncombinations, butitsimportanttolimitthistrainingmethod toonlytwoexercisesperbodypartperworkout. Onceyouvecompletedafive-weekcycle, periodiseyourtrainingbyreturningtoyourold systemforsixtoeightweeks.Thengobackto thediminishingsetsmethod,thistimeusing slightlyheavierweightsthanyouusedduring thelastcycle.Youshouldfindthatyourstrength andyourphysiquehavemadedramatic improvementsintheinterim,andthatyoure morephysicallyfitthanyouhadbeenbefore givingthisinventivesystematry. FLEX GOFORTHAND DIMINISHThechartshowsasamplefive-weekcycleof adiminishingsetsroutine.Useitforuptotwo exercisesperbodypartperworkout.Finda weightforeachexercisethatallowsyouto complete20repsonthefirstsetinweekone. Dontfixateontherepswelistinallother setsofthissampleprogramme.Thisisjust anexampleofhowyourbodymayadaptto theprogramme.Everyonewillprogress differently,andyouronlyfocusshouldbeon completing70repstotalinfewersetsthanit tookyoutocomplete70repsinweekone. Remember,theweightyouusestaysstatic fromthefirstsettothelast.Thisisntabout increasingresistance,rather,itsabout decreasingtimespentperforminga workload.Tovisualise,imagineyourea contractoranditnormallytakesyou100days tobuildahouse.Yourealise,however,thatif youcangetahousebuiltinonly80days,you canmoveontothenexthouseandperhaps makeextraprofitbytheendoftheyear.By gettingthesameworkdoneinashortertime, you,likethecontractor,willreaptherewards. Ratherthanmoney,however,therewardswill comeintheformofdense,powerfulmuscles, whichissomethingmoneycantbuy. Stoppingat20repsforthesakeofhittingthe number20wontcutit,souseaweightthatsheavy enoughtoproducemuscularfailurebythelastrep. 140 FLEX ARNOLD IS BACK!35yearsafterwinninghisfinalMrOlympiainAustralia, ArnoldSchwarzeneggerreturnswithhisArnoldClassic BY JOHN PLUMMER PHOTOGRAPHY BY GARY PHILLIPS ShawnRoden(secondfromright)winsthe lastAustralianPro,whichisbeingreplaced bytheArnoldClassicAustralianinMarch 92 FLEX 93FLEX
  31. 31. AUSTRALIAPRO RECENTWINNERS 2006: RonnyRockelGermany 2007: DexterJacksonUSA 2008: DexterJacksonUSA 2009: KaiGreeneUSA 2010: KaiGreeneUSA 2011: DennisWolfGermany 2012: BranchWarrenUSA 2013: DexterJacksonUSA 2014: ShawnRhodenUSA 2015: EventrenamedArnold ClassicAustralia Australiaisbracingitselfforits biggesteverbodybuildingextrava- ganza.TheArnoldClassicAustraliawilltake placeatMelbourneConventionCentreon March13th,14thand15th. Theevent,promotedbygymownerTony Doherty,willbeonadifferentleveltoany muscleeventpreviouslystagedinAustrala- sia.Onlythe1980MrOlympia,heldinSydney andwonbyArnoldSchwarzenegger,can compareintermsofprestige,butforvisitor numbersandsheerbreadthofactivities,this onewillbemilesahead. ThehistoryoftheArnoldClassicandthe manwhosenameitcarriesarethereasons why.Everybodywhofollowsthesporthas heardoftheArnoldClassic.Itstartedinthe UnitedStatesin1989andhasseenspin-off versionsestablishedinEuropeandBrazil. NowitisAustraliasturn. Andjustabouteverypersoninthecountry, whetherornottheyhaveliftedaweight, knowswhoArnoldis.Sohavingthe Terminatorstarjetintostagean AustralianArnoldisavery,verybigdeal. LiketheoriginalArnoldinColumbus,Ohio, thethree-dayspectacularwillfeatureawide rangeofsportsandactivities,including strongman,weightlifting,CrossFitandmixed martialarts.Therewillalsobeahugeexpo featuringthebiggestnamesinsports nutrition.Butthecentrepieceoftheweekend willbethebattletobecrownedtheinaugural ArnoldClassicAustraliachampion. TheeventreplacestheFitXExpoandthe AustralianPro,whichDohertypromoted. Underhisguidance,theAussieProregularly attractedbig-nameUSbodybuilderstothe southernhemisphere.LastyearAmerican ShawnRhodenbeatHollandsWilliamBonac forfirstplace.Nowthatthecontesthasbeen upgradedtotheArnoldClassicAustralia,the line-upisonlylikelytogetstronger. Thewinnerofthecontest,whichtakes placeaweekaftertheArnoldClassicAmerica, willbookhisspotatthe2015MrOlympiaand therearegenerousqualifyingpointsavailable fortheathletesfinishingsecondtofifth. Theprobodybuildingline-upalsofeatures theArnoldClassicFigureandtheArnold ClassicBikiniandwithOlympiaplacesin thoseeventsalsoupforgrabs,expecttosee manyoftheAmericansuperstarscoming overtotakeonthebestwomenfrom AustraliaandNewZealand. Thethreeproshowsaretheicingonacake thatalsoincludestheamateurArnoldClassic, whichwillfeaturemanyofthebestphysiques inthesouthernhemispherebattlingforIFBB procards.Melbournesuper-heavyweight ScottGobleislikelytobeamongstthe forerunnersintheamateurmen.Onthe femaleside,fellowAussieKatieMorriswill takesomestoppinginthebattletowinapro cardinfigure. PREPAREFORLEGENDS Whateverhappensonstage,itpromisestobe amemorablethreedaysforfansof Australasianandinternationalmuscle. DohertysaystheArnoldwillbeAustralias biggestmulti-sportfestivalever. WhentheArnoldClassicteamdecidedto runthenextchapteroftheirsuccessfulworld- wideexpansion,joiningwiththeAustralian ProandFitXwasaperfectchoice,hesays. With31individualsportssignedon,across severalworld-classvenues,wecanexpect over10,000individualathletestocompete. TheArnoldamateurisexpectedtoattract over500athletesfromacrosstheSouth Pacificalone. WithoverUS$100,000inprizemoney, thebestcompetitorsinpromensopen,pro bikiniandprofigurearesuretomakethe journeytoMelbourneoneweekafterthe ArnoldClassicinColumbus,Ohio. The 15,000 square metres of exhibition space are completely sold out.The biggest companies in the business will be bringing all the stars to meet and greet the fans in Melbourne.Olympia winners Phil Heath, Jay Cutler,Ronnie Coleman and Dexter Jackson will be there.Legends like Kevin Levrone,Chris Cormier and Shawn Ray will be there. Arnold Schwarzenegger himself will be on hand to present the Arnold Classic awards,walk through the expo and hold the first Arnold seminar in the Super Seminar Gym.Tickets are selling fast and Australia is excited.FLEX Forinformationgoto www.arnoldclassic.com.au. KaiGreene(centre)beatsDexterJackson (left)andMelvinAnthonyin2010 Thisyearsforerunnerforthe mensprocard,ScottGoble ChrisCormier(right) winsin2002 2015favourite towinthepro cardinFigure, KatieMorri 2014top5pro figurewinners ArnoldwithTonyDoherty 94 FLEX 95FLEX
  32. 32. W FLEXCONTEST NOTTINGHAMS GREATEST MOMENTSFLEXBIDSAFONDFAREWELLTOTHEPLACETHATBECAMEBRITISH BODYBUILDINGSSPIRITUALHOMEWITHALOOKBACKATSOMEOF THEMOSTMEMORABLEMOMENTSSEENATTHECITYSROYALCENTRE BYJOHNPLUMMER 10 44 FLEX 45FLEX
  33. 33. 2THEBLINDLEADS THENON-BLIND Oscar Pistorius is a runner without legs; Ricky Welling is a bodybuilder without sight.They seem equally implausible.After all,how can a bodybuilder lift weights properly or assess his physique without the gift of sight? Welling,a self-confessed stubborn so-and-so who despises any form of self-pity,didnt let the matter of being blind stop him from doing what he wanted.Using his shins to bump his way around the weights room and relying on feel to work his muscles,he built himself up to epic proportions then relied on the honest feedback of his training partner Eddie Abbew to assess how he looked.His efforts paid off in spectacular style in 2002 when he won the heavyweight and overall titles.It was anything but a sympathy vote Welling was clearly the best. Sincetheturnofthe century,apilgrimage toNottinghamhas becomeanannualritualfor anyonewhofollowsbodybuilding intheUK.Peoplehavemadea beelinefortheEastMidlandsto watchthebiggestshowonthe domesticcalendartheUKBFFUK Championships.Thecontest istheculminationoftheseason andendswiththecrowningofa newIFBBpro.Itisasimportant toUKfansastheMrOlympiais toAmericansandalthough Nottinghammightnothavethe sameallureasLasVegas,withtime comesfamiliarityandoverthe yearsbodybuildershavedeveloped arealaffinityfortheplaceitsbars andrestaurantsandinparticular theRoyalCentre,whichhashosted thecontesteachyear. Thevenuehaswitnessedsome ofthemostmemorablemoments inUKbodybuilding.Dreamshave beenrealised;heartshavebeen broken. Butnomore.ThisyearsUK Championshipsweremovedto Manchesterwheretheyweredue totakeplacealongsidetheIFBB BritishGrandPrixandahostof othereventsatthenewSportEx festival. Wecouldntsaygoodbyeto Nottinghamwithoutlooking backatsomeofthepeopleand momentsthathavemadethe placesospecialovertheyears. 1KHANFINALLYBECOMESKING Foryears,nodiscussionthenightbeforethe contesttookplacewithoutthefollowing sentence:italldependsonZack.ZackKhan wasthebiggestandfreakiestbodybuilderin Britainbutheneverseemedtoproveitat Nottingham.Forsomereasonheneverturned upintopshapeandmerelytantalisedfans withhispotential.Fourtimeshefinished secondandeachtimeitwashardertotake. Justwhenitseemedhemightneverwinhegot themonkeyoffhisbackinspectacularstyleby winningthenewsuper-heavyweightclassand theoveralltitlein2009,whicharguablyhad thebestcropofweightclasswinnersever seenatNottingham.Welshpre-contestexpert NeilHill,whohadhelpedLewisandLlewellin taketheoveralltheprevioustwoyears,was onceagaintheking-maker,helpingKhan achievehisbestconditionsofar.AlvinSmall pushedKhanallthewayandwouldhavehis moment12monthslater. 1 2 46 FLEX 47FLEX
  34. 34. 3THEFLEXLEWISERABEGINS Everyone knew Flex was a bit special when he crushed all before him as a junior.But Troy Brown shocked the Welsh boyo wonder in the 2006 overall posedown.It was the first time Lewis had lost to anyone and he wasnt in the mood for a repeat when he returned 12 months later.But the pressure was on his career was already taking off in America and he needed that pro card for credibility. Arriving in Nottingham with a film crew in tow he was all business back stage.On stage he won the light-heavyweights,the overall and proposed to his girlfriend on stage.It was a productive days work.FLEX wrote:The contest took place almost a decade to the day after Dorian Yates,Britains six-time Mr Olympia,bowed out of the sport.Its ridiculous to expect anyone to fill his shadow but there was certainly a sense in Nottingham that a standard bearer for a new generation of British bodybuilders had emerged. 3 48 FLEX
  35. 35. 5CLASSICKINGS Theideaofrestrictingabodybuildersweight wouldhavebeenlaughedoutoftownearlyin theNottinghamyears.Indeed,some peopledidsmirkwhentheclass startedin2007formenwho didntwanttogetbigatany costandwhopreferreda moreclassicallook. SeanFergusonbecame thefirstclassicchampionin 2007butBobbyKhan,the 2009winner,remainsthebest known.Khansetnewstandards forshapeandconditionandchangeda lotofpeoplesmindsaboutclassic,whichis nowthemostpopularclassatmanyshows. Themensathleticfitnessclasswasaddedto theprogrammein2012asmensbodybuild- ing,likewomens,increasinglyreachesoutto peopleofalllevelsofdevelopment. 4BIKINIANDBODYFITNESS MAKETHEIRBOW Womens bodybuilding changed utterly during the Nottingham years.The old under-52 kg,under-57 kg and over-57 kg bodybuilding weight categories were reduced to one open class while new categories began for women who prefer to train for a less extreme look.Gemma Williams won the inaugural bodyfitness title in 2003 and although she only beat two women,her new look caused a sensation and more and more women switched classes and great champions such as Carmen Knights,Louise Rogers,Maxine Cook and Renata Sulekaite emerged.Bikini offerred an even more pared down option in 2011 and threatens to revolutionise the womens side of things by appealing to the mass market. Heather Schofield defeated Welsh duo Lydia Rees and Beth Workman to become the first bikini queen. 6THEAMAZINGIRINA Nottingham has seen few more remarkable champions than Irina Cotton.Born in the Ukraine,she was a professional gymnast in the old Soviet Union before she emigrated to England in the 1990s.She arrived at a time when the new Fitness Olympia was gaining popularity and when Cotton saw a video of it she was blown away by the physiques and routines of the top Americans.She decided to have a go herself,even though she was in her 40s twice the age of many women who compete in this most demanding division. By the time she was 50 she had become an unbeaten,three-time UK fitness champion and the ultimate poster woman for active ageing. 5 4 6 50 FLEX 51FLEX
  36. 36. 7THEPAULDELAHAYETRAGEDY An experienced judge once told FLEX that Delahaye was the most genetically gifted British bodybuilder he had ever seen,with the potential to compete at the Mr Olympia. It looked like Delahaye,a Nottinghamshire man,might belatedly get his chance when he won his pro card in 2005 just three months after leaving prison.His rapid transformation was remarkable and a prison officer who had helped him get on the right track was there to share his moment.It was a wonderful moment but sadly,the tears turned from joy to sorrow when Delahaye,a recreational drug user,died in 2008 before he had ever competed as a pro. 7 52 FLEX
  37. 37. 8PATWARNERNAILSIT ThebarsofNottinghamwerefullofpre-show talkaboutwhowouldwinthestacked heavyweightclassin2009.Notmuchofit focusedonPatWarner.Pathadareputationas aniceguybutabitofanearlyman.Hehadnever quitenailedhisconditionandsomefeltthatat theageof44,histimehadgone.Howwrong theywere.Patturnedupintheshapeofhislifeto getthetitlehehadalwayscravedanddefeattop qualityguyslikeBarnyduPlessis,LeeSpencer andJamesShelmerdine.Theoldgunslingerhad marchedintotownandshotthemalldownbut notwithoutafewhiccups.Hehadtosweatoff afewouncesonthemorningoftheweigh-in beforereturningafractionbeneaththe100kg limitminutesbeforethescaleswereputaway. 8 54 FLEX 55FLEX
  38. 38. consequence of the growth of the sport during the Nottingham years,The number of classes and the number of qualifiers had expanded to the point where almost 250 men and women were weighing in at the finals. Thats a lot of routines to sit through in one day.Despite the extra cost,the addition of the second day proved a major success.FLEX 10 10MORECOUNTRIES, LONGERFORMAT The United Kingdom of Great Britain and Northern Ireland had existed as a political entity for almost 80 years before bodybuild- ing adopted the same.Until then the contest was known as the English Federation of BodybuildersBritish Championships,which was somewhat confusing,particularly as the Celtic nations competed while also anointing their own IFBB pros.The two-day format, which started in 2009,was an inevitable 9LLEWELLINDOWNSIZES TOVICTORY Bodybuilding is about getting bigger,right? James Llewellin blasted this theory out the water in 2008 when he went from light- heavyweight to middleweight to win the overall.Llewellins star had been on the rise for some time.Originally known for his massive arms,he had improved his weaker parts to the point where he was a serious contender in 2007 but had to settle for second in the light-heavies to Flex Lewis. It seemed natural to assume that Llewellin would spend the next year trying to get bigger.But he hooked up with Neil Hill,who had helped Lewis beat him,and came back several kilos lighter in 2008 as a middle- weight.He had rightly deduced that he was suited to a lighter body weight and his tighter waist and powerful-looking physique helped him became only the fourth middleweight to win the overall. 9 57FLEX56 FLEX
  39. 39. PORTRTFLEX Von ALBERT BUSEK Fotos: MANFRED ZANKER DerRussland-DeutscheDIMAANISIMOVschafftedenSprungvonder Junioren-indieMnnerklassemitBravourundlegtemitdemGesamtsieg inErlangen2009denGrundsteinfreinevielversprechendeKarriere. INTERNATIONALERBAYERISCHERMEISTER2009 DimaAnisimovkonntesichbei derInternationalenDeutschen Meisterschaft2009ineinem WeltklassefeldimMnner- Superschwergewichtinder Spitzengruppebehaupten. 212 FLEX 213FLEX
  40. 40. AusdemSchnuppernwurdeeinzweistn- digesTrainingmitdemErgebnis,dasssichDima am nchsten Tag kaum bewegen konnte. Aber er wusste auch, dass er sein Ding gefunden hatte.VerglichenmitEishockey,daserbisdahin schon3Jahregespielthatte,sagteDimaheute rckblickend: Die ersten zwei Stunden Han- teltraining haben mir mehr Spa gemacht als die 3 Jahre Eishockey. BeiseinensehrgutenkrperlichenAnlagen undseinemsportlichenEhrgeizwaresnureine FragederZeit,bisDimaaufderWettkampfbhne landen wrde. 2005 war es soweit und Dima debtierte bei der Ostdeutschen Meisterschaft gleich mit einemSiegbeidenJunioren.DanachwarDima endgltig vom Wettkampf-Virus infiziert und setztesichgroeZiele.BeiderInternationalen Bayerischen Meisterschaft 2006 zog Dima bereits alle Blicke auf sich und gewann ber- legendenJuniorentitel.MitgroenErwartun- genfuhrDimakurzdaraufzurInternationalen Deutschen Meisterschaft. Der Leistungsstan- dardwarzwarauergewhnlichhochundDimas 4. Platz auch als Erfolg zu sehen, doch fr ihn persnlichwareseingroerRckschritt.Dima will gewinnen. Alle Energie fokussierte Dima dann auf sein letztes Jahr als Junior 2007! Underschaffteallesfastalles!ImHerbst2007 war er zweifellos einer der Juniorenstars in Deutschland,gewannvierMeistertitelundholte zwei Junioren Gesamtsiege (Int. Bayerische undInt.RheinNeckarPokal).BeiderInt.Deut- scheninWieslochverhindertenureinweiterer Ausnahme-Athlet den totalen Triumph. Dima musstesichDanielHillgeschlagengeben.Dieser Rckschlag traf Dima dann aber nicht mehr DIMAANISIMOV PERSNLICHEANGABEN WOHNORT 91074Herzogenaurach GEBURTSDATUM 21.10.1986 STERNZEICHEN Waage FAMILIENSTAND ledig BERUF KaufmnnischerAssistent HOBBYS Kochen,Essen,Gitarrespielen MEINFITNESSSTUDIO FitnesscenterSchardt,Herzogenaurach MEINWETTKAMPFVORBEREITER ManuelBauer LIEBLINGS-MEN Pelmeni(russischesGericht) ICHBINAKTIVSEIT2001 ICHMACHEWETTKMPFESEIT2005 MEINNCHSTESSPORTLICHESZIEL InternationalerDeutscheMeister MEINESPORTLICHENVORBILDERSIND ArnoldSchwarzenegger,RonnieColeman LEBENSMOTTO Zhnezusammenbeienundnieaufgeben MASSEUNDGEWICHTE KRPERGRSSE181cm WETTKAMPFGEWICHT108-110kg OFF-SEASON-GEWICHT123 kg OBERSCHENKEL71cm ARM50cm TAILLE90cm BRUST135cm WADEN45cm KRAFTLEISTUNGEN BANKDRCKEN180kgx5 KNIEBEUGE 170kg Frontx 8 Vor sieben Jahren kam Dima mit seinen Eltern aus Russland nach Deutschland und wohnte zunchst in Sonneberg/ Thringen,wo er erst die Realschule und dann eine Ausbildung zum Kaufmnnischen Assistenten mit Erfolg abgeschlossen hat.Sein Bruder trainierte bereits in Russland sehr intensiv mit Gewichten und 2001 ging Dima schlielich auch einmal mit,um zu schnuppern. EinglcklicherDima nachseinemersten Gesamtsiegbeiden MnnerninErlangen. DasPreisgeldfrseinen Junioren-Gesamtsiegbeim Rhein-Neckar-Pokal2007 schmeckteDima. 214 FLEX 215FLEX
  41. 41. ganz so hart. Er hatte bereits Plne fr seinen bergang in die Mnnerklasse. Und dazu zog Dima2008nachHerzogenaurachundtrainiert seither im Fitnesscenter Schardt einer der groen Athletenschmieden Deutschlands. Zudem organisieren Helmut und Dora Schardt seit Jahren hchste erfolgreich die Interna- tionale Bayerische Meisterschaft in Erlangen. Das Ziel wurde Dima damit praktisch vorgege- ben: Int. Bayerische 2009 und zwar im Superschwergewicht. Egal wie erfolgreich ein AthletalsJuniorwar,derbergangindieMn- nerklasse ist immer sehr schwer, vor allem im Superschwergewicht.DochDimawarvonseiner Chanceberzeugt:IchnahmdieVorbereitung fr die Bayerische 2009 mit dem Ziel auf, bei denMnnernimSuperschwergewichtzugewin- nen und ich rechnete mir eine Chance von 90 % aus. Alle seine Freunde, sein Trainer Manuel Bauer, sein Sponsor Best Body Nutrition und natrlich auch seine Freundin standen 100 % hinterihmunduntersttztenDimainjeglicher Hinsicht. Die Wettkampfvorbereitung war auf knapp5MonateangesetztundDimazogsowohl das Training als auch die Dit so intensiv und diszipliniert wie noch nie durch. Dima setzt grundstzlichdasPriorittsprinzipkonsequent DIMAANISIMOV WETTKAMPFERFOLGE JAHR WETTKAMPF KLASSE PLATZIERUNG 2005 OstdeutscheMeisterschaft Junioren 1.Platz 2006 Int.BayerischerMeisterschaft Junioren 1.Platz 2006 Int.DeutscheMeisterschaft Junioren 4.Platz 2007 Int.SddeutscheMeisterschaft Junioren 1.Platz 2007 Int.BayerischerMeisterschaft Junioren 1.Platz* 2007 Int.RheinNeckarPokal Junioren 1.Platz* 2007 Int.GroerPreisvonHessen Junioren 1.Platz 2007 Int.DeutscheMeisterschaft Junioren 2.Platz 2009 Int.BayerischeMeisterschaft Mnner5 1.Platz* 2009 Int.DeutscheMeisterschaft Mnner5 3.Platz *Gesamtsieger DIMAANISIMOV WETTKAMPFERNHRUNG TAGESZEIT/UHR MENGE LEBENSMITTEL 7.00 15/100g Eiklar/Reis 9.00 150g Thunfisch 11.00 40g Eggprotein 12.00 250g/100g Hhnchen/Reis 15.00 300g Rindfleisch 19.00 30g WheyPro 10g Glutamin 10g BCAA 100g Reis 20.00 250g Pute 22.30 300g Rindfleisch 00.00 40g Eggprotein Dima2009 inErlangen InderFormseinesLebenswurdeDima AnisimovMnner-Gesamtsiegerbeider Int.BayerischenMeisterschaft2009. InderFormseinesLebenswurdeDima AnisimovMnner-Gesamtsiegerbeider Int.BayerischenMeisterschaft2009. BeiseinererstenInt.Deutschen Meisterschaf2006wurdeDimaim Junioren-SchwergewichtVierter. 216 FLEX
  42. 42. umundrichtetdasHauptaugenmerkaufseine Schwchenundmeintdazutrocken:Wennich indenSpiegelschaue,findeichimmerStellen, die zu verbessern sind und konzentriere mich dannbeimTrainingdarauf.Dimavariiertsein Training auch sehr stark, was letztlich dann zum Instinktivprinzip fhrt. Allerdings mit einem vorgegebenen Rahmen. Es passt gut zu Dimas Pers

Related Documents
Designing Flex and Rigid Flex Applicaitons - …circuits-corp.com/.../03/Designing-Flex-and-Rigid-Flex-Applications... · Designing Flex and Rigid Flex Products for High Reliability

Designing Flex and Rigid Flex Applicaitons -...

Category: Documents
IP MIGRATION MADE SIMPLE NVT PHYBRIDGE FLEX ......IP MIGRATION MADE SIMPLE FLEX ADAPTERS & EXTENDERS NVT PHYBRIDGE FLEX-Link FLEX-C FLEX-Base DATA SHEET FLEX Adapters & Extenders The

IP MIGRATION MADE SIMPLE NVT PHYBRIDGE FLEX ......IP...

Category: Documents
Lenovo IdeaPad Flex 14/Flex 14D Flex 15/Flex 15D...Lenovo IdeaPad Flex 14/Flex 14D Flex 15/Flex 15D Lea los avisos de seguridad y las sugerencias importantes es-ES en los manuales

Lenovo IdeaPad Flex 14/Flex 14D Flex 15/Flex 15D...Lenovo...

Category: Documents
Dutch Flex December 2014 Flex Cup Portfolio

Dutch Flex December 2014 Flex Cup Portfolio

Category: Design
CENTRAL PA PORTFOLIO 476 - Equisolve · CENTRAL PA PORTFOLIO Industrial/Flex O˚ce/Flex 1. 835- 841 Newgate Blvd., Hagerstown 2. 95 Kriner Rd.&1475 Nitterhouse Dr., Chambersburg 3.9300

CENTRAL PA PORTFOLIO 476 - Equisolve · CENTRAL PA...

Category: Documents
RIA & FLEX & Red5 Daniel Hu 2006-11-30. Agenda What’s RIA What’s RIA What’s Flex What’s Flex Flex Builder Flex Builder Architecture of Flex Application.

RIA & FLEX & Red5 Daniel Hu 2006-11-30. Agenda What’s RIA....

Category: Documents
Oracle flex asm & flex cluster

Oracle flex asm & flex cluster

Category: Technology
Hp flex network portfolio guide

Hp flex network portfolio guide

Category: Technology
EFR32FG13 Flex Gecko Proprietary Protocol SoC Family … · EFR32FG13 Flex Gecko Proprietary ... Wireless Gecko portfolio. Flex Gecko SoCs are ideal for enabling energy-friendly proprietary

EFR32FG13 Flex Gecko Proprietary Protocol SoC Family … ·...

Category: Documents
Lenovo IdeaPad Flex 2-14/Flex 2-14D Flex 2-15/Flex …Lenovo Flex 2-14/Flex 2-14D/Flex 2-15/Flex 2-15D Hardware Main-tenance Manual 4 † Always look carefully for possible hazards

Lenovo IdeaPad Flex 2-14/Flex 2-14D Flex 2-15/Flex …Lenovo...

Category: Documents
HAWKER FLEX...HAWKER® FLEX™ batteries are the newest product in the HAWKER ® solutions portfolio. • Multi-shift • Production areas • Retail stores and membership warehouses

HAWKER FLEX...HAWKER® FLEX™ batteries are the newest...

Category: Documents
Graphic Design Portfolio · agcgmailcom alexgonaledesigncom linkedincominagc Flex & Cuts Barbershop Branding & Collateral Ray Spencer Executive Creative Director

Graphic Design Portfolio · agcgmailcom alexgonaledesigncom...

Category: Documents