Antibody responses to linear and conformational epitopes PhD course: Biological Sequence Analysis 30.05.2008 Pernille Andersen
Antibody responses to linear
and conformational epitopes
PhD course:Biological Sequence Analysis30.05.2008
Pernille Andersen
Outline
� Antibodies and B-cell epitopes
� Classification of B-cell epitopes
� Prediction methods for B-cell epitopes
� Presentation of CBS prediction methods
� Examples of B-cell epitopes in vaccine design
Antibodies and B-cell epitopes
Conserved Fc fragments
are recognizable for
macrophages and
complement system
Variable CDRs of Fab
fragments binds
specifically to
pathogen
epitopes
1IGT
Harris et al. 1997
Antibodies and vaccines
� Vaccines introduce parts of the pathogen (epitopes) to the immune system
� The immune system then develops antibodies
that bind the specific pathogen and which stay in the individual
� Antibodies help to prevent the infection of the
pathogen and the individual is immune
B-cell epitopes
� B-cell epitopes are exposed parts of a pathogen molecules which antibodies are developed to recognize and bind
� They are consisting of atoms in a specific spatial arrangement
� Protein B-cell epitopes are classified into linear and discontinuous epitopes
� ~90% of epitopes in globular proteins are discontinuous (Thornton et. al. 1986, Barlow et al. 1986)
Discontinuous B-cell epitopes
An example: An epitope of the Outer Surface Protein A from Borrelia
Burgdorferi (1OSP)
SLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKCKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKG 1OSP, Li et al. 1997
Characteristics of binding
� Salt bridges
� Hydrogen bonds
� Hydrophobic interactions
� Van der Waals forces
� Highly flexible amino acid side chains
� Conformational rearrangements upon binding
� “Induced fit” model of interactions
Binding strength
B-cell epitope data bases
� Databases:
� AntiJen
� IEDB
� BciPep
� Los Alamos HIV database
� Protein Data Bank
� Large data set: linear epitopes
� Small data set: discontinuous epitopes
>PATHOGEN PROTEINKVFGRCELAAAMKRHGLDNYR
GYSLGNWVCAAKFESNF
Rational Vaccine
Design
Computational/rational vaccine design
Steps in epitope prediction
• The performance is still low compared to T-cell
epitope prediction
• Use as much information about your protein as
possible
– Predicted epitopes
– Multimerization
– Glycosylation
– Transmembrane helices
– Conformational changes
– Functional sites
� Protein hydrophobicity – hydrophilicity algorithmsParker, Fauchere, Janin, Kyte and Doolittle, Manavalan
Sweet and Eisenberg, Goldman, Engelman and Steitz (GES), von Heijne
� Protein flexibility prediction algorithm Karplus and Schulz
� Protein secondary structure prediction algorithmsGOR II method (Garnier and Robson), Chou and Fasman, Pellequer
� Protein “antigenicity” prediction :Hopp and Woods, Welling
TSQDLSVFPLASCCKDNIASTSVTLGCLVTG
YLPMSTTVTWDTGSLNKNVTTFPTTFHETYGLHSIVSQVTASGKWAKQRFTCSVAHAEST
AINKTFSACALNFIPPTVKLFHSSCNPVGDT
HTTIQLLCLISGYVPGDMEVIWLVDGQKATN
IFPYTAPGTKEGNVTSTHSELNITQGEWVSQKTYTCQVTYQGFTFKDEARKCSESDPRGVT
SYLSPPSPL
Sequence-based methods for prediction of linear epitopes
Propensity scales: The principle
� The Parker
hydrophilicity scale
� The values describe the
hydrophilicity of each amino acid
� Derived from
experimental data
D 2.46E 1.86N 1.64S 1.50Q 1.37G 1.28K 1.26T 1.15R 0.87P 0.30H 0.30C 0.11A 0.03Y -0.78V -1.27M -1.41I -2.45 F -2.78L -2.87W -3.00
HydrophilicityParker et al. 1986, Biochemistry
….LISTFVDEKRPGSDIVEDLILKDEI….
Propensity scales
(-2.78 + -1.27 + 2.46 +1.86 + 1.26 + 0.87 + 0.3)/7 = 0.39
Example of B-cell epitope
predictions using the Parker
hydrophilicity scale on the
sperm whale myoglobin
sequence.
Epitopes are shown in blue.
(Pellequer et al. 1993)
Sensitivity and specificity
Sensitivity: A measure of
how many annotated
epitopes were predicted as
epitopes
Specificity: A measure of
how many annotated non-
epitopes were predicted as
epitopes
X% sensitivity
Y% specificity
Evaluation of propensity scales
� Blythe and Flower performed an extensive study
of propensity scales for B-cell epitope prediction
� Conclusion:
� Basically all the classical scales perform close to random!
� More advanced methods are needed
Blythe and Flower, 2005
DiscoTope
Prediction of residues in
discontinuous B-cell epitopes
using protein structure
information
Haste Andersen et al., Protein Science, 2006
B-cell epitope propensity scale
Frequencies of amino
acids in epitopes
compared to frequencies
of non-epitopes
Several discrepancies
compared to the Parker
hydrophilicity scale
The DiscoTope method
was shown to predict
better than the Parker
scale alone
Amino acid Parker Log-odds
Ratios
D 2.460 0.691
E 1.860 0.346
N 1.640 1.242
S 1.500 -0.145
Q 1.370 1.082
G 1.280 0.189
K 1.260 1.136
T 1.150 -0.233
R 0.870 1.180
P 0.300 1.164
H 0.300 1.098
C 0.110 -3.519
A 0.030 -1.522
Y -0.780 0.030
V -1.270 -1.474
M -1.410 0.273
I -2.450 -0.713
F -2.780 -1.147
L -2.870 -1.836
W -3.000 -0.064 aAmino acids are listed with descending
hydrophilicity using the values of the Parker scale.
Highly
hydrophilic
Moderate
hydrophilic
Least
hydrophilic
Contact numbers
Surface exposure and
structural protrusion can
be measured by residue
contact numbers
DiscoTope : Prediction of Discontinuous epiTopes
using 3D structures
A combination of:
– Sequentially averaged epitope propensity values of residues in spatial proximity
– Contact numbers
-0.145
+0.346+1.136
+0.691+0.346+1.136+1.180+1.164
Contact number : K 10
Sum of log-odds values
.LIST..FVDEKRPGSDIVED……ALILKDENKTTVI.
DiscoTope prediction value
The DiscoTope web server
www.cbs.dtu.dk/services/DiscoTope
http://tools.immuneepitope.org/stools/discotope/discotope.do
BepiPred
Prediction of linear epitopes using protein sequence
information
Larsen et al., Immunome Res. 2006
The BepiPred method
� Parker hydrophilicity scale
� Markow model: linear epitopes from the AntiJen
database
� BepiPred is a combination method
Sequence bepipred-1.0b epitope 17 17 0.094 . . .
Sequence bepipred-1.0b epitope 18 18 0.780 . . E
Sequence bepipred-1.0b epitope 19 19 1.013 . . E
Sequence bepipred-1.0b epitope 20 20 1.221 . . E
Sequence bepipred-1.0b epitope 21 21 1.006 . . E
Sequence bepipred-1.0b epitope 22 22 1.047 . . E
Sequence bepipred-1.0b epitope 23 23 0.817 . . E
Sequence bepipred-1.0b epitope 28 28 0.336 . . .
Sequence bepipred-1.0b epitope 32 32 0.106 . . .
Sequence bepipred-1.0b epitope 33 33 -0.007 . . .
Works with a prediction
threshold
The BepiPred web-server
www.cbs.dtu.dk/services/BepiPred
http://tools.immuneepitope.org/tools/bcell/iedb_input
BepiPred prediction in VAR2CSA
� BepiPred performs better than classical propensity scale methods
� BepiPred predicted epitopes successfully in the DBL3X domain of VAR2CSA which is a potential candidate for a vaccine against pregnancy associated malaria.
BepiPred
Predictions
Epitopes
identified with
Pepscan
Dahlbäck et al 2006, Plos Pathogens
B-cell epitopes in vaccines
Linear epitopes, presented in peptides
� Easily synthesized and stored
� Problems
� MHC class II helper-epitope
� Immunogenicity
� Multiple conformations
� Peptidase-degradation
B-cell epitopes in vaccines
• Discontinuous epitopes
– Presented in subunit vaccines, mimotopes or
protein scaffolds
– Recent projects:
• OspA a lyme disease vaccine candidate
– Koide et al. applied structure-based drug design to remove
45% of the protein -> use engineered, stabilized form for
vaccines
• HIV gp120
– Zhou et al. made a stable, functional conformation for
induction of the neutralizing antibody b12
Koide et al. , JMB, 2005, Zhou et al. , Nature, 2007
Summary I
� B-cell epitopes are on the surface of
antigens
� Single propensity scales are less useful for
prediction
� DiscoTope: Structure based prediction of
discontinuous epitopes
� BepiPred: Sequence based prediction of
linear epitopes
Summary II
� Rational vaccine design based on B-cell epitopes is still in development stage
� Linear epitopes most easily used in vaccine design
� Discontinuous epitopes are harder to use in vaccine design
Acknowledgements
Nick Nick Nick Nick GauthierGauthierGauthierGauthier
Jens. E.P. LarsenJens. E.P. LarsenJens. E.P. LarsenJens. E.P. Larsen
MortenMortenMortenMorten NielsenNielsenNielsenNielsen
Ole LundOle LundOle LundOle Lund
Claus Claus Claus Claus LundegaardLundegaardLundegaardLundegaard