• False negative HBsAg detection False negative HBsAg detection Is rare in patients with signs of chronic Is rare in patients with signs of chronic hepatitis B. hepatitis B. May be an issue in low-risk populations, such as: May be an issue in low-risk populations, such as: – blood donors, blood donors, – organ, tissue and cell donors. organ, tissue and cell donors. • It may result of: It may result of: Undetectable, low-level HBsAg. Undetectable, low-level HBsAg. Substitutions in HBsAg “Major Hydrophilic Region”: Substitutions in HBsAg “Major Hydrophilic Region”: – located at positions 99 to 160, located at positions 99 to 160, – encompasses the “a” determinant, a major HBV epitope. encompasses the “a” determinant, a major HBV epitope. False-Negative HBsAg False-Negative HBsAg Detection in Chronic Detection in Chronic Hepatitis B Hepatitis B
28
Embed
False-Negative HBsAg Detection in Chronic Hepatitis B
False-Negative HBsAg Detection in Chronic Hepatitis B. False negative HBsAg detection Is rare in patients with signs of chronic hepatitis B. May be an issue in low-risk populations, such as: blood donors, organ, tissue and cell donors. It may result of: Undetectable, low-level HBsAg. - PowerPoint PPT Presentation
Welcome message from author
This document is posted to help you gain knowledge. Please leave a comment to let me know what you think about it! Share it to your friends and learn new things together.
Transcript
• False negative HBsAg detectionFalse negative HBsAg detection Is rare in patients with signs of chronic hepatitis B.Is rare in patients with signs of chronic hepatitis B. May be an issue in low-risk populations, such as:May be an issue in low-risk populations, such as:
– blood donors,blood donors,
– organ, tissue and cell donors.organ, tissue and cell donors.
• It may result of:It may result of: Undetectable, low-level HBsAg.Undetectable, low-level HBsAg. Substitutions in HBsAg “Major Hydrophilic Region”:Substitutions in HBsAg “Major Hydrophilic Region”:
– located at positions 99 to 160,located at positions 99 to 160,
– encompasses the “a” determinant, a major HBV epitope.encompasses the “a” determinant, a major HBV epitope.
False-Negative HBsAg False-Negative HBsAg Detection in Chronic Detection in Chronic
Hepatitis BHepatitis B
Mutations in “a” DeterminantMutations in “a” Determinant
107107 138138 139139
137137 149149
147147
AA
RRD D 144144
G G 145145
210210
S-SS-SS-SS-S
--S-S---S-S-
9999
121121 124124S-SS-SLoopLoop 1 of “a” determinant 1 of “a” determinant
LoopLoop 2 of “a” determinant 2 of “a” determinant
HBs1HBs1
HBs2HBs2
HBs3HBs3
HBs4HBs4
HBs5HBs5
141 141 KK
TT 126126
NN
QQ 129129
HH
MM 133133
LL
EE
Aims of the StudyAims of the Study
• To determine the prevalence of falsely negative To determine the prevalence of falsely negative
HBsAg detection in a large population of organ, HBsAg detection in a large population of organ,
tissue and cell donors.tissue and cell donors.
• To understand the role of HBsAg mutants in the To understand the role of HBsAg mutants in the
lack of HBsAg detection in HBV DNA positive lack of HBsAg detection in HBV DNA positive
donors.donors.
PatientsPatients
• 11,155 organ, tissue and cell donors were systematically 11,155 organ, tissue and cell donors were systematically tested for the presence of HBV markers (e.g. HBsAg, anti-tested for the presence of HBV markers (e.g. HBsAg, anti-HBc Ab, anti-HBs Ab) between May 2000 and May 2004:HBc Ab, anti-HBs Ab) between May 2000 and May 2004:
First groupFirst group::- 626 donors (5.6%),626 donors (5.6%),- with at least one of the three HBV serological markers,with at least one of the three HBV serological markers,- excluding vaccination profiles (anti-HBs Ab alone).excluding vaccination profiles (anti-HBs Ab alone).
• 11,155 organ, tissue and cell donors were systematically 11,155 organ, tissue and cell donors were systematically tested for the presence of HBV markers (e.g. HBsAg, anti-tested for the presence of HBV markers (e.g. HBsAg, anti-HBc Ab, anti-HBs Ab) between May 2000 and May 2004:HBc Ab, anti-HBs Ab) between May 2000 and May 2004:
First groupFirst group::- 626 donors (5.6%),626 donors (5.6%),
- Brain-dead, heart-beating organ donorsBrain-dead, heart-beating organ donors
- Living organ donorsLiving organ donors
- Tissue donorsTissue donors
- Stem cell donorsStem cell donors
- Cord blood donorsCord blood donors
- Cornea donorsCornea donors
199199
1313
165165
7575
5656
118 118
PatientsPatients
• 11,155 organ, tissue and cell donors were systematically 11,155 organ, tissue and cell donors were systematically tested for the presence of HBV markers (e.g. HBsAg, anti-tested for the presence of HBV markers (e.g. HBsAg, anti-HBc Ab, anti-HBs Ab) between May 2000 and May 2004:HBc Ab, anti-HBs Ab) between May 2000 and May 2004:
First groupFirst group::- 626 donors (5.6%),626 donors (5.6%),- with at least one of the three HBV serological markers,with at least one of the three HBV serological markers,- excluding vaccination profiles (anti-HBs Ab alone).excluding vaccination profiles (anti-HBs Ab alone).
Second group:Second group:- 1433 brain-dead organ donors,1433 brain-dead organ donors,- seronegative for HBV or with anti-HBs Ab only.seronegative for HBV or with anti-HBs Ab only.
PatientsPatients
Methods (1)Methods (1)
• HBsAg HBsAg was assessed with 3 different assays:was assessed with 3 different assays:
• HBV DNAHBV DNA was systematically sought by means of a was systematically sought by means of a real-time PCR assay:real-time PCR assay:
Cobas TaqMan HBV (Roche Molecular Systems),Cobas TaqMan HBV (Roche Molecular Systems), Lower limit of detection: 6 IU/ml,Lower limit of detection: 6 IU/ml, Dynamic range of quantification: 30-10Dynamic range of quantification: 30-1088 IU/ml. IU/ml.
• Full-length Full-length preS1-preS2-HBsAg sequencepreS1-preS2-HBsAg sequence was was determined in all HBV DNA-positive donors:determined in all HBV DNA-positive donors:
Nested PCR using previously described primersNested PCR using previously described primersa a
Direct sequencing,Direct sequencing,
Alignment of sequences with prototype strains of HBV Alignment of sequences with prototype strains of HBV genotypes A to H.genotypes A to H.
aaStuyver et al., J Gen Virol 2000 Stuyver et al., J Gen Virol 2000
Methods (2)Methods (2)
HBV DNA in HBsAg-positive DonorsHBV DNA in HBsAg-positive Donors
3.3 log3.3 logIU/mlIU/ml
2.5 log2.5 logIU/mlIU/ml
5.4 log5.4 logIU/mlIU/ml
2.0 log2.0 logIU/mlIU/ml
2.7 log2.7 logIU/mlIU/ml
Brain-deadBrain-deadorgan donorsorgan donors
(n = 199)(n = 199)
LivingLivingorgan donorsorgan donors
(n = 13)(n = 13)
TissueTissueDonorsDonors
(n = 165)(n = 165)
Cord bloodCord bloodDonorsDonors(n = 56)(n = 56)
Stem cellStem cellDonorsDonors(n = 75)(n = 75)
CorneaCorneaDonorsDonors
(n = 118)(n = 118)
17/20 (85%)17/20 (85%)
2/2 (100%)2/2 (100%)
3/5 (60%)3/5 (60%)
2/2 (100%)2/2 (100%)
1/8 (12.5%)1/8 (12.5%)20%20%
40%40%
60%60%
80%80%
100%100%
0%0%
HBV DNA in Donors with HBV DNA in Donors with Isolated Anti-HBc AbIsolated Anti-HBc Ab
1.6 log1.6 logIU/mlIU/ml
3.6 log3.6 logIU/mlIU/ml
20%20%
40%40%
60%60%
80%80%
100%100%
0%0%
2/53 (3.8%)2/53 (3.8%)2/21 (9.5%)2/21 (9.5%)
Brain-deadBrain-deadorgan donorsorgan donors
(n = 199)(n = 199)
LivingLivingorgan donorsorgan donors
(n = 13)(n = 13)
TissueTissueDonorsDonors
(n = 165)(n = 165)
Cord bloodCord bloodDonorsDonors(n = 56)(n = 56)
Stem cellStem cellDonorsDonors(n = 75)(n = 75)
CorneaCorneaDonorsDonors
(n = 118)(n = 118)
2.4 log2.4 logIU/mlIU/ml
20%20%
40%40%
60%60%
80%80%
100%100%
0%0%
3/62 (4.8%)3/62 (4.8%)
HBV DNA in Donors with Both HBV DNA in Donors with Both Anti-HBc and Anti-HBs AbAnti-HBc and Anti-HBs Ab
Brain-deadBrain-deadorgan donorsorgan donors
(n = 199)(n = 199)
LivingLivingorgan donorsorgan donors
(n = 13)(n = 13)
TissueTissueDonorsDonors
(n = 165)(n = 165)
Cord bloodCord bloodDonorsDonors(n = 56)(n = 56)
Stem cellStem cellDonorsDonors(n = 75)(n = 75)
CorneaCorneaDonorsDonors
(n = 118)(n = 118)
3.5 log3.5 logIU/mlIU/ml
3.6 log3.6 logIU/mlIU/ml
20%20%
40%40%
60%60%
80%80%
100%100%
0%0%
2/5 (40%)2/5 (40%)
1/27 (3.7%)1/27 (3.7%)
HBV DNA in Donors with HBV DNA in Donors with Three MarkersThree Markers
Brain-deadBrain-deadorgan donorsorgan donors
(n = 199)(n = 199)
LivingLivingorgan donorsorgan donors
(n = 13)(n = 13)
TissueTissueDonorsDonors
(n = 165)(n = 165)
Cord bloodCord bloodDonorsDonors(n = 56)(n = 56)
Stem cellStem cellDonorsDonors(n = 75)(n = 75)
CorneaCorneaDonorsDonors
(n = 118)(n = 118)
HBsAg Gen AHBsAg Gen A: MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNH: MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHHBsAg Gen BHBsAg Gen B: ............................................................ : ............................................................ HBsAg Gen CHBsAg Gen C: ....A..L............S..K.....L.............ET..........QI.S. : ....A..L............S..K.....L.............ET..........QI.S. HBsAg Gen DHBsAg Gen D: ............................................TT.............. : ............................................TT.............. HBsAg Gen EHBsAg Gen E: ..S....................K....................A............... : ..S....................K....................A............... HBsAg Gen FHBsAg Gen F: .......L....R....VC....K....................L.R.P........... : .......L....R....VC....K....................L.R.P........... HBsAg Gen GHBsAg Gen G: .......L....R....VC....K....................L.R.P........... : .......L....R....VC....K....................L.R.P........... HBsAg Gen HHBsAg Gen H: .......L.R.......VC....K...................VP.G.P.......I...: .......L.R.......VC....K...................VP.G.P.......I... HBsAg-9 : ..S....................K....................A............... HBsAg-9 : ..S....................K....................A............... HBsAg-10 : ....A..L...............K....................T..........QI.S. HBsAg-10 : ....A..L...............K....................T..........QI.S. HBsAg-11 : ...T.......................................HBsAg-11 : ...T.......................................EE
HBsAg Sequence Analysis HBsAg Sequence Analysis Group 1Group 1
HBsAg-positive donorsHBsAg-positive donors
Isolated anti-HBc Ab donorsIsolated anti-HBc Ab donors
Donors with three Donors with three serological markersserological markers
45
Reference prototype strains Reference prototype strains of A to H genotypesof A to H genotypes
HBsAg Gen AHBsAg Gen A: MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNH: MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHHBsAg Gen BHBsAg Gen B: ............................................................ : ............................................................ HBsAg Gen CHBsAg Gen C: ....A..L............S..K.....L.............ET..........QI.S. : ....A..L............S..K.....L.............ET..........QI.S. HBsAg Gen DHBsAg Gen D: ............................................TT.............. : ............................................TT.............. HBsAg Gen EHBsAg Gen E: ..S....................K....................A............... : ..S....................K....................A............... HBsAg Gen FHBsAg Gen F: .......L....R....VC....K....................L.R.P........... : .......L....R....VC....K....................L.R.P........... HBsAg Gen GHBsAg Gen G: .......L....R....VC....K....................L.R.P........... : .......L....R....VC....K....................L.R.P........... HBsAg Gen HHBsAg Gen H: .......L.R.......VC....K...................VP.G.P.......I...: .......L.R.......VC....K...................VP.G.P.......I... HBsAg-9 : ..S....................K....................A............... HBsAg-9 : ..S....................K....................A............... HBsAg-10 : ....A..L...............K....................T..........QI.S. HBsAg-10 : ....A..L...............K....................T..........QI.S. HBsAg-11 : ...T.......................................HBsAg-11 : ...T.......................................EE
HBsAg Sequence Analysis HBsAg Sequence Analysis Group 1Group 1
45
HBsAg-positive donorsHBsAg-positive donors
Isolated anti-HBc Ab donorsIsolated anti-HBc Ab donors
Donors with three Donors with three serological markersserological markers
Reference prototype strains Reference prototype strains of A to H genotypesof A to H genotypes
HBsAg Gen AHBsAg Gen A: MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNH: MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHHBsAg Gen BHBsAg Gen B: ............................................................ : ............................................................ HBsAg Gen CHBsAg Gen C: ....A..L............S..K.....L.............ET..........QI.S. : ....A..L............S..K.....L.............ET..........QI.S. HBsAg Gen DHBsAg Gen D: ............................................TT.............. : ............................................TT.............. HBsAg Gen EHBsAg Gen E: ..S....................K....................A............... : ..S....................K....................A............... HBsAg Gen FHBsAg Gen F: .......L....R....VC....K....................L.R.P........... : .......L....R....VC....K....................L.R.P........... HBsAg Gen GHBsAg Gen G: .......L....R....VC....K....................L.R.P........... : .......L....R....VC....K....................L.R.P........... HBsAg Gen HHBsAg Gen H: .......L.R.......VC....K...................VP.G.P.......I...: .......L.R.......VC....K...................VP.G.P.......I... HBsAg-9 : ..S....................K....................A............... HBsAg-9 : ..S....................K....................A............... HBsAg-10 : ....A..L...............K....................T..........QI.S. HBsAg-10 : ....A..L...............K....................T..........QI.S. HBsAg-11 : ...T.......................................HBsAg-11 : ...T.......................................EE
HBsAg Sequence Analysis HBsAg Sequence Analysis Group 1Group 1
HBsAg-positive donorsHBsAg-positive donors
Isolated anti-HBc Ab donorsIsolated anti-HBc Ab donors
Donors with three Donors with three serological markersserological markers
Reference prototype strains Reference prototype strains of A to H genotypesof A to H genotypes
HBsAg Gen AHBsAg Gen A: KTCTTPAQGNSMFPSCCCTKPTDGNCTC: KTCTTPAQGNSMFPSCCCTKPTDGNCTCHBsAg Gen BHBsAg Gen B: ............................ : ............................ HBsAg Gen CHBsAg Gen C: .........T.................. : .........T.................. HBsAg Gen DHBsAg Gen D: R....T...T..Y........S...... : R....T...T..Y........S...... HBsAg Gen EHBsAg Gen E: R..M.L...T........S..S...... : R..M.L...T........S..S...... HBsAg Gen FHBsAg Gen F: ....AL...T........S..S...... : ....AL...T........S..S...... HBsAg Gen GHBsAg Gen G: ....AL...T........S..S......: ....AL...T........S..S......HBsAg Gen HHBsAg Gen H: .....L...T...........S......: .....L...T...........S...... HBsAg-9 : R....L...T........S..S......HBsAg-9 : R....L...T........S..S......HBsAg-10 : .........T..................HBsAg-10 : .........T..................HBsAg-11 : .HBsAg-11 : .MM
Reference prototype strains Reference prototype strains of A to H gentotypesof A to H gentotypes
HBsAg-positive donorsHBsAg-positive donors
Isolated anti-HBc Ab donorsIsolated anti-HBc Ab donors
Donors with three serological Donors with three serological markersmarkers
HBsAg Gen AHBsAg Gen A: KTCTTPAQGNSMFPSCCCTKPTDGNCTC: KTCTTPAQGNSMFPSCCCTKPTDGNCTCHBsAg Gen BHBsAg Gen B: ............................ : ............................ HBsAg Gen CHBsAg Gen C: .........T.................. : .........T.................. HBsAg Gen DHBsAg Gen D: R....T...T..Y........S...... : R....T...T..Y........S...... HBsAg Gen EHBsAg Gen E: R..M.L...T........S..S...... : R..M.L...T........S..S...... HBsAg Gen FHBsAg Gen F: ....AL...T........S..S...... : ....AL...T........S..S...... HBsAg Gen GHBsAg Gen G: ....AL...T........S..S......: ....AL...T........S..S......HBsAg Gen HHBsAg Gen H: .....L...T...........S......: .....L...T...........S...... HBsAg-9 : R....L...T........S..S......HBsAg-9 : R....L...T........S..S......HBsAg-10 : .........T..................HBsAg-10 : .........T..................HBsAg-11 : .HBsAg-11 : .MM
HBsAg Gen AHBsAg Gen A: KTCTTPAQGNSMFPSCCCTKPTDGNCTC: KTCTTPAQGNSMFPSCCCTKPTDGNCTCHBsAg Gen BHBsAg Gen B: ............................ : ............................ HBsAg Gen CHBsAg Gen C: .........T.................. : .........T.................. HBsAg Gen DHBsAg Gen D: R....T...T..Y........S...... : R....T...T..Y........S...... HBsAg Gen EHBsAg Gen E: R..M.L...T........S..S...... : R..M.L...T........S..S...... HBsAg Gen FHBsAg Gen F: ....AL...T........S..S...... : ....AL...T........S..S...... HBsAg Gen GHBsAg Gen G: ....AL...T........S..S......: ....AL...T........S..S......HBsAg Gen HHBsAg Gen H: .....L...T...........S......: .....L...T...........S...... HBsAg-9 : R....L...T........S..S......HBsAg-9 : R....L...T........S..S......HBsAg-10 : .........T..................HBsAg-10 : .........T..................HBsAg-11 : .HBsAg-11 : .MM
HBsAg Gen AHBsAg Gen A: KTCTTPAQGNSMFPSCCCTKPTDGNCTC: KTCTTPAQGNSMFPSCCCTKPTDGNCTCHBsAg Gen BHBsAg Gen B: ............................ : ............................ HBsAg Gen CHBsAg Gen C: .........T.................. : .........T.................. HBsAg Gen DHBsAg Gen D: R....T...T..Y........S...... : R....T...T..Y........S...... HBsAg Gen EHBsAg Gen E: R..M.L...T........S..S...... : R..M.L...T........S..S...... HBsAg Gen FHBsAg Gen F: ....AL...T........S..S...... : ....AL...T........S..S...... HBsAg Gen GHBsAg Gen G: ....AL...T........S..S......: ....AL...T........S..S......HBsAg Gen HHBsAg Gen H: .....L...T...........S......: .....L...T...........S...... HBsAg-9 : R....L...T........S..S......HBsAg-9 : R....L...T........S..S......HBsAg-10 : .........T..................HBsAg-10 : .........T..................HBsAg-11 HBsAg-11 : . : .MM
HBsAg Gen AHBsAg Gen A: KTCTTPAQGNSMFPSCCCTKPTDGNCTC: KTCTTPAQGNSMFPSCCCTKPTDGNCTCHBsAg Gen BHBsAg Gen B: ............................ : ............................ HBsAg Gen CHBsAg Gen C: .........T.................. : .........T.................. HBsAg Gen DHBsAg Gen D: R....T...T..Y........S...... : R....T...T..Y........S...... HBsAg Gen EHBsAg Gen E: R..M.L...T........S..S...... : R..M.L...T........S..S...... HBsAg Gen FHBsAg Gen F: ....AL...T........S..S...... : ....AL...T........S..S...... HBsAg Gen GHBsAg Gen G: ....AL...T........S..S......: ....AL...T........S..S......HBsAg Gen HHBsAg Gen H: .....L...T...........S......: .....L...T...........S...... HBsAg-9 : R....L...T........S..S......HBsAg-9 : R....L...T........S..S......HBsAg-10 : .........T..................HBsAg-10 : .........T..................HBsAg-11 HBsAg-11 : . : .MM
• No specific features were observed in the No specific features were observed in the preS1 and preS2 regions in the donors with preS1 and preS2 regions in the donors with no detectable HBsAg compared to HBsAg no detectable HBsAg compared to HBsAg positive donors.positive donors.
Frequency of HBV DNA Detection Frequency of HBV DNA Detection in the Second Study Groupin the Second Study Group
Brain-deadBrain-deadorgan donorsorgan donors
Seronegative Seronegative
Anti-HBs alone Anti-HBs alone
TOTALTOTAL
nn
912 912
521521
14331433
HBV DNA +HBV DNA +confirmedconfirmed
0 0
11
11
HBsAg Gen AHBsAg Gen A: KTCTTPAQGNSMFPSCCCTKPTDGNCTC: KTCTTPAQGNSMFPSCCCTKPTDGNCTCHBsAg Gen BHBsAg Gen B: ............................ : ............................ HBsAg Gen CHBsAg Gen C: .........T.................. : .........T.................. HBsAg Gen DHBsAg Gen D: R....T...T..Y........S......: R....T...T..Y........S......HBsAg Gen EHBsAg Gen E: R..M.L...T........S..S...... : R..M.L...T........S..S...... HBsAg Gen FHBsAg Gen F: ....AL...T........S..S...... : ....AL...T........S..S...... HBsAg Gen GHBsAg Gen G: ....AL...T........S..S...... : ....AL...T........S..S...... HBsAg Gen HHBsAg Gen H: .....L...T...........S......: .....L...T...........S...... HBsAg-122 : R....L.PST..Y........S...... HBsAg-122 : R....L.PST..Y........S......
• No additional preS1 or preS2 changes were No additional preS1 or preS2 changes were observed that could explain the lack of HBsAg observed that could explain the lack of HBsAg detection in this donor.detection in this donor.
• HBV DNA:HBV DNA:
is detected in most HBsAg-positive organ, tissue and cell is detected in most HBsAg-positive organ, tissue and cell donors,donors,
can be detected in HBsAg-negative donors, with or without can be detected in HBsAg-negative donors, with or without anti-HBc Ab.anti-HBc Ab.
• In HBV DNA-positive donors, whatever their serological In HBV DNA-positive donors, whatever their serological profile, the level of HBV replication is substantially profile, the level of HBV replication is substantially lower than in patients with chronic hepatitis B.lower than in patients with chronic hepatitis B.
Conclusions (I)Conclusions (I)
• The lack of HBsAg detection in our study could not be The lack of HBsAg detection in our study could not be explained by HBsAg or preS1-preS2 amino acid explained by HBsAg or preS1-preS2 amino acid substitutions (except in one donor without any HBV substitutions (except in one donor without any HBV serological marker).serological marker).
• The lack of HBsAg detection was most likely related The lack of HBsAg detection was most likely related to a lack of sensitivity of enzyme immunoassays for to a lack of sensitivity of enzyme immunoassays for low-level HBsAg in individuals with low-level viral low-level HBsAg in individuals with low-level viral replication.replication.
Conclusions (II)Conclusions (II)
• Organ, tissue and cell transplantation safety may Organ, tissue and cell transplantation safety may greatly benefit from:greatly benefit from:
Implementation of highly-sensitive HBsAg assays.Implementation of highly-sensitive HBsAg assays.
Implementation of highly-sensitive HBV DNA Implementation of highly-sensitive HBV DNA detection assays.detection assays.
PerspectivesPerspectives
French National Reference Center for Viral French National Reference Center for Viral Hepatitis B, C and Delta,Hepatitis B, C and Delta,
Department of Virology, INSERM UDepartment of Virology, INSERM U635635
HHôpital H. Mondorôpital H. Mondor, Université Paris XII, Créteil, Université Paris XII, Créteil