AP BIOLOGY 2012 Computational Biology Proteins Robert S. Goodman SAR H IGH S CHOOL
11
AP BIOLOGY
2012
Computational Biology
Proteins
Robert S. Goodman
S A R H I G H S C H O O L
2
Computational Biology: Proteins
Robert S. Goodman, 2012
All Rights Reserved. No Part of this publication may be reproduced or utilized in any form or
by any means, electronic or mechanical, including photocopying, recording, or by any
information storage system without written permission from the author, Robert S. Goodman.
******************************************************************************
TABLE OF CONTENTS
1 Primary Structure of Proteins 3-10
2 Secondary Structure of Proteins 11-22
3 Tertiary and Quaternary Structure of Proteins 23-31
4 Carboxypeptidase A-An Example of Substrate Binding and Catalysis 32-42
5 The Mystery of the Potassium Channel 43-53
3
The Primary Structure of Proteins
Goals:
To examine the primary structure of proteins
To see how sequence comparisons give us insight into disease and evolutionary
relationships
To examine the relationship between an active and inactive proteins (enzymes).
Background:
In 1951 Frederick Sanger was the first to work out the amino acid sequence of a protein-bovine
insulin. He was awarded the Nobel Prize in Chemistry in 1958 for that accomplishment. In 1980
he was awarded a second Nobel Prize in Chemistry for discovering a method for sequencing
DNA. He is one of only four two time Nobelists and the only two time Nobelist in chemistry.
Sanger was able to cut apart the insulin using different techniques: for example using the enzyme
trypsin in one case or strong acid in another case. Each time he was able to separate the small
peptides and work out their sequences. But to string together those peptides required some clever
analysis. Here is what he did. Suppose that you did not know the order of the alphabet. In one
experiment you cut it up using the imaginary enzyme “alphabetase” and you get these pieces:
ghijkl pqrstuvw abcdef mno xyz
But you do not know what order the fragments are in. However, using another imaginary
enzyme, “letterase” to cut up the alphabet you get these fragments:
vwxyz ijklmnopq abc defgh rstu
Now you reason the following…
1) It seems like nothing ever comes before “a”…so maybe “a” is first.
2) And nothing ever comes after “z”…so maybe “z” is last.
3) So take the long fragment with “a” which goes like this: “abcdef” and from the “defgh”
fragment obtained with the second method we know that “gh” comes next. We then look
at the fragment “ghijkl” obtained using the first method and we know that “ijkl” comes
have “gh”.
4) Keep going with that same “overlap” analysis of fragments and you will figure out the
whole alphabet: abcdefghijklmnopqrstuvwxyz !!!!
Of course it wasn’t quite this simple, but this analogy give you some idea of Sanger’s approach.
4
Using Sanger’s method, the amino acid sequences of many proteins were worked out by
researchers around the world. The sequence of amino acids in a protein is just one important
aspect of protein structure known as the “primary structure”. In later activities you will learn
about the secondary, tertiary and quaternary structure as well. Although the primary structure
plays a major role in ultimately determining the higher levels of structure (secondary, tertiary
and quaternary), we are becoming more aware that there are other factors which affect the
ultimate shape of a protein. Those factors would include the role of chaperonins, post
translational modifications of the primary structure as well as the action of signal molecules that
activate or inactive various proteins.
The primary structure of proteins gave scientists a method of comparing variations in various
organisms which provided clues to understanding disease as well as evolutionary relationships.
This activity will focus on the primary structure of various proteins.
Procedure:
A) One protein, an enzyme that you may study in the laboratory later in the course is catalase.
This enzyme is found in virtually all aerobic organisms. It catalyzes the decomposition of
hydrogen peroxide (H2O2), a byproduct of oxidative reactions. Hydrogen peroxide can be
quite toxic, but this enzyme breaks it down before it can build up to dangerous concentrations.
The reaction is summarized below:
2H2O2 → 2H20 + O2 .
Let us start out by using the “National Center for Biotechnology Information” website to
ascertain the sequence of amino acids in this protein. The URL for the web site is:
http://www.ncbi.nlm.nih.gov/
Go to this site and click Protein (see yellow arrow in figure 1).
Figure 1
5
In the pull down menu (see yellow arrows in figure 2) select protein and in the “search” box type
“Catalase Homo sapiens”. Click on “Search”.
Figure 2
There are many different
versions of this enzyme listed.
Select the first one and click on
the term FASTA (see yellow
arrow in figure 3). It is
pronounced “Fast A”. This will
give you the amino acid
sequence of catalase.
Figure 3
Each letter stands for an amino acid. See the abbreviation code at the end of this activity. Here
are the 527 amino acids in catalase. Considering the effort that it took the early protein
researchers such as Sanger’s, it is amazing that we now have this information at our
fingertips…and for thousands of other proteins as well.
MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIP
ERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTED
GNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHR
HMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFY
IQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKM
LQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALE
HSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYG
SHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKANL
Q-1) What are some of the ways that such information might be useful? Explain
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________
6
B) Comparing Catalase in Different Mammals.
Each protein in the NCBI files has a different code called an “Accession Number”. The
accession number for Homo sapiens catalase is given on the web page. It is NP_001743.1.
Here are the accession numbers for the enzyme catalase in seven different mammals:
Accession Number Description
AAB42378.1 Rat
NP_001030463.1 Cow
NP_033934.2 Mouse
NP_001743.1 Human
NP_999466.2 Pig
NP_001002984.1 Wolf
NP_001124739.1 Orangatan
We are going to compare the amino acid sequences of the catalase in these mammals using a
computer based NCBI alignment tool called “COBALT”.
Go to the following web page: http://www.ncbi.nlm.nih.gov/tools/cobalt/. Type in the
accession numbers for the catalase which was derived from seven different mammals. Be
sure to include the “underscore” _ in all of the animals’ accession numbers except the rat. In
the Job Title box type in “Mammalian Catalase Compared” and then click on the “Align”
Box. (see figure 4)
Figure 4
7
If you scroll down, you will see the amino acid sequences for the seven mammals. It is
given 80 amino acids at a time. Look over these sequences carefully.
Q- 2) Do the sequences seem more “alike” or more “different”? Explain giving examples.
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________
C) Taxonomic Relationship Between The Seven Mammals
Amino Acid Comparison of Catalase in Seven Mammals
Catalase
Comparison
A B C D E F G
Rat Cow Mouse Human Pig Wolf orangutan
1 Rat 0
2 Cow 0
3 Mouse 0
4 Human 0
5 Pig 0
6 Wolf 0
7 Orangutan 0
Indicate the number of amino acids differences in the enzyme “Catalase” between each two
mammals in the chart. There are 21 boxes that need to be filled in. Depending on your class
size you will be asked to fill in a number of the boxes (ie, A2, A3, B3, etc). Your teacher
will share this chart as a google document giving you editing privileges. Once you and your
classmates have finished filling in the chart, be sure to include it in the write up of this
activity.
It may be easier for you to do this by aligning only two organisms at a time using “Cobalt”.
For example, if you are assigned B4, then you might want to just use the accession numbers
for Catalase in the human and cow. Once you get the aligned amino acid sequences of these
two mammals, simply count the number of amino acid differences in the compared
sequences.
Q-3) Construct a “horizontal” phylogenetic tree based on your results showing each of the
seven mammals. Compare yours with your neighbor’s. Draw it below:
Your Phylogenetic Tree
(Pig, Mouse, Rat, Human, Wolf, Orangatan, Cow)
8
Go to the top of the web page and and
click “Phylogenetic Tree” to give you the
evolutionary relationship based on catalase
structure (see red arrow in figure 5).
Figure 5
Q- 4) How does YOUR phylogenetic tree compare with the COBALT generated version?
Explain.
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________
D) Sickle Cell Anemia: The Primary Structure of Proteins and Disease
One of the more dramatic examples of the significance of primary structure involved the
disease sickle cell anemia. This is a disease affecting red blood cells or erythrocytes.
Specifically, there is a problem in the amino acid sequence of hemoglobin (Hb) in those
afflicted with this genetic disease.
Each hemoglobin protein is made of four polypeptides, 2 alpha globin chains and 2 beta
globin chains. The problem is with the beta chains.
The accession numbers for normal human beta globin is AAA16334.1 and the accession
number for sickle cell beta globin is AAN11320.1.
Using the NCBI Cobalt Alignment Tool, determine what the fault is with the sickle beta
globin. It may surprise you to see how one single error can have dire consequences!
Q- 5) Describe the error in the primary sequence of SSA beta globin. Be as specific as
possible.
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________
↑
9
E) The Activation of Pepsinogen into Pepsin
The enzyme pepsin is secreted by the gastric glands in your stomach. It is secreted as
“pepsinogen”, which is an inactive form of the enzyme.
Q-6) Why is it beneficial to secrete this enzyme in the inactive form? Explain.
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________ The accession numbers for pepsinogen and pepsin are “3PSG_A” and “5PEP_A”
respectively.
Using the NCBI Cobalt Alignment Tool, determine the difference between these two forms
of the enzyme (inactive and active). Before to type the “underscore” in the accession
numbers. (“3PSG_A” and “5PEP_A”)
Q-7) Explain how pepsinogen and pepsin are different. Explain what is meant by post-
translational modification and explain how it is relevant in the case of pepsinogen and
pepsin. ____________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________
Here are 3 dimensional representations of the two enzymes. Such images are really the
subject of the next few activities on the secondary, tertiary and quaternary structure of
proteins. The primary sequence of the inactive and active form of the enzyme, along with
these images will serve as a good bridge to the forthcoming activities. (see figure 6)
Pepsinogen (inactive enzyme) Pepsin (active enzyme)
Figure 6
10
Q-8) Summarize what you have learned about the primary structure of proteins.
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________
_________________________________________________________________________
Further Investigations
1) Choose a group of organisms from a taxonomic clade that you are interested in
investigating. Choose a protein that is found in all of the organisms in that clade (there
are many candidates: ie, enzymes in the glycolysis family) and use the alignment tool,
followed by the “Phylogenetic Tree” option to create an evolutionary tree of the clade
that you are investigating.
2) Investigate the relationship between catalase and the organelle called a “peroxisome”.
References
1) Wikipedia article on Sickle Cell Anemia: http://en.wikipedia.org/wiki/Sickle-cell_disease
2) Nobel Prize Website on Frederick Sanger:
http://www.nobelprize.org/nobel_prizes/chemistry/laureates/1958/sanger-bio.html
Appendix: Amino Acid Abbreviations
1) Alanine Ala A
2) Arginine Arg R
3) Asparagine Asn N
4) Aspartic Acid Asp D
5) Cysteine Cys C
6) Glutamine Gln Q
7) Glutamic Acid Glu E
8) Glycine Gly G
9) Histidine His H
10) Isoleucine Ile I
11) Leucine Leu L
12) Lysine Lys K
13) Methionine Met M
14) Phenylalanine Phe F
15) Proline Pro P
16) Serine Ser S
17) Threonine Thr T
18) Tryptophan Trp W
19) Tyrosine Tyr Y
20) Valine Val V
11
The Secondary Structure of Proteins Goals:
To learn how to use computer modeling to examine the secondary structure of proteins.
To examine the intricate structure of the peptide bond and the nuanced relationship to
protein folding.
To consider the factors that both prevent and cause polypeptides to bend.
Background:
In 1951 Linus Pauling and Robert Corey worked out the two models for the initial folding of a
polypeptide. The two conformations were named the alpha helix and the beta pleated sheet.
Christen Brownlee writes in “Classics of the Scientific Literature: The Protein Papers
(http://www.pnas.org/site/misc/classics1.shtml), “Grasping the structure of these molecules
would give scientists a head start on understanding how proteins function in the body. Pauling
and Corey's research, now over a half-century old, guides today's biotechnology revolution and
the search for hundreds of disease cures--drugs that may someday conquer Alzheimer's disease,
cystic fibrosis, Mad Cow disease, and many forms of cancer.” Indeed their findings have had so
much impact on our understanding of proteins.
We are going to use data from experiments on protein structure as well as computer modeling to
get a handle on Pauling and Corey’s models that show different secondary structures in
polypeptides.
Procedure:
A) Consequences of the “peptide bond” joining amino acids. As discussed in the activity on the
“Primary Structure of Proteins”, polypeptides are made by joining together a “string” of
amino acids. The diagram to
the right (Figure 1) show the
dehydration reaction by
which two amino acids are
joined together to form a
dipeptide made of two amino
acid residues and a water
molecule. Note the box
showing the C-N peptide
bond. It is interesting to note
that most carbon-nitrogen
single bonds measure 1.49 Ȧ.
Most C-N double bonds
measure 1.27 A. The peptide
bond measures 1.32 A.
Figure 1-Forming a Dipeptide
11
Q-1) Based on that information alone, how would you characterize a peptide bond: single or
double. Explain.
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
What actually happens is a resonance stabilization reaction in which the peptide bond
“swings” back and forth between double and single. The same is true for the bond connecting
the carbonyl carbon and carbonyl oxygen. (See figure 2). This results in the carbonyl oxygen
being slightly negative and the amino hydrogen of the next amino acid residue is slightly
positive.
Figure 2
Q-2) How might the slightly negatively charged carbonyl oxygen interact with the slightly
positively charged amino hydrogen of two amino acids that are some distance from each other
on a polypeptide chain? Explain.
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
Q-3) Based on your knowledge of organic (carbon) chemistry, what can be said about the
rotation on both sides of a single bond? Double bond? If the peptide bond has “double bond”
properties, what can be said about rotation on both sides of a peptide bond? Explain.
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
11
Examine figure 3 which shows four amino acids peptide bonded together. The double bond
nature of the peptide bond may “discourage” rotation on either side of the peptide bond, but it
does NOT preclude rotation on both sides of the alpha carbon (α carbon) in each amino acid
residue.
Figure 3
Q-4) Examining the tetrapeptide above, note that starting with the amino nitrogen, it goes (left
to right) N-C-C-N-C-C-N-C-C and so on. To be more precise, its amino nitrogen, α carbon,
carbonyl carbon, amino nigrogen, α carbon, carbonyl carbon and so on. Where is the molecule
free to rotate? Be specific and explain.
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
Consider the “R-Groups). Although some are small-such as glycine and alanine who’s R-
groups are H and CH3 respectively, some of the R-groups are larger and a bit “clunky”. So, as
we look into the folding of a protein, we need to consider: 1) where the polypeptide can twist
or fold; 2) where it cannot do so; 3) what to do with these “clunky” R-groups; and 4) what
factors will cause the polypeptide to fold.
B) Using Jmol to Investigate the Alpha Helix. We are now going to investigate the secondary
structure of an enzyme called carboxypeptidase. In exercise # 4 we will revisit
carboxypeptidase as we investigate how this enzyme can bind to its substrate and catalyze
a reaction.
But, our emphasis here will be to investigate the alpha helical and then the beta pleated
sheet regions of this enzyme. To do so, we will use the computer program called Jmol.
11
There are three ways that we will manipulate and measure our model using the Jmol
program:
1. Type directions onto the Jmol Script Console in the window to the left. All jmol
instructions that you need to type on the Jmol Script Console will be in bold and
within quotation marks. Type in the instructons just after the $ sign. Leave out
the quotation marks when you type your directions on the Jmol Script Console. It
is important to apply the correct syntax in doing so.
2. With the cursor on the screen, left click and choose various items in the menu or
submenus. Each step will be followed with a “>” sign and will be in bold. For
example, style>scheme>ball and stick.
3. Use the menus, submenus and shortcuts in the toolbar.
Some of the instructions are cumbersome to type out and so for those we will use the
script editor. In such cases, you will find it easiest to copy and paste instructions from this
document onto the script editor box and then select “run” to enact the instructions.
Open your Jmol program and drag the Enzyme/Substrate (5CPA PDB) file onto the blackened
screen. A version of the protein will appear on the screen. (see Figure 4)
This protein is made of 307
amino acid residues. The
image shows many
surrounding water
molecules (the red dots)
and the single polypeptide,
some of which is in the
“cartoon” scheme (the pink
and orange regions) and
some of it is in the “trace”
scheme (the white regions).
First we are specifically
interested in investigating
the pink regions. Move the
cursor across the image. Figure 4
Note that you can rotate the image in different directions.
Q- 5) How would you describe the pink regions of this molecule?
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
11
If you move the cursor onto the image, information about the amino
acid that your cursor is sitting above. We are going to isolate one
spiral region of the protein, specifically that α helical region
encompassed by amino acids 14-27.
Type “Display 14-27” and press Enter.
Enlarge the α helix by typing “zoom 150” and pressing Enter. Drag
the cursor across the molecule such that it is turned in an “upright”
position. Then press both ctrl and alt to move the helix into the center
of the screen. See figure 5.
Figure 5
Convert the molecule to the
“ball and sticks” format by
right clicking and choosing
style>scheme>Ball and Stick.
See figure 6.
As we continue to analyze the
alpha helix, it would be helpful
if everyone conducting this
activity positioned the helix in
the same way. Recall that
biochemists number the amino
acid residues in a polypeptide
in order, going from the N-
terminus to the C-terminus.
Place the cursor on one of the Figure 6
atoms at the bottom of the screen. We want the lower numbered N terminus (residue 14) to be at
the bottom of the screen. If “[Thr]14…” appears, then you are ok. But if “[Ala]27…” appears,
then the molecules is upside down and you need to reposition it. See figure 7 showing the right
position. Your molecule may look a bit different if it is twisted more than the way it is shown in
figure 7.
In order to see the position of the hydrogen bonds, type “Select 14-27” and press Enter. Then
type “Calculate hbonds” and press Enter.
11
Ok, it is time to begin analyzing this structure.
Note the hydrogen bonds.
Q-6) Which atoms (element name) are joined
by the hydrogen bonds. In identifying the
elements, be as specific as possible. Keep in
mind that hydrogens are not shown, so an h-
bond going toward an amino nitrogen is
actually connected to the hydrogen not shown.
(Red=oxygen, gray=carbon, blue=nitrogen)
____________________________________
____________________________________
____________________________________
____________________________________
Note the number of the amino acid residues
joined by the h-bonds. To do so, move the
cursor onto the oxygen or amino nitrogen and
note the number of the residue. You need to
be a bit careful in doing so because the dotted
red/blue line representing the h-bond my go
behind some of the atoms that you are
observing leading you to name the wrong
residue. Be sure that you can see the entire
h-bond. Figure 7
Q-7) What is the difference in residue numbers of the h-bonded amino acid residues?
_____________________________________________________________________________
Q-8) What role do these h-bonds play in maintaining the α-helical structure? Explain.
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
Type “select sidechains” and press Enter. Type “Color green” and press Enter. See figure 8.
This molecule is called the α helix. The designation “α” is simply due to the fact that Pauling and
Corey discovered it first, hence “α” for first and then later they discovered the β conformation,
hence “β” for second. But let us see why they called the “α helix” a helix. So to do this, let’s
examine the backbone of the molecule, ignoring the green side chains which we will discuss
shortly.
11
The backbone of the molecule is made of nitrogens
and carbons. Starting with amino acid residue 14 at
or near the bottom of your figure, follow the
backbone. You will need to drag the molecule to the
left or right each time an atom in the backbone is
obscured. Note the backbone goes….N-C-C-N-C-C-
N-C-C….and so on. Although you might feel like
you are zig zagging a bit, if you follow the backbone
you will see that it is like going up a spiral staircase,
a staircase the goes up in a counter-clockwise
direction.
To view the molecule from all directions, type
“move 0 360 0 0 0 0 0 0 10” and press Enter. The
molecule will turn 360 degrees in 10 seconds. (Some
of the zeroes in this instruction hold the place of
instructions that can be used to move the molecule in
other ways including rotating the molecule along the
Y or Z axis.) You can repeat these instructions if
desired.
Now drag the bottom of the molecule up so that it
rotates in a way such that the center of the helix is
facing you. You may have to press ctrl and alt and Figure 8
re-center the image.
Q-9) Where are the (green) R-groups located. Considering their “clunkiness”, why would this
positioning make sense? Explain.
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
(Bonus) : Try to figure out about how many amino acids residues there
are per turn of the helix. This is a bit difficult, because you will need to
reposition the molecule somewhat as you go up the backbone. It is NOT a
whole number as some suspected when the model was first described. See
how close you can come. Once you have the number (again, it will not be
a whole number, so you will have to make an estimate), check with your
instructor. Here is another bit of advice. Get the sidechains out of your
way by typing “select 14-27” and press Enter and then type “restrict
backbone” and press Enter. This will remove everything except what
you restricted….in this case the backbone of the helix. See figure 9.
Figure 9
11
Here is another trick you may try. Starting with residue
14, color each residue differently…you need not go too
far with this, but try coloring residues 14-20 differently.
Just type “Select 14” and press Enter and then type
“color tan” and press Enter. Repeat with each residue
up to 20 using a different color each time.
Then type “Select oxygen” and press Enter. Type
“color red” and press Enter. Type “Select nitrogen”
and press Enter. Type “color blue” and press Enter.
So now the α carbon and carbonyl carbon for each
residue in the backbone has different color carbons, but
the blue nitrogen and red carbonyl oxygen serve as
markers so that you can see when you have completed
one turn of the helix. How many residues per turn of
the helix? Check your results with your instructor. See
figure 10. END OF BONUS
Measuring the length of the polypeptide in the α-helix: Figure 10
Left click the “ruler” image in the toolbar above at the
top of the display window. See figure 11. Move the cursor above the carbonyl oxygens until you
find the oxygen in residue 19. Left click while the cursor is over that oxygen. Then, move the
cursor over the
carbonyl oxygen in
residue 23 and left
click. A dotted line
will be shown
connecting those
oxygens and the Figure 11
distance between them will be measured. Record that distance between these 5 amino acids. You
will carry out a similar measurement when examining the β-conformation for comparison
purposes later in this activity.
Q-10) Summarize what you have learned about the structure of the α-helix being as complete and
specific as possible. There are a lot of good answers one could give….make it super.
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
11
C. Using Jmol to Investigate the Beta Conformation (Pleated Sheat)
Drag the Enzyme/Substrate (5CPA PDB) file onto the screen. If the image from part B of this
activity is still on the screen, the 5CPA PDB file will replace it. This time we are not interested
in the pink α-helical regions of the molecule, but rather
the yellowish orange β-pleated sheet (or β-conformation).
It is referred to as “β”…the second letter in the Greek
alphabet…because it’s structure was worked out second
by Pauling and Corey. We will only display a part of the
molecule which shows this structure.
Rotate the molecule by dragging the cursor across it in
such a way that maximizes the view of regions of the
polypeptide in the β-conformation. Now we are going to
remove from view much of the polypeptide which is
NOT in the β-conformation.
Type “Display 32-36, 49-53” and press Enter. The
cartoon display of a region of the polypeptide is shown.
The arrows indicate the direction of the chains going
from the N-terminus toward the C-terminus. Type “zoom
200” to increase it’s size 200%.
Press Ctrl and Alt while you drag the molecule to the
center of the window. See figure 12.
Figure 12
Q-11) What does it mean that these two
sections of the polypeptide are
antiparallel? Explain.
________________________________
________________________________
________________________________
________________________________
Now, to better visualize the details of the
structure will put this region of the
polypeptide in the “Ball and Stick”
scheme. Convert the molecule to the “ball
and sticks” format by typing “Select 32-
36, 49-53” and pressing Enter and then
right clicking and choosing
style>scheme>Ball and Stick. See Figure 13
Figure 13.
11
In order to see the position of the hydrogen bonds,
type “Calculate hbonds” and press Enter.
In order to highlight the sidechains so that they can
be seen as distinct from the backbone of the chains,
type “select sidechains” and press Enter. Type
“color green” and press Enter. See figure 14.
Viewing this structure from different angles will
give us insights about it’ structure. The two sections
of the polypeptide go from residues 32 to 36 and
from residues 49-53.
Q-12) What joins the two sections of the
polypeptide? More specifically, note what atoms are
connected. Where a nitrogen is involved, it is
actually the hydrogen attached to the nitrogen (not
shown), that is involved in the bonds. Note the
alternating nature of the bonds; going from nitrogen Figure 14
of one section to the oxygen of the other section and the next bond going from the oxygen of one
section to the nitrogen of the other section.
________________________________________
Turn the molecule such that the backbones of the
two sections of the polypeptide are as aligned as
possible. To facilitate view this, one section of the
polypeptide will be removed from view. Type
“display 49-53” and press Enter. See figure 15.
Q-13) In what directions are the green sidechains
pointing?
________________________________________
Using the same procedure that you used when
investigating the length of part of a polypeptide Figure 15
chain in the α-helix, measure the distance between
5 amino acids, specifically the carbonyl oxygens in residues 49-53.
11
Q-14) Summarize what you have learned about the structure of the β-conformation being as
complete and specific as possible. There are a lot of good answers one could give….again, make
it super.
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
Q-15) Make a comparison between the α-helix and the β-conformation. Consider the following:
Characteristic α-helix β-conformation General Shape
Position of the H bonds
Position of the R-groups
Length of Section of
Polypeptide Per 5 Amino Acid
Residues
Other Features
11
Further Investigations
1) Determine what percentage of the protein which is in the α-helix and what percentage is
in the β-conformation.
2) What factors determine whether or not a section of a polypeptide is in the α-helix or in
the β-conformation.
References
1) PNAS at 100: Classics of Scientific Literature. The Protein Papers by Christen Brownlee.
http://www.pnas.org/site/misc/classics1.shtml
11
The Tertiary and Quaternary Structure of Proteins
Goals:
To examine the factors that cause a protein to fold into its three dimensional tertiary
structure
For those proteins constructed of more than one polypeptide, to examine how those
polypeptides are joined together to make a functional protein
Background:
In 1962 John Kendrew and Max Perutz were awarded Nobel Prizes for their work on the
structure of proteins. Using X-ray analysis, they were able to work out the three dimensional
tertiary structure of the proteins myoglobin and hemoglobin. In our prior activity we examined
the factors which cause the initial folding of a polypeptide into either an alpha helix or a beta
conformation. The next level of folding is described as the tertiary structure of the protein. We
will consider four factors that cause this level of folding: 1)Hydrophobic and hydrophilic
interactions; 2)Disulfide bonds between cysteines; 3)Ionic interactions between fully charged
amino acids; and 4)Hydrogen Bonds. We will then briefly examine the quaternary structure of
hemoglobin.
Procedure:
A) Hydrophobic and Hydrophilic Interactions
Assume for a moment that hydrophobic and hydrophilic interactions between amino acids and
their surrounding (both internal and external to the rest of the protein) were the only factors that
affect protein folding:
Q-1) How would the way the protein folds be different if it were moved from a watery (polar)
environment to an oily (nonpolar) environment (or in the opposite direction)? Explain.
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
We are going to use the program Jmol to analyze several different proteins as we try to
understand the basis of protein folding. The box below has some general instructions for using
this powerful program and there is further information in the appendix at the end of the book
which may be helpful.
11
There are three ways that we will manipulate and measure our model using the Jmol
program:
1. Type directions onto the Jmol Script Console in the window to the left. All jmol
instructions that you need to type on the Jmol Script Console will be in bold and
within quotation marks. Type in the instructons just after the $ sign. Leave out
the quotation marks when you type your directions on the Jmol Script Console. It
is important to apply the correct syntax in doing so.
2. mWith the cursor on the screen, left click and choose various items in the menu or
submenus. Each step will be followed with a “>” sign and will be in bold. For
example, style>scheme>ball and stick.
3. Use the menus, submenus and shortcuts in the toolbar.
Some of the instructions are cumbersome to type out and so for those we will use the
script editor. In such cases, you will find it easiest to copy and paste instructions from this
document onto the script editor box and then select “run” to enact the instructions.
Open your Jmol program and drag the Enzyme pepsin (5PEP PDB) file onto the blackened
screen. A version of the protein will appear on the screen.
In the Jmol script console, type “cpk” and press Enter. Type “zoom 90” and press Enter. Type
“hide hoh” and press Enter. The image of pepsin now fits the screen and is in a space filling
scheme.
Type “select hydrophobic” and press Enter.
Type “color green” and press Enter. Type
“select polar” and press Enter. Type “color
yellow” and press Enter. See figure 1.
Pepsin does its work in the watery, acidic
solution of your stomach.
Q-2) Does pepsin sit in a polar or nonpolar
solution when it is in your stomach? Explain.
____________________________________
____________________________________ Figure 1
______________________________________________________________________________
______________________________________________________________________________
11
Q-3) Would you expect most of the amino acids facing the outside to be; hydrophobic (nonpolar-
green) or hydrophilic (polar or charged-yellow)? Does the diagram support your hypothesis?
Explain. Consider the following information when you answer this question. Although only 45%
of the atoms are associated with polar residues, it appears that over 50% of the visible residues
are yellow.
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
Q-4) How would the answer to Q-3 change if this protein were sitting in a nonpolar
environment? Explain.
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
The protein potassium channel is just such a protein. It traverses the plasma membrane. Most of
the protein channel is embedded in the nonpolar region of the lipid bilayer.
Q-5) Given that information, where would you expect the hydrophobic (nonpolar) or hydrophilic
(polar or charged) residues to be located? Explain.
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
Drag the potassium channel (1BL8 PDB) file onto the blackened Jmol screen. A version of the
protein will appear on the screen.
In the Jmol script console, type “cpk”
and press Enter. Type “zoom 90” and
press Enter. The image of potassium
now fits the screen and is in a space
filling scheme. It is a teepee shaped
protein complex. Turn the channel such
that the narrow end is facing you the
observer. You should be able to see
straight into the channel and the purple
potassium ions should be visible.
Type “select hydrophobic” and press
Enter. Type “color green” and press Enter. Figure 2
Type “select polar” and press Enter. Type
“color yellow” and press Enter. See figure 2.
11
Unlike the last protein, pepsin which sat in a polar environment, this one is sitting in a mostly
nonpolar environment, although, each end of the protein is facing either the watery inside of the
cell or the watery outside of the cell.
Q-6) Is this coloration consistent with your expectations? Explain why or why not. Also, to see a
“slice” of the protein right down the middle, type “slab on” and press Enter and type “slab 50”
and press Enter. Are the colors what you predict in the middle of such a molecule? Explain.
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
Q-7) Summarize what you have learned about hydrophobic and hydrophilic intereactions and
how they vary with the environment that the protein is sitting in.
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
B) Covalent Disulfide Bonds Between Cysteines
Drag the enzyme amylase (1PPI PDB) file onto the blackened Jmol screen. A version of the
protein will appear on the screen.
Type “hide hoh” and press Enter.
That instruction will hide the water
molecules. To convert them to a
ball and stick format, right click
and then choose
style>scheme>ball and stick (see
figure 3).
Figure 3
Type “select sulfur” and press
Enter. Type “cpk 200” and press Enter. Type “ssbonds on” and press Enter. Type ssbonds
100 and press Enter.
This series of events selects sulfur atoms, enlarges them, turns on the disulfide bonds and
thickens them so they are easily visualized.
11
Out of the many amino acid residues in amylase, only 12 are cysteines. Let us determine how
many of them are involved in forming disulfide bonds. Type “display [cys]” and press Enter.
Only those 12 cysteines are displayed and all of the other amino acid residues are hidden.
Q-8) How many of those 12 form disulfide bonds. You may need to rotate the molecule by
dragging the cursor across the screen in order to answer this question.
___________________________________________________________________________
There are 496 amino acid residues in this particular amylase derived from wild pig. Five pair of
cysteine residues are linked by disulfide bonds. Move the cursor onto each sulfur and record the
number of the residue within the polypeptide chain.
Cys _____linked to Cys_____
Cys _____linked to Cys_____
Cys _____linked to Cys_____
Cys _____linked to Cys_____
Cys _____linked to Cys_____
Q-9) Which linkages likely result in the sharpest folds in the polypeptide? Which linkages are
between cysteines that are most distant?
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
In order to visualize the relatively sharp turn
caused by the linkage of cysteine 378 and 384
we will look at a few amino acid residues
before, between and after those two cysteines.
Type “display 370-390” and press Enter. Then
type “select 370-377, 379-383, 385-390” and
press Enter. Right click and then choose
style>scheme>trace. Then type “color green”
and press Enter. See figure 4. Type “zoom 250”
and move the model to the center by pressing
Ctrl and Alt and dragging the model to the center. Figure 4
Disulfide bonds between nearby and distant amino acid residues play an important role in protein
folding. Let us now look at another factor which plays a role in folding.
11
C) Ionic Bonds Between Oppositely Charged R-Groups
Q-10) Which amino acids have positively charged R-groups? Negatively charged R-groups?
___________________________________________________________________________
___________________________________________________________________________
Q-11) What type of bond forms between fully charged atoms? _________________________
We are going to examine the role of this type of interaction between amino acid residues in
determining the 3-dimensional shape of a polypeptide. These bonds may form between
oppositely charged R-groups that are some distance from each other on the polypeptide chain.
Drag the enzyme amylase (1PPI PDB) file onto the blackened Jmol screen. A version of the
protein will appear on the screen. Type “hide hoh” and press Enter.
Type “display 294-306, 15-64, 197-243” and press Enter. With the cursor on the screen,
right click Style>Scheme>Trace. Type “select all” and press Enter. Type “color green” and
press Enter.
The following pairs of amino acid residues contain oppositely charged R-groups that are close
enough together to form bonds even though they are somewhat distant on the polypeptide
chain: 18 and 61; 200 and 240; 297 and 303. This chart summarizes the properties of those
amino acids. There are many other charged amino acid residues in amylase…we are just
examining a few examples here.
Amino Acid
Amino Acid Number
Charged Group
Atom (Number)
Involved in
IonicBond
Glutamate 18 -COO-
144
Arginine 61 =NH2 +
500
Lysine 200 - NH3 +
1562
Glutamate 240 -COO- 1884
Aspartate 297 -COO- 2343
Arginine 303 =NH2 +
2396
Type “select 18, 61, 200, 240, 297, 303” and press Enter. With the cursor on the screen,
right click Style>Scheme>Ball and Stick.
To show the ionic bonds that form…
Type “select atomno=144, atomno=500 and press Enter. Type “connect single” and press
Enter. Type “color yellow” and press Enter.
Type “select atomno=1562, atomno=1884 and press Enter. Type “connect single” and
press Enter. Type “color yellow” and press Enter.
Type “select atomno=2343, atomno=2396 and press Enter. Type “connect single” and
press Enter. Type “color yellow” and press Enter.
11
Note how the ionic bonds are yet another
factor causing the polypeptide to fold.
There are many other ionic interactions in
this molecule. Rotate the part of the
molecule visible on the screen so that you
can see the ionically bonded amino acid
residues and the folds in the adjacent
polypeptide regions. See figure figure 5.
Figure 5
D) Hydrogen Bonds Between Slightly Oppositely Charged R-Groups, Amino Acyl Groups
and Carbonyl Oxygens
We examined the role of hydrogen bonds in determining the secondary structure of a
polypeptide. Hydrogen bonds also play a role in tertiary structure. Though weak, they are
numerous and thus significant factors in causing a polypeptide to fold.
Drag the enzyme amylase (1PPI PDB) file onto the blackened Jmol screen. A version of
the protein will appear on the screen. Type “hide hoh” and press Enter.
Type “display 342-346, 355-370, 381-383” and press Enter. With the cursor on the
screen, right click Style>Scheme>Ball and Sticks. In order to visualize the H-bonds,
type “calculate Hbonds” and press
Enter. Type “color hbonds
yellow” and press Enter. Type
”select sidechains” and press
Enter. Type “color green” and
press Enter.
At this point you can see the
selected amino acids with their
sidechains in green and the back
bone in gray (carbon), blue
(nitrogen) and red (oxygen). Note
the yellow hydrogen bonds
between several of the nitrogens Figure 6
and oxygens. See figure 6.
ii
Q-12) How many h-bonds can you find (you may need to rotate the molecule a bit to see
some of them) in this region of the protein? ___________________Which 2 h-bonded
amino acid residues are closest to each other along the chain? ____ and ____. Which 2 h-
bonded amino acid residues are furthest from each other along the chain? ____ and ____.
Which of the highlighted hbonds contribute to secondary structure? ________________
Tertiary structure? _________________
11
************************************************************
One of the biggest challenges in biochemistry is to develop a way of predicting tertiary
structure of a protein, who’s primary structure is known. Based on what you have learned
about primary, secondary and tertiary structure, why would making such a prediction be
so difficult…even with the use of the most sophisticated computer programs?
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
E) The Quaternary Structure of Proteins: Hemaglobin
Many proteins are composed of a single polypeptide chain. For those proteins, analyzing
the primary, secondary and tertiary structure is adequate when fully elucidating its three
dimensional structure.
For other proteins made of more than one polypeptide chain, a fourth level of structure
must be investigated. Hemaglobin is such a protein. Hemaglobin transports oxygen in our
blood, specifically in our red blood cells or erythrocytes. It is made of four polypeptide
chains, 2 alpha globins and 2 beta globins. Earlier in this activity we compared the
sequences of normal and sickle cell beta globin.
All of the factors which affect the tertiary structure of a protein, may also affect the
quaternary structure. Now we are going to take a brief look at hemoglobin.
Drag the hemaglobin (1A3N PDB) file onto the blackened screen. A version of the protein
will appear on the screen. Type “hide hoh” and press Enter.
Convert the molecule into a “ball and sticks” format by typing “select all” and pressing
Enter. With the cursor on the screen, right click Style>Scheme>Ball and Sticks.
In order to better visualize the distinct polypeptide chains, type “select *A” and press
Enter. Then type “color green” and press Enter. Repeat for the other chains, B, C, and D
coloring them yellow, magenta and orange respectively.
Each of the four polypeptides has a “heme” ligand attached to it. To highlight the ligands,
type “select [hem]” and press Enter. Then, type “color white” and press Enter.
11
The heme ligands are all attached to histines. To highlight this, type “select [his]87:A,
[his]92:B, [his]87:C, [his]92:D” and press Enter. See Figure 7 below.
Figure 7
Further Investigations
1) Choose a protein that you are curious about. Do a google search of its functions. Then
find its primary structure (FASTA sequence) and then find a PDB file of that protein.
Examine it fully looking at how much of its structure is in the alpha helix, beta pleated
sheet and what factors are causing it to fold. Look at which regions are hydrophobic and
hydrophilic, where are there charged amino acids or cysteines. Locate disulfide
linkages….in other words, do a full study of your protein’s structure and function.
References
1) Biography: John Cowdery Kendrew
http://www.nobelprize.org/nobel_prizes/chemistry/laureates/1962/kendrew.html
2) Biography: Max Perutz
http://www.nobelprize.org/nobel_prizes/chemistry/laureates/1962/perutz
11
Carboxypeptidase A-An Example of Substrate Binding and
Catalysis
Learning About Proteins Through Computer Modeling
Goals:
To learn how computer modeling can help us understand how an enzyme binds to it’s
substrate.
To learn about the mechanisms of catalysis according to the induced fit model of enzyme
action.
Background:
Enzymes are remarkable! They speed up chemical reactions, sometimes up to 10 billion times
faster than if the enzyme were absent. Ezymes commonly react with about 10,000 substrates per
second and that number may go up to 500,000 in some cases. Today we will use the program
Jmol to get some insights on how enzymes bind to their substrates and then catalyze a reaction.
The enzyme that we are studying today is carboxypeptidase, a pancreatic exopeptidase that
removes amino acids, one at a time, from the C-terminus of a polypeptide. The carboxypeptidase
A that we are studying today is a digestive enzyme, normally secreted in an inactive form and
then activated once inside the intestines. Carboxypeptidases act in other ways. For example,
many proteins, such as insulin are modified by the removal of amino acids after they are initially
translated. This is referred to as post translational modification and may be carried out by a type
of carboxypeptidase.
Considering this brief introduction to enzyme action, you are now ready to employ
computational techniques to explore a protein.
Q-1) Based on that background information, what questions do YOU have about enzyme
action?
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
___________________________________________________________________________
The questions that you will answer are: How do enzymes selectively bind to substrates and
how do they perform their catalytic role in cells?
11
Procedure: In this activity you will be using computer modeling of proteins to learn about
enzyme action. To do so, you will use the Jmol Program.
There are three ways that we will manipulate and measure our model using the Jmol
program:
1. Type directions onto the Jmol Script Console in the window to the left. All jmol
instructions that you need to type on the Jmol Script Console will be in bold and
within quotation marks. Type in the instructons just after the $ sign. Leave out
the quotation marks when you type your directions on the Jmol Script Console. It
is important to apply the correct syntax in doing so.
2. With the cursor on the screen, left click and choose various items in the menu or
submenus. Each step will be followed with a “>” sign and will be in bold. For
example, style>scheme>ball and stick.
3. Use the menus, submenus and shortcuts in the toolbar.
Some of the instructions are cumbersome to type out and so for those we will use the
script editor. In such cases, you will find it easiest to copy and paste instructions from this
document onto the script editor box and then select “run” to enact the instructions.
A) Open your Jmol program and drag the Enzyme/Substrate (3CPA PDB) file onto the
blackened screen. A “cartoon” version of the enzyme will appear on the screen. Convert
it to a ball and stick
version by moving the
cursor onto the screen,
right click, and then
choosing
style>scheme>ball and
stick. See figure 1.We
want to discover how this
molecule works by
manipulating the model.
You will see that this
program is a powerful
tool for studying
proteins. Figure 1
B) Start out by moving your cursor onto the black display screen. Note that you can rotate
the molecule in different directions by dragging different parts of it. This diagram is quite
overwhelming, so we need to manipulate it in ways which will be instructive.
11
Q-2) Based on what you know about enzymes, what part of the molecule would you like
to focus on? Explain
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
This particular PDB file also includes an artificial substrate, a dipeptide made of glycine
at the N-terminus peptide bonded to a tyrosine at the C-terminus. It is sitting in the active
site.
Q-3) Know that the substrate is sitting in the active site, theoretically, how might you use
the Jmol program to locate the active site? (Hint: Historically, scientists have used dyes
and radioactive substances to do essentially the same thing.) Explain.
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
C) OK, so let us use the program to find the substrate…and therefore the active site. The
substrate of made of two amino acids which are residues 501 and 502. Type “select 501,
502”. Now press “Enter” or “Return”. Then type “color green” and then press “Enter”.
Type “cpk 250” and press “Enter”. See figure 2A.
Q-4) Can you tell where the substrate is? Can you tell where the active site is? Explain.
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
Using your cursor, drag across the screen to rotate the protein in different directions.
Note, that there are times when the substrate is totally visible and there are times when it
is partially or almost completely blocked by other amino acid residues in the
carboxypeptidase A. See Figure 2A-C.
Figure 2 A B C
11
Q-5) How does such manipulation allow you to learn where the opening to the active site
is? Explain.
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
If you move the cursor to amino acids around the substrate, the name of those amino acid
residues and the position of them in the polypeptide chain will appear. Our concern is
with the amino acids that play a role in binding (residues ) and those that play a role in
the catalytic event (residues and Zinc). Accordingly, we will display those amino acids,
the substrate (501 and 502), Zn and hide the rest of the amino acid residues.
Type“Display[Tyr]248,[Glu]270,[Tyr]198,[Phe]279,[Arg]145,[His]69,[Glu]72,
[His]196, [Arg]71,501, 502,Zn”. Now press “Enter” or “return”. (Note: you could copy
and paste the instructions above or you could just type the residue numbers without the
names.)
D) The 9 amino acids of the active site (remember, there are a total of 307 amino acids in the
enzyme) and substrate are now the only visible part of the structure. The hydropobic side
chain of the tyrosine residue
of the substrate fits into a
similarly hydrophobic
(nonpolar) pocket in the
enzyme, but that is not
shown here. You can rotate
this structure in different
directions by “dragging” it
up or down or back and
forth sideways. You can
also enlarge it any
percentage.
Figure 3
Type “zoom 150” to enlarge it 150%. Center the molecule by holding down ctrl and alt
and dragging the molecule to the center of the screen. See figure 3.
11
E) In the next part of the activity we are going to make changes in the appearance of the
active site and either color various structures or label them to allow for easy reference.
First we are going to change
the scheme of the amino
acids comprising the active
site.
Type“select[Tyr]248,[Glu]
270,[Tyr]198,[Phe]279,
[Arg]145,[His]69,[Glu]72,
[His]196, [Arg]” and press
Enter. Then, with the cursor
on the screen, right click
Style>Scheme>Wireframe (see figure 4). Figure 4
Type “Select 501, 502” and press Enter. Then with the cursor on the screen, right click
Style>Scheme>Ball and Stick.
Then type “Select Zn” and press Enter. Type “Color green” and press Enter. Type
“cpk 150” and press Enter.
At this point, the amino acids in the active site are in the wire frame scheme, the
dipeptide substrate is in the ball and stick scheme and the Zn is colored green. (See figure
5).
We need to make some other features
easily identifiable.
First we will color the two atoms
directly involved in the peptide bond
within the substrate. Remember, that
this bond is severed during the
hydrolytic reaction catalyzed by this
enzyme.
Figure 5
Type “Select [GLY]501:A.C #2441” and press Enter. Then type “Color orange” and
press Enter. Type “select [TYR]502:A.N #2443” and press Enter. Then type “Color
white” and press Enter.
Finally, in order to make it easier to refer to the different residues, we are going to name
each one. To do this, first go to the File Menu and open the Script Editor.
11
“Cut and paste” or “Type” the following into the “Script Editor” and then select
“Run” in the script editor window. (Each of the atoms named is the alpha carbon in the
amino acid residue. %n=name of the residue and %r= residue number in the polyeptide)
select atomno=1958
label %n%r
select atomno=2137
label %n%r
select atomno=1160
label %n%r
select atomno=1552
label %n%r
select atomno=578
label %n%r
select atomno=551
label %n%r
select atomno=1568
label%n%r
select atomno=2211
label%n%r
select atomno=568
label%n%r Figure 6
As stated in the introduction, carboxypeptidase A “chops off” the terminal amino acid at
the C-terminus of a polypeptide or even a dipeptide such as the one in this active site. We
are now going to carefully dissect the image before us by answering a series of questions.
For some of the questions, hints will be given for answering the question.
First let’s look at the substrate, a dipeptide.
The Substrate
F) We are now going to use our model to learn about the substrate: glycyltyrosine.
Q-6) What are the two amino acids which make up the dipeptide? (Hint: move the cursor
of one of the atoms in the dipeptide and the amino acid residue will be named with a
three letter abbreviation.)
___________________________ _____________________________
Q-7) Which amino acid is at the N-terminus? ___________________________
C-terminus? ___________________________
11
Q-8) What does the orange atom represent? (Be as specific as possible.)
__________________________________________________________
What does the white atom represent? (Be as specific as possible.)
__________________________________________________________
Q-9) When this substrate is hydrolyzed, what molecule NOT SHOWN in the image is
involved in the reaction? Answer this question by completing the following sentence:
Glycyltyrosine + ? → Gycine + Tyrosine ?=_______________________
Q-10) What charge is associated with:
the carbonyl oxygen of the peptide bond? _________________________
the NH hydrogen of the peptide bond? _________________________
the zinc ion? _________________________
the carboxyl group of the substrate? _________________________
the amino group of the substrate? _________________________
the amino group in the sidechain of Arginine 145?_____________________
the carboxyl group of glu 270? _________________________
the OH group in the sidechain of tyrosine 248? _______________________
The Active Site: Binding to the Substrate
G) When an enzyme and substrate come together there must be both a “spactial fit” and a
“bonding fit”. There are several sites where the enzyme carboxypeptidase bonds to it’s
substrate, in this case glycyltyrosine. We are going to identify those binding sites and
place a bond between the relevant atoms.
Look back at your responses in question 10. While viewing your responses and the model
and while rotating the model so that you can see it a various angles, try to identify places
where bonds might form. This is more or less like a “matching question” on an
exam….but you need to look at the spatial orientation of the Zn, the residues in the active
site and the substrate in order to ascertain your answers. There are four places where a
bond forms. By placing the cursor on the atom you can see the 4 digit number of the
atom. (NOTE:, hydrogens are not shown in the model, so for any NH groups, find the
number of the nitrogen.
11
Q-11) Fill in the answers below and then check with your instructor before you proceed.
(atomno refers to the number of the atom in the model):
atomno=_____________bonds to atomno=______________
atomno=_____________bonds to atomno=______________
atomno=_____________bonds to atomno=______________
atomno=_____________bonds to atomno=______________
Ok, now let us form those bonds on our model.
For each of the bonds, Type “select atomno=?, atomno=?” and substitute the ? with the
number that you determined in Q-11. The press “Enter”. Then type “connect single” and
press “Enter”. Type “color bond purple”
and press Enter. Repeat these three steps
for each of the four bonds.
The enzyme is now bound to the substrate
forming an enzyme-substrate complex.
According to Koshlands induced fit model,
there are several changes in the enzyme’s
structure which are induced by the binding
event. Figure 7 shows the enzyme bound to
the substrate. Your model may appear
different depending on its particular
orientation. If you “play” with the
orientation, rotating it in different x,y,z
direction, you should be able to see your
model in a position which is similar to the
one shown in figure 7. This is optional. Figure 7
Note that the bond between the substrates amino group and glu 270 actually occurs
through an intervening water molecule.
The Active Site: The Catalytic Event
The joining of the enzyme to the substrate causes a conformational change in the enzyme
(induced fit) which cannot be easily shown with this program. These changes include the
movement of groups in glu 270, arg 145 and tyr 248.
The actual catalytic event which occurs in the active site is quite complex and there are
different models which have been proposed to explain the event.
11
According to one model (see figure 8) an OH- group from the intervening water molecule
between glu 270 and the carbonyl oxygen “attacks” the carbonyl carbon. The Zn ion
which was pointed toward the carbonyl oxygen facilitates this action. Tyr 248 donates a
proton (H+) to the NH group of the susceptible peptide bond.
Figure 8 (http://openlearn.open.ac.uk/file.php/4238/!via/oucontent/course/482/s377book1chapter3_f046hi.jpg)
Examining the Active Site in Context with the Whole Enzyme
H) We are now going to display the rest of the enzyme so that we may see the active site and
substrate as part of the whole enzyme.
Type “Display all” and press Enter. Type “select
[Tyr]248,[Glu]270,[Tyr]198,[Phe]279,[Arg]145,[His]69,[Glu]72,[His]196,[Arg]71”
and press Enter. Type “labels off” and press Enter. Type or “cut and paste” the
following: Select 1-68, 70, 73-144, 146-195, 197, 199-247, 249-269, 271-278, 280-307
and press Enter. Left click Style>Scheme>Trace. Type “color white” and press Enter.
Type “zoom 75” and press Enter.
11
You can now see the active site and substrate in contex with the rest of the molecule.
Rotate the structure along the x, y or z
axes so that you can see the whole active
site as it sits in the rest of the protein.
Note in figure 9 that when positioned as
you see it here, the active site is all
bunched up in the lower right hand
corner of the enzyme…all contained
within the red square.
Perhaps most remarkable is that out of
307 amino acids, only a small number
are directly involved in binding the
substrate and in the catalytic events
leading from reactants to products.
Q-12) That being the case, what is the
role(s) might the other amino acids in
this enzyme play? How might your
answer differ is the enzyme was membrane Figure 9
bound?
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
11
Further Investigations
1) Examine the binding and catalytic event of another enzyme.
2) Examine the binding of an inhibitor to the allosteric site of an enzyme.
3) Examine the activation (or inactivation) of an enzyme acted upon by a kinase in a
signal pathway.
References
1) http://openlearn.open.ac.uk/file.php/4238/!via/oucontent/course/482/s377book1chapt
er3_f046hi.jpg (Source: Figure 8)
2) http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi (NCBI: Carboxypeptidase A)
3) http://www.rcsb.org/pdb/explore/explore.do?structureId=1PYT (RCSB Protein Data
Bank)
11
The Mystery of the Potassium Channel
Learning About Proteins Through Computer Modeling Goals:
To learn how computer modeling can help us understand the relationship between protein
structure and function.
To learn about the selectivity filter in ion transport protein potassium channels.
Potassium channels play an important role in many organisms from bacteria to humans. In
humans, those roles include involvement in heart muscle contraction and nerve cell impulse
transmission.
In 2003 Dr. Rod MacKinnon, of Rockefeller University, won the Nobel Prize for his research on
ion channels.
Here is some background information about the potassium channel (KCSA) from Streptomyces
lividans that we will be analyzing today: It is made of four identical polypeptide chains, each
containing 119 amino acids. Much of the structure plays a significant role in allowing the protein
to sit in a phospholipid bilayer. It is more or less shaped like an upside down teepee with the
wider end facing the hydrophilic outside of the cell and the narrow end facing the hydrophilic
inside of the cell. Most of the protein sits in the hydrophobic region of the membrane amidst the
“tails” of the phospholipids. However, the part of the molecule that we will focus in on is the
“selectivity filter” (see Figure 1), the part of the protein channel which determines which ions
may pass through the membrane…in this case potassium.
The selectivity filter is an amazing feature of the potassium channel. It allows approximately
one million K+
ions to pass through it per second and yet it only allows 1 Na+ ion “sneak through
11
for every 10,000 K+ ions that enter the cell. That would be like a ticket collector at a football
stadium allowing one person without a ticket to enter through the gate for every ten thousand
fans entering through the gate which have tickets. It is interesting to note that Na+ ions are
smaller than K+ ions. Both ions have the same +1 charge. It seems like Na
+ ions DO have the
“tickets”, yet they cannot get into the “stadium” (read cell).
Q-1) Based on that background information, what questions do YOU have about the potassium
channel?
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
______________________________________________________________________________
The question that you will answer is: How does the selectivity filter work such that it allows
potassium ions through, yet it prevents the smaller, equally charged sodium ion from entering the
cell?
Procedure
I) Open your Jmol program and drag the Potassium Channel (1Bl8 PDB) file onto the
blackened screen. A mostly magenta computer model of the potassium channel will
appear on the screen. See figure 2.
Figure 2
11
There are three ways that we will manipulate and measure our model using the Jmol
program:
4. Type directions onto the Jmol Script Console in the window to the left. All jmol
instructions that you need to type on the Jmol Script Console will be in bold and
within quotation marks. Type in the instructons just after the $ sign. Leave out
the quotation marks when you type your directions on the Jmol Script Console. It
is important to apply the correct syntax in doing so.
5. With the cursor on the screen, left click and choose various items in the menu or
submenus. Each step will be followed with a “>” sign and will be in bold. For
example, style>scheme>ball and stick.
6. Use the menus, submenus and shortcuts in the toolbar.
We want to relive the discovery of how this molecule works by manipulating the model.
You will see that this is a powerful and useful program. There is an appendix at the end
of the lab which provides a summary of the “Command” instructions used to manipulate
this model.
J) Start out by moving your cursor onto the black display screen. Note that you can rotate
the molecule in different directions by dragging different parts of it. Position the
molecule so that you can see straight through the selectivity channel. You will see
“potassium” ions right in the center of the channel. They are colored purple.
Q-2) Are you viewing the channel as if you are inside the cell or from the outside of
the cell? How can you tell? You will probably have to manipulate the image to
answer this question.
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
Q-3) When viewing this model from the side (as if you were looking at the protein
positioned in the lipid bilayer), is it possible to see the channel? Why or why not?
Explain.
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
11
K) Lets check out this protein a bit more. There are four identical polypeptides in this
protein.
Q-4) What would you like to do to this model so that we can visualize or highlight
each polypeptide separately?
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
L) Type “select *A”. Now press “Enter” or “return”. Then type “color pink” (or whatever
color you would like to choose: see the appendix for choices) and then press “Enter”.
Repeat this step for chains B, C and D using a different color for each chain. Be sure to
type the asterisk (*).
Q-5) It is still a bit difficult to get a handle on how the selectivity filter is structured and
how it works. In order to get a handle on how the selectivity filter works, what would you
like to do with this model (be creative)? Explain why.
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
M) In order to see in detail what is going on along the
length of the selectivity filter, we must “slice” through
this protein. Since the protein is made of four
identical polypeptides, by removing two of them, we
can, in effect, slice down through the middle of the
protein. Type “display *A, *C,” (which in effect
causes polypeptide chains B and D to disappear) and
then press “Enter”. Let us color the remaining
polypeptides one color. Type “Select*A,*C” and
press “Enter”. Then type “Color magenta”. To color
the potassium white, type “Select K” and press
“Enter”. Type “Color white” and press “Enter”. (see
figure 3). Note that if you position the remaining Figure 3
polypeptides, you can see the channel. You can also see the white potassium ions in the
channel. Let us explore how the selectivity filter works.
11
N) We need to take a closer look at the channel and simplify the appearance of the rest of the
polypeptides. That will help us to get a handle on how the selectivity filter works. Each of
the polypeptides is made of
119 amino acids. We will be
able to identify them and
analyze them better in a ball
and stick format. Type “select
all” and press “Enter”. To
convert them to a ball and
stick format, left
click and then choose
style>scheme>ball and stick
(see figure 4).
Figure 4
O) The structure looks a bit too complex (see
figure 5) to really analyze. Lets simplify the
whole molecule except for the actual
channel or selectivity filter. Each of the 119
amino acids are numbered. In order to see
which amino acids are in the channel move
the cursor along atoms in the amino acids in
the channel to identify their numbers. If you
freeze the cursor on an atom, the amino
acids that it is part of will be identified in a
little box. You will see the three letter
abbreviation of the amino acid, its number in
the chain and the name of the polypeptide
chain that it is in [ie, Ser69A]. This is a bit
trickier than it may sound. Some of the
atoms appear to be adjacent to the channel, Figure 5
but when you drag the molecule to rotate it
you may discover that while it appeared to be in the channel, actual, it was not.
11
P) We are going to simplify the structure of both chains except for amino acids 75-78.
Type “select 1-74:A” and press “Enter”.
Left click style>scheme>Trace. Type
“Color green” and press “Enter”.
Type “select 79-119:A” and press “Enter”.
Left click style>scheme>Trace. Type
“Color green” and press “Enter”.
Type “select 1-74:C” and press “Enter”.
Left click style>scheme>Trace. Type
“Color green” and press “Enter”.
Type “select 79-119:C” and press “Enter”.
Left click style>scheme>Trace. Type
“Color green” and press “Enter”.
See Figure 6.
Figure 6
Q) In order to understand how the selectivity filter works, we need to center the filter on the
screen and enlarge it…even if it means blocking out much of the rest of the molecule.
Before doing so, let us take a good look at the parts of the polypeptides which are NOT
part of the channel.
Q-6) What roles do those parts serve with respect to the lipid bilayer and the selectivity
filter?
____________________________________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
R) To move the molecule along
the X or Y axis, press +right
click and drag. Drag the
molecule such that the
channel is centered.
To enlarge the channel or to
zoom, press Shift + left click
and drag vertically (↕).
You may need to center the
model a few times as you
enlarge it. Lets make the
potassium ions almost
invisible by coloring them black. Figure 7
11
Type “Select K” and press “Enter”.
Type “Color black” and press “Enter”.
See Figure 7.
S) OK, now we are in a position to analyze the selectivity filter. Note that carbon is shown
in gray, nitrogen in blue and oxygen in red.
Q-7) What atoms are facing the inside of the channel?
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
Q-8) Look at the model of the selectivity filter. You may have to rotate it a bit to answer
the following question. How can you tell if an oxygen is a carbonyl oxygen or an oxygen
that is part of the R-group of the amino acid? Explain. What is the charge of these
oxygens?
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
T) Measure the length of the channel (in angstroms Å) in the following way: Click the ruler
symbol in the toolbar. A small “Measurements” screen opens up. Double click the Thr 75
of chain A and then double click the Tyr 78 of chain A. The distance will appear on the
diagram and also in the “Measurements” box. Do the same for Thr 75 of chain C and Tyr
78 of chain C.
Q-9) What is the length of the channel in angstroms (Å)
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
Q-10) Measure the width of the channel by measuring the distance between [Thr]75:A
and [Thr]75:C. Do the same between [Tyr]78:A and [Tyr]78:C.
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
11
U) Potassium ions do not travel by themselves when they are outside or inside a cell.
Q-10) What molecules surround potassium ions in the intra- or intercellular fluid?
Explain the basis for bonding between potassium and the molecules which accompany it.
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
V) Note that the channel is lined with charged oxygens. In addition, your model is only
showing two of the four polypeptides. When all four are present, the negatively charged
oxygens form a cage around the potassium. Consider the potassium or sodium going
through this channel with it’s “water partners”…that is hydrated potassium or sodium
ions. Remember that water is a dipole having a oppositely charged regions.
Q-11) What is the charge of a potassium ion? What is the charge of the oxygen in water
in the first hydration shell around the potassium?
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
Q-12) What is the charge of a sodium ion? What is the charge of the oxygen in water in
the first hydration shell around the sodium?
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
Q-13) What is the charge of the carbonyl oxygens in valine and glycine lining the
channel?
____________________________________________________________________
____________________________________________________________________
____________________________________________________________________
____________________________________________________________________
W) In order for a potassium ion or sodium ion to fit through the channel, water molecules
will have to be stripped off of the respective ions. Based on the structure of the channel
and based on the structure of the hydrated ions, we need to explore which ion is more
likely to be “dehydrated” and thus more likely to go through the channel.
11
The diameter of dehydrated Na+ and K
+ ions are 1.96Å and 2.66Å, respectively.
Q-15) Are the negatively charged oxygen atoms in water closer to the positively charged
sodium nucleus or the positively charged potassium nucleus (see figure 8)? Explain.
Based on your answer, which ion requires less dehydration energy to remove the
hydration shell, potassium or sodium? Explain.
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
Figure 8
X) The O-s in the selectivity
filter are the same distance
from K+ as the O
-s in the
first hydration shell of
potassium (see Figure 9).
The O-s in the first
hydration shell surrounding
Na+ is closer in and thus not
in the right position to be
displaced by the O-s lining
the selectivity filter.
Figure 9
11
Q-16) Based on that information, which ion is more likely to become dehydrated as it
passes through the selectivity pore? Explain.
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
_____________________________________________________________________
Y) And finally, here is a look into a cell through a potassium channel (see Figure 10).
Summary-The potassium channel has a selectivity filter which allows larger, positively
charged potassium to enter at a rate which is approximately 10,000 times higher than the
rate of entry of the smaller, positively charged sodium ion. Based on what you learned
through this activity, explain how the selectivity pore operates to selectively allow the
higher rate of potassium ion entry than sodium ion entry.
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
11
Further Reading/Vido Clip
1) Rod MacKinnons lecture at the Nobel Prize Ceremony. POTASSIUM CHANNELS
AND THE ATOMIC BASIS OF SELECTIVE ION CONDUCTION
http://www.nobelprize.org/nobel_prizes/chemistry/laureates/2003/mackinnon-lecture.pdf
2) Rod MacKinnon’s biography on the Rockefeller University Web Site.
http://www.rockefeller.edu/research/faculty/abstract.php?id=132
3) Char-Chang Shieh, Michael Coghlan, James P. Sullivan AND Murali
Gopalakrishnan. Potassium Channels: Molecular Defects, Diseases, and Therapeutic
Opportunities. Pharmacol Rev 52:557–593, 2000
4) YouTube Video showing mechanism of action of the potassium channel.
http://www.youtube.com/watch?v=UqxzSrjzJ70&feature=related
Further Investigations
1) The selectivity channel actually has more than one binding site at the potassium ions
move through the selectivity filter. Discuss what causes the ions to be “forced” out on
one side as they enter the other side.
2) Learn about voltage and ligand gated channels as they specifically apply to
potassium, calcium and sodium channels.
3) What are the physiological effects of various defects in potassium channels (see
further reading #3).
References
1) Web Books: Memory-Ion Channels
http://www.web-books.com/MoBio/Memory/Channel.htm
2) PSI Nature. Structural Biology/Knowledgebase TrkH Potassium Ion Transporter
http://sbkb.org/kb/archives.jsp?pageshow=37
3) Carrillo-Tripp, Mauricio; Saint-Martin, Humberto; Ortega-Blake, Iván. A comparative
study of the hydration of Na+ and K
+ with refined polarizable model potentials.
Journal of Chemical Physics, Volume 118, Issue 15, pp. 7062-7073 (2003).
4) Mancinelli, R. A. Botti, F. Bruni, M. A. Ricci and A. K. Soper. Hydration of
Sodium, Potassium, and Chloride Ions in Solution and the Concept of Structure
Maker/Breaker. Journal of Physical Chemistry. B 2007, 111, 13570-13577
5) Yu. Noskov and Benoît Roux. Importance of Hydration and Dynamics on the
Selectivity of the KcsA and NaK Channels. The Journal of General Physiology.
January 16, 2007