WWW.NAILSMAG.COM OCTOBER 2011AMY BECKER TAKES THE TOP SPOT AFTER
15 YEARS ON NAILS TOP 25 LIST Buy It in Pinkto Help End Breast
CancerNail Techs Dont Let Nail Techscure(preview the fall gel color
collections)fallFORTHERetailing TIPS for the Timidna1011Cover.indd
2 8/24/11 12:19:33 PMIn Salon: May 1, 2011ORLY Nail Lacquers are
Free of DBP, Formaldehyde & Toluenesweet peacocknite owl sea
gurllucky duckfowl playpeachy parrotAvAlLABLE AT PROFESSlONAL
BEAUTY SUPPLY STORES, SALONS AND SALLY
BEAUTY.NAlLPRO.COM/FREElNFOUSE FREElNFO #1na1011ads.indd C2 8/24/11
10:51:24 AM800.275.1111 orlybeauty.comGiselle is wearing SWEET
PEACOCK na1011ads.indd 1 8/24/11 10:51:29 AM 2011
DisneyUNFROGETTABLECOLORS!ONLY IN THEATERSna1011ads.indd 2 8/24/11
10:06:37 AMGLITTERS12-PIECE DISPLAYREDS & NEUTRALS12-PIECE
DISPLAY36-PIECE DISPLAYGL I TTERS*REDS&NEUTRAL SCONTAINS NO
DBP, TOLUENE, OR FORMALDEHYDENail Lacquers feature OPIs exclusive
ProWide Brush (Patent pending).Call 800.341.9999 2011 OPI Products
Inc.*All Glitters also available in Axxium Soak-Off Gel Lacquers
for a limited time.Find us on:ANIMAL - ISTIC MEEP - MEEP - MEEP
WOCKA WOCKA!PEPES PURPLEPASSIONDESIGNER...DE BETTER!WARM
ANDFOZZIERAINBOW CONNECTIONEXCUSEMOI!GONEGONZO!FRESH FROGOF BEL
AIRDIVINESWINEGETTINMISS PIGGYWITH IT!na1011ads.indd 3 8/24/11
10:06:43 AM
cnd.com2011 Creative Nail Design, Inc.na1011ads.indd 4 8/24/11
10:06:46 AMAutumns bounty of lively pear and dandeliona little
cozy, a little sultry. Indulge in a festival of Fall Fragrance.Pear
& Dandelion Scentsations.From CND.FALL HARVEST.na1011ads.indd 5
8/24/11 10:06:49 AMFASTJUST GOT na1011ads.indd 6 8/24/11 10:06:51
AMWWW.|a||larror].corT|e]'re 0orra 0o||a 0e| *HOLVKedA| ]our |oca|
d||r|ou|or lor eru|re *HOLVK |oda] Vade |r ||e uSADiminishing Power
& Performance of U.V. BulbsU.V. LightBulb & Gel
PerformanceMonths 1st2 nd 3rd 4th5 th 6thReplace BulbsNewConsistent
Power & Performance of LED LightL.E.D. 18GLight & Gel
PerformanceYears 1st2 nd 3rd 4th5 th 6thNo Bulb Replacement
Necessary - EVER!www.nailsmag.com/fifi/21285na1011ads.indd 7
8/24/11 10:06:55 AMschool of hard rockssize mattersbobbing for
baubleswinter2011cocktailbling.I like to arm myself with bangle
janglebrooch the subjectUSAs nail salon expert.Since 1981.
essie.comcocktail blingFor more information,call 1.866.313.7845DBP,
Toluene and Formaldehyde freena1011ads.indd 8 8/24/11 10:06:58
AMWinter 2011moda_winter_insert.indd 1 9/1/11 10:17:11
AMmoda_winter_insert.indd 2 9/1/11 10:17:19 AMbrooch the
subjectDiscreet, smooth, pretty.This creamy cashmere cameo is a
sleeper hit,playing a starring role in the most renedwardrobes this
season.cocktail blingMilky, mysterious, majestic.A pale blue
chalcedony cabochon is the dreamy, creamy center to the archetypal
cocktail ring and the color of the season.size mattersRarest of the
gems, more valuable than diamond, blazing hot ruby red makes your
pulse race and your heart pound. Red carpet diem!school of hard
rocksA rock-hard look is easy to achieve when you paint on this
masterful midnight malachite. Youll be sitting pretty tough while
others go green with envy.bobbing for baublesTry as you might to
pin this color down, it is ever elusive slipping through your ngers
like the deepest darkest blue sapphire. Hard to get but denitely
heart-stopping.bangle jangleLovely limpid pools of light.Float away
on a pretty cloud of lavender amethyst that lifts your spirits to
airy heights. Pledge allegiance to the bling. A well-placed piece
of jewelry makes any outt and ensures all that glitters will be
you!These festive, luminous colors evoke the beguiling beauty of
the world of gems, and are sure to cause a sensation.Its your
destiny to light up the night. In gorgeous we trust.theres nothing
like festive, jewel-tone color. bling it on!moda_winter_insert.indd
3 9/1/11 10:17:22 AMcocktail bling6 pc Color CubeHolds one bottle
each of 6 colorsSalon Cost: $24.00Sugg. Retail Price: $48.00Item #
P0532200UPC Code: 8844860650254 pc Mega Mini Color CubeHolds 4 mega
mini colors: Cocktail Bling, Bobbing For Baubles, Bangle Jangle,
and Size MattersSalon Cost: $8.50Sugg. Retail Price: $17.00Item #
P0532100UPC Code: 88448606501812 Bottle Designer DisplayHolds 2
bottles each of 6 colorsSalon Cost: $48.00Sugg. Retail Price:
$96.00Item # P0532300UPC Code: 88448606503236 Bottle Designer
Display Holds 6 bottles each of 6 colorsSalon Cost: $144.00Sugg.
Retail Price: $288.00Item # P0532400UPC Code: 884486065049winter
2011Available October 1, 2011Individual Bottle Salon Cost: $4.00
Per Bottle Sugg. Retail Price: $8.00DBP, Toluene and
Formaldehyde-freeP0523600 For more information, call 1.866.313.7845
or visit www.essie.combobbingfor baubles769size matters771cocktail
bling768school ofhard rocks772bangle jangle770broochthe
subject773cocktailbling.I like to arm myself with
moda_winter_insert.indd 4 9/1/11 10:17:23 AMDBP, Toluene and
Formaldehyde freeto nd a cure.raise awarenessraiseawareness. Im
speakingout to USAs nail salon expert.Since 1981. essie.comFor more
information,call 1.866.313.7845Essie supports Living Beyond Breast
Cancer in recognition of Breast Cancer Awareness Month. A portion
of the sales will be donated to Living Beyond Breast Cancer,whose
mission is to empower all women affected by breast cancer to live
as long as possible with the best quality of life.na1011ads.indd 9
8/24/11 10:07:02 AMna1011ads.indd 10 8/24/11 10:07:17
AMwww.nailsmag.com/fifi/21260na1011ads.indd 11 8/24/11 10:07:21
AMthe ultimate in nail fashionna1011ads.indd 12 8/24/11 10:07:24
AM2011 Dashing Diva Professional. 866.665.3482.
www.dashingdivapro.comJoin Our CommunityNot all appliqus are
created equal. Introducing the rst nail appliqu engineered with:
EMBEDDED BEJEWELED DESIGNS SUPERIOR NO-HEAT ADHESION
TECHNOLOGYNATURAL NAIL OPTION FOR NO-LIFT WEEK-LONG WEAR GELIFE
SOAK-OFF UV GEL OPTION FOR HIGH-GLOSS TWO-WEEK WEAR CUSTOM-CUTTING
OPTIONS TO CREATE YOUR OWN NAIL INSPIRATIONSAvailable in 36
stunning designs for ngers and toes.Available November 1 at your
local CosmoProf store.WEAR NO NAIL HASGONE BEFOREBEJEWELED 3D
DESIGNS9 sizes / 36 appliqusFASHION PRINT DESIGNS14 sizes / 42
appliquswww.nailsmag.com/fifi/21231na1011ads.indd 13 8/24/11
10:07:41 AMModel is wearing NSI Polish Pro Accessory Pink Peep Toes
over Ebony (black).na1011ads.indd 14 8/24/11 10:07:44 AMAccessory
VintageBurgundyThe Accessory Collection. Instantly multiply your
Polish Pro color range.Blue Satin Clutchbefore & afterScan for
more information.Polish Pro Accessories. For something striking and
totally new, layer anyone of our six Accessories over one of our 42
Polish Pro colors and presto!Chip-free for two weeks or longer. Buy
four and get two FREE to own theentire Accessory Collection. Also
sold separately. For more information,visit us at nsinails.com. Or,
call 1-800-354-6741.Because youre more than Just a Nail Girl.Youre
a Pro who knows how to deliver the perfect nishing touch. Help NSI
ght breast cancer. For every online order you submit in October,
NSI will contribute $5 to the Linda Creed organization. Visit
nsinails.com/lindacreed for more
details.www.nailsmag.com/fifi/21135na1011ads.indd 15 8/24/11
10:07:55 AMEXPERIENCE THEWOW-FACTOR.Dashing Diva French Wrap
Manicurena1011ads.indd 16 8/24/11 10:08:01 AMAPPLY French Wrap
PlusCLIP Application tab to release French colorAPPLY Dashing Diva
Base Sealand Top SealPatented innovation provides: No-chip,
no-smudge French manis Up to 2 weeks of awless wear Perfect smile
lines, every time1.2.3.RESULTS A perfect Frenchmanicure that
lastson natural nails4.Its All About the
WOWwww.nailsmag.com/fifi/21231na1011ads.indd 17 8/24/11 10:08:08
AMna1011ads.indd 18 8/24/11 10:08:15
AMwww.nailsmag.com/fifi/21265na1011ads.indd 19 8/24/11 10:08:29
AMAVANTE-GARDE 03001CONTEMPO 03002DIVA CHIC 03004ECCENTRIC
03006METRO 03007CHEEKY 03008FOXY 03009FAB03010FLASHING 03011DASHING
03012TRENDY 03013TRIST 03014POSH03015SWANKY 03016UPTOWN 03017ALL
THE RAGE 03018VOGUE03019FASHIONISTA 03003SOOO IN 03020FIERCE
03021ANGELS03023PRECIOUS03024LUCSIOUS 03025SEDUCTIVE 03026LOVELY
03027PASSION 03028KARMA03029HALO 03030DAZZLED 03031BLING BLING
03032GLISTENING 03033TWINKLES03034PRINCESS 03035HOTNESS 03036PURITY
03037SWAG03038INNOCENCE 03022PROFESSIONAL FORMULASPROFESSIONAL
RESULTS38 Artistic Colors Now Available in 60 Amazing Colors
www.ArtisticNailDesign.comBeverly Hills CA, 90210USATel: 714. 635.
5110GLAM03005na1011ads.indd 20 8/24/11 10:08:36 AMCelebrity
Manicurist Tom Bachik Announces Artistic Nail Designs Colour Gloss
Soak-Off Color Gel Salon Manicures 21-Days of Lasting ColorJUICED
03059HOTZY 03058CRAZED 03057WHAM 03055FRENZY03054TEASE 03052DeBLU
03051MISSTEP 03050MUSE 03049SASSY03049LA-TI-DA03047 GLOWING03060FLY
03056WITH-IT 03053CAFFEINE 03040MOCHA-CHINO 03041JAVA JAVA03042CAF'
LATE' 03043NAKED 03044GLISTEN 03045PEACH WHIP
03046ILLUSION03039NEW22 Artistic Colors COLOUR GLOSS SOAK-OFF COLOR
GELwww.nailsmag.com/fifi/21296na1011ads.indd 21 8/24/11 10:08:44
AMWWW.NAILSMAG.COM OCTOBER 2011AMYBECKER TAKES THE TOP SPOT
AFTER15YEARS ONNAILS TOP25LIST Buy It in Pinkto Help End Breast
CancerNail Techs Dont Let Nail Techscure(preview the fall gel color
collections)fallFORTHERetailing TIPS for the Timid} {in this
issueOctober 2011 Volume 29, No. 9Features138The Cure for FallAs
the bright shine of summer fades into the earthy tones of fall,
perk up your customers with these new color gel collections from
your favorite manufacturers.142Retailing for the TimidRetail can be
intimidating if you think it makes you look like a salesperson.
Rather than thinking of retail as making the sale, consider it a
way of ofering your professional opinion.148Victory at Last: Becker
Tops the Top 25 Competitors RankingTalk about bragging rights. Amy
Becker has earned a spot on NAILS Top 25 Competitors list more
times than anyone else in its history. And nally, for our 2010-2011
competition year, shes snagged the top spot.154Buy It in Pink to
Help End Breast CancerEvery October businesses join in solidarity
to ght breast cancer. By purchasing these passionately pink items,
you too are joining in this solidarity as each company donates to
organizations that work every day to end breast cancer and the
struggles it can bring to women and families around the
world.166Nip It in the CuticleA good, sturdy pair of cuticle
nippers is a standard piece of equipment for every nail tech. They
are a necessary tool to help keep the cuticle and nail plate clean
and well maintained. page 142page 138page 114Cover LookNails:
Shelena Robinson, Crooked River, Ore.Polish Shown: CND Shellac
Black Pool and ZillionairePhotographer: Vu OngModel: Jenna Chong,
Body Parts Modelspage 15452top14815414222| NAILS MAGAZINE| OCTOBER
2011138page 148166na1011toc.indd 22 8/25/11 12:21:25 PMHOLLYWOOD,
CA Welcome to the entertainment capital of the world and the place
the talented and beautiful ock to get discovered! Striking a pose
under the iconic Hollywood sign is a must when Touring America, and
be sure to pack your most glamorous attireyou never know who you
could run into.MODEL IS WEARING MY ADDRESS IS HOLLYWOODFor more
information, contact your local OPI distributor.Call 800.341.9999
2011 OPI Products Inc.CONTAINS NO DBP, TOLUENE, OR FORMALDEHYDE
COLORS FROM LEFT TO RIGHT:Are We There Yet?, I Eat Mainely Lobster,
My Address is Hollywood, Color to Diner For, Honk If You Love OPI,
Road House Blues, Suzi Takes the Wheel, French Quarter for Your
Thoughts, Uh-Oh Roll Down the Window, A-taupe the Space Needle, Get
in the Expresso Lane, I Brake for Manicuresna1011toc.indd 23
8/24/11 2:35:58 PM24| NAILS MAGAZINE| OCTOBER 2011} {in this
issueTechnique 7376Demos Step-by-steps from LCN and Angel
Love80Signature ServicesStep-by-steps for a Pumpkin Pedicure and a
Strawberries & Cream Spa Pedicure84Behind the ScenesFind out
how to do the nails that are on this months cover.86A Vibrating
Nail?Learn how to use simple, small, and inexpensive electronics to
make a fun nail art design that really shakes.Style 8994Nail Art
StudioStep-by-steps on new nail art designs96The Jewelry Nailist:
Fumic SueyoshiThis New York City-based nail tech combines jewelry,
nail art, and creative energy to produce stunning nail
masterpieces.100Monster MashInspired by this ghoulish time of year,
ve nail artists show of their fun designs and devilish skills as a
treat for you.102Boutique: Hair FeathersRemovable and easy to
apply, feather hair extensions give highlighted texture and
per-sonality to clients locks.84Business 105108 Reader to
ReaderOther than money, what would motivate you to work harder at
your current salon?110The Big PitchWhen you meet someone who is a
potential client, what do you say in a minute or less to introduce
yourself as a nail tech?114Nail Techs Dont Let Nail TechsSee what
your colleagues think you shouldnt let other nail techs do.118
Salon ProleGloss Nail Spa was the rst business to open in a newly
developed Milwaukee neighborhood.Health 127130Under the Microscope:
Brittle NailsSometimes called onychorrhexis or onychoschizia,
brittle nails peel, split, and break easily.132Its a Sore
SubjectSometimes aches and pain seem like an unavoidable byproduct
of doing nails. One nail tech disagrees.134Caring for Your Diabetic
ClientMake your salon a safe haven for clients with diabetes by
learning a few simple steps of added protection.136Secret
Ingredient: Base and Top CoatsA closer look at what makes base
coats and top coats work.28On My Mind30On Your Mind34Nails
File68Freebies & Giveaways70On The RoadIn Every
Issue118&ULLHEALTHBENEFITSINCLUDEDNOW HIRINGNAIL
TECHS!10896118100156Ad Index 170Reader Nail Art 174Product
Spotlight184Deal Sheet 198My Other Lifena1011toc.indd 24 8/25/11
11:14:02 AMYOUVE MET YOUR MATCHGEL INNOVATIONS FROM ORLY COLOR
EXPERTSAVAILABLE AT PROFESSIONAL BEAUTY SUPPLY STORES AND
SALONS.www.nailsmag.com//21168800.275.1111 orlybeauty.comFor a
manicure that lasts as long asyour pedicure, match ngers to
toeswith one of ORLYs 32 Gel FX shades. Matchy
matchy.na1011toc.indd 25 8/24/11 2:36:24 PMBrowse Halloween Nail
Art Ideas. Nail techs all over the globe are uploading photos of
their Halloween-themed nail art. Get free inspiration on our Nail
Art Gallery.http://nailartgallery.nailsmag.com/tags [Click on
Halloween]Aspire to be in the Top 25.Amy Becker has earned a spot
on NAILS Top 25 Competitors
listmoretimesthananyoneelse.Forour2010-2011 competition year, shes
snagged the top spot. Congratulations to her and to the industrys
entire top 25 nail competitors.www.nailsmag.com/top25byyear26|
NAILS MAGAZINE| OCTOBER 2011View Show Snapshots.For the second year
in a row brush-on gel polish lines were the talk of the nail world
at beauty trade show Cosmoprof North America. We have a gallery of
snapshots from the show including these gels and much
more.www.nailsmag.com/2011cosmoprofmag.com.comFind everything youre
looking for on www.nailsmag.com. Whether youre researching,
shopping, or designing, youll nd inspiration and answers at our
website.log on every day toHelp Fight Breast Cancer. October is
breast cancer awareness month. Find out what nail products are
donating part of their proceeds to this cause and get ideas for
nail art designs so you can raise awareness among your clientele.
www.nailsmag.com/2011beatbreastcancerand much more.Watch a Tutorial
of NAILS Cover Look. NAILStv features a step-by-step video of this
months cover nails, with our cover tech showing exactly how she
created this months stylish Shellac
look.www.nailsmag.com/Oct2011CoverVideoNails by Nail Art Gallery
member Oli12352topNAILCOMPETITORSna1011webTOC.indd 26 8/24/11
3:34:11 PMwww.nailsmag.com/fifi/21110na1011webTOC.indd 27 8/25/11
12:29:29 PM28| NAILS MAGAZINE| OCTOBER 2011}
{Imgettingkindoftiredofalltheseconsumerbloggers online who are just
infatuated with nail polish and post endlessly about polish and
doing their own nails. I mean,
sure,theyprobablyhelpincreasetheawarenessofnailcareand new products
(mostly polish), but I think its time for those of us on
theprofessionalsideofthenailworldtotakebackourplaceinthe pecking
order. Theyre even starting to inltrate my side of the nail world
as well I see as many bloggers taking meetings with manufacturers
and hanging out in the press room at trade shows as I do actual
journalists.Asnailtechnicians,YOUhavetheinuenceoveryourclientsto
sharethelatestcolortrendsandnailstyles.Whoknowsbetterthan YOU about
the differences in hybrid gels and what the right treatment for
peeling nails is. Dont cede your powerful professional inuence to a
bunch of polish junkies who are looking for free handouts of the
latest collections from manufacturers. OK, thats a little harsh.
But seriously, the professional side of our industry needs to stay
at the forefront and the DIY-ers need to take a small step back.
The bloggers are the new kids on the block and everyone is
fascinated with them. So how do you get your voice heard, you ask?
As an educated and licensed nail technician you can speak to
clients onalevelthatthepolishenthusiastscant.Youknowwhatservices
torecommend.Youknowwhatnailshapeandlengthlooksbeston each of your
clients. You know how the products work and why. You know the
latest colors, the coolest appliques, and the interesting new
techniques (because you read and go to shows and follow
professional bloggers). Ive got a couple ideas to help you reclaim
your position as the nail expert. >Start your own blog.>Use
your web page and Facebook page as a place where you can talk to
your clients about whats
hot.>Ifyoureanailartist,createaproleonNailArtGallery
(nailartgallery.nailsmag.com) and share it with your clients. >
Get in touch with the consumer press and offer your expertise for
nail style stories.
>PutyourownHotOffthePressesbooktogetherwithcolor swatches, nail
styles, and trends youre seeing from your fellow nail techs or in
your trade magazines. Heck, put stuff you nd on blogs
andinconsumermagazinesintheretoo,butpresentittoyour clients as you
being their go-to source for all things nail-related. If your
clients are getting the information from you, they wont have a
reason to get it elsewhere. I dont think consumer bloggers are bad,
and I certainly dont think theyre bad for our industry. Ive just
been thinkingthattheyretakingthenailcarespotlightfromthosewho
rightly deserve it YOU. Move Over, Bloggers!on my mindOctober is
Breast Cancer Awareness month, and you can find a number of
products supporting the cause on page 154. Give back while
supporting your industry. [email protected] na1011omm.indd 28
8/24/11 3:33:39
PMwww.nailsmag.com/fifi/xxxxxwww.nailsmag.com/fifi/21285na1011omm.indd
29 8/24/11 3:33:43 PM30| NAILS MAGAZINE| OCTOBER 2011 Publisher
Cyndy [email protected] Publisher Michelle
[email protected] Publisher/Editor Hannah
[email protected] Editor Sree
[email protected] Editor Judy
[email protected] Editor Tim
[email protected] Assistant Joanne
[email protected] Writers Michelle Pratt,
Erin Snyder DixonArt Director Danielle
[email protected] Art Director Ajay
[email protected] Artist Kimberly
[email protected] Manager Carla
[email protected] Sales ManagerMichelle
Mullen, (310) [email protected] Sales
ManagerMary Baughman, (562)
[email protected]/eMedia Coordinator Myla
[email protected] Marketing Manager Katie Fillingame
For subscription inquiries: (888) NAILS-44,
[email protected] business and editorial correspondence
to:3520 Challenger St., Torrance, CA 90503(310) 533-2400(310)
533-2507 Faxwww.nailsmag.comChairman Edward J. BobitCEO/President
Ty F. BobitChief Financial Ofcer Richard E. Johnson A BOBIT
BUSINESS MEDIA PUBLICATIONLogontowww.nailsmag.comtoanswer this
months question and check back here to see what other nail techs
have to say.} {on your mindEditors Note: You can nd complete
industrystatisticsatwww.nailsmag.com/market-research.Wehavethe last
six years worth in ipbook format orPDFifyoudliketodownloadthe
information.Youllndeverything fromsizeoftheindustrytonailtech
demographics to stats on income and buying habits of nail techs.
>>>LOOKINGFORSTATS Ijustlove
NAILSMagazine.Thankyouforagreat publication. I am in the process of
writing abusinessplanforanewcompanyIam
foundingandIwaswonderingifyou areawareofanyfabulousnailindustry
statistics that I could include in my plan? Heather HillFrenchies
Nail Salon, Littleton, Colo.WHAT DO YOU BARTER?Editors Note: Our
very own FingerNailFixer bloggerHollySchipperspostedablogabout
barteringservicesafterbarteringasetof
Shellactoenailswithahairdresserforahair treatment. And we asked our
60,000 Facebook fans(www.facebook.com/nailsmag)what
kindofthingstheyveeverbartered.Heres what they had to say:Kandice
Astamendi:I have a personal trainer who I barter with.Tera Uphaus:I
barter mani/pedis for facials once a month! Soooo worth it!Hilary
Knight OKonski:Barter is my middle name. Im getting a logo done now
for barter! Michele Ann Galbo:I have bartered for personal
training, laser hair removal, massage, and hair services. I just
love to barter!Sandi Tomlinson:One time I bought a car and traded
manis and pedis to pay it of. It took one year but it was so worth
it. And the customer loved it. She didnt pay for any salon services
for a whole year.Bri McCloud:I trade services with my friends for
various things. Ive bought videos, makeup, gifts for showers, all
through barter. Why trade cash when that person is just going to
give it back to you for her service?Patricia Knox Mullins:Yes, I
love to barter! I have bartered for clothes, tax preps, and many
other things! Its a great way to work!Melissa Messmer-Golia:I trade
nails for my funky colored hair and cuts! I also traded nails for
dog-sitting this summer.na1011oym.indd 30 8/24/11 3:36:00 PMSCAN.
WATCH. LEARN. cnd.comSAYGOOD-BYE2011 Creative Nail Design,
Inc.na1011oym.indd 31 8/24/11 10:39:23 AM32| NAILS MAGAZINE|
OCTOBER 2011EditorsNote:Ifyouarentalready
signeduponourNailArtGallery (nailartgallery.nailsmag.com), what are
you waiting for? With more than 7,000 artistprolesandmorethan40,000
How can I get ahold of T4 Spa? I would love to order some of their
stretched canvas murals.Nancy CarrollVia e-mailEditors Note: You
can reach T4 Spa Concepts and Designs
at(866)556-2372orwww.t4spa.com.Werecommend usingtheDealerLocatoron
the site to nd a dealer in your area.YoucanalsotryAlfalfa
NailSupply,whichoffersthe
samecanvasmurals,atwww.buynailsdirect.com. Im a busy Albany
Technical College student, but I have a passion, studying in the
daytime and doing nails by night! Every chance I get, I take the
opportunity to read NAILS Magazine. It always helps me to increase
my skills and knowledge. Whether I am on the public transit or at
school Im reading NAILS, loving every minute of it!Sharmegan
KearsonTru Expressions Salon & BoutiqueAlbany, Ga.Do you have a
picture of yourself reading NAILS? Send a pic to
[email protected] and make sure to include your name, salon
name, city, state, and a brief synopsis. Online-based printing
service (like vistaprint.com)A local professional printer My own
at-home or at-work printer Other I dont have business cards
56.5%17.7%10.9%2.7%12.2%Where do you get your business cards
printed?Where in the worldis NAILS Magazine?ICadWisWEB POLLIN
SEARCH OF CAREER HANDBOOKI absolutely adore NAILS Magazine and
lookforwardtoiteverymonth.Iwant to order the 2011 Career Handbook.
Is there a fee for this?Brittany Noel HendersonRock Hill,
S.C.Editors Note: Thanks Brittany. The NAILSCareerHandbookisagreat
toolforgraduatingstudentsandnew nailtechs.Youcannditonlineat
www.nailsmag.com/career-handbook oryoucanorderthemagazinefrom
[email protected] ART LOVE I love Nail Art Gallery! I
couldnt live without it. I check for new photos every day. Thanks
for providing such a nice space to share.Kjersta LundeVia
e-mailPsssstSend your comments to [email protected] or send us a
letter via snail-mail to Hannah Lee, 3520 Challenger St., Torrance,
CA 90503. (NAILS Magazine reserves the right to edit letters for
space and clarity. Please include your name, address, phone number,
and e-mail address.)Log on to www.nailsmag.com to answer this
months question and check back here to see what other nail techs
have to say.} {on your mindWhere can I purchase Dashing Diva French
Wraps? Im in the United Kingdom.Elizabeth SteenVia
e-mailEditorsNote:TheU.K.dis-tributorofDashingDivaprod-uctsisBeauMonde/Dashing
DivaU.K.Youcanreachthem atwww.dashingdivauk.comor 44 (0) 1332
541299.WHERE CAN I FIND?nailartphotos,itsanynailtechsbest
friendforinspirationandsharing.You cansetupyourownproleforfree,
createaprole,andstartsharingyour nail art right away.
Enjoy!na1011oym.indd 32 8/24/11 3:36:15 PMSAY HELLOTO CND SHELLAC.
Now in 30 gorgeous shades. Layer them to create dozens more!SCAN.
WATCH. LEARN. cnd.com2011 Creative Nail Design, Inc. On Like Polish
Wears Like GelOff In Minutes (Really!)UV3 Technologypatent
pendingna1011oym.indd 33 8/24/11 10:39:36 AM34| NAILS MAGAZINE|
OCTOBER 2011When she painted this years winning self-portrait,
Tulsa, Okla.-based Jing Wilson was still a student at Jenks Beauty
College. Now a new tech at Ihlof Salon and Day Spa, Wilson took
three hours to paint her entry to NAILS 2011 Self-Portrait Contest.
Although shes new to nails, she boasts a ne arts degree from
Chengdu School of Culture and Arts in her native China. This type
of miniature work takes a lot of concentration and pushing
yourself, she says. My parents always pushed me to rene my art.
They always expected the best from me.Congratulations to Wilson and
thanks to everyone who entered.Praise for the Self-Portrait Contest
Winner} {nails fle1st place2nd place3rd place4th placeIts artwork
like this that earned this years Self-Portrait winner, Jing Wilson,
a degree in ne arts.Salon Iris Picks a PartnerSalon Iris salon
software is partnering directly with Dell to offer customized
hardware and computer packages. Salon Iris has worked closely with
Dell to test and offer hardware packages that are designed
especially for all of the various sizes of salons.We want to make
it easy for you to get your salon up and running or to convert to a
new automated solution, says Christianna Jackson, vice president of
DaySmart Software Inc., makers of Salon Iris software.For more
information, visit
www.saloniris.com/dell.aspx.DuriCosmeticshasafree
nailcolorandtreatment appforAndroidandiPhone mobiledevices.Fanscan
convenientlybrowseontheir mobile devices and try on any Duri nail
shade virtually.>>> JING WILSONTulsa, Okla.KAMBER
GRAHAMCaddo Kiowa Technology Center, Fort Cobb, Okla.JESSICA
AUBINInternational Beauty School, Martinsburg, W.Va.TANYA ROSSUC
Nails & Tanning, Fayetteville, N.C. na1011genNF.indd 34 8/24/11
10:43:04 AMFind us on:CONTAINS NO DBP, TOLUENE, OR FORMALDEHYDE
Call 800.341.9999 2011 OPI Products Inc.LETS SHATTERBREAST
CANCER!In support ofBreast Cancer Awareness Month, OPI has made a
donation to Susan G. Komen for the Curein the U.S. and to Rethink
Breast Cancer in Canada.PINK OF HEARTS2011 EDITION shatterOPIS NEW
shatter SHADE FOR BREAST CANCER AWARENESS MONTHA warm shade of pink
that creates a bold, inspiring two-texture effect when applied over
two coats of completely dry nail lacquer. Finish with Top Coat for
high-gloss shine!na1011genNF.indd 35 8/24/11 10:43:11 AM36| NAILS
MAGAZINE| OCTOBER 2011Before she was a nail tech, Ena Rodriguez was
a tarot-reading gypsy at Universal Studios Orlando. Thats where she
rst came across the art of henna tattooing. I was curious so I
decided to nd out more about it, says Rodriguez. In the process I
absolutely fell in love with henna (or mehndi as its also known),
its meaning, beauty, and art. All her work is freehand, which means
she doesnt use stencils.Now a new nail tech working at Orlandos
Kokopellis Salon and Spa, shes nding out that nails and henna are
remarkably complementary services. Henna is used for celebrations
and positive things landmarks in peoples lives, like birthdays and
weddings, she says. I absolutely love the one-on-one relationship
with my customer and the opportunity to create a unique piece of
art on someones skin knowing that person is going to wear it.
Through henna I have encountered wonderful and amazing people as
well as their cultures.Now that Im a nail tech, I am able to ofer a
complete package to my brides that includes hand and foot services
along with henna. Its also a natural t during the summer when
sandals beg to be worn. My goal, as my tag line reads, is Beauty at
your hands and feet. Nails and Henna Go Hand in HandBeUnhesamfthe
oppor} {nails fle>>> A Postcard from the Smokies
Virtuallydoublinginsizefromthepreviousyear,thefourthannual Nail
Tech Networking Event of the Smokies, held on June 26-27 at the
River Terrace Resort in Gatlinburg, Tenn., saw 150 attendees enjoy
the 23 nail
boothsand50+educatorswhodemonstratedcuttingedgetechniques,with
manydebutingnewnailproducts.Makinganappearanceforthersttime
wereLightElegancesJimMcConnell,aswellasHakenProfessionalsScott
Haken and Atwood Industries Bruce Atwood.
AttendeesalsowelcomedcompetitionjudgeCarlaCollierandcoverartist
RachelMouritsenofINM,whileMasterworksAmyBeckerjoinedinforthe fourth
time. She amazed the crowd with her elaborate booth set up,
complete with chandelier and intricate colored gel designs, while
Carla and Rachel did incredible, cover-worthy nails on some lucky
people, says event organizer Jill Wright. Nail techs were thrilled
by the surprise visit from OPIs John Hauk, who ventured down to the
Smoky Mountains to see what the event was all about, plus get a
little R&R.
GuestspeakerJanetMcCormickgaveatalkaboutmedicalpedicuresandtheir
place in the salon and held a class on that subject the following
day.Next year, the event will be held in the downtown Gatlinburg
Convention Center on June 24-25. Watch for details on Facebook at
Nail Tech Networking Event of the Smokies and at
www.nailtechevent.com. 13421. Amy Becker (left) and Kira Frazier
set up the Masterworks by Amy Becker booth. 2. Smokies event
organizer Jill Wright (right) poses with Sangeeta, who came all the
way from India to attend. 3. This years turnout led to plans to
make the event even bigger
nextyear.4.TheYoungNailsboothwasmannedbyAdrienne Schodtler, Regan
Brodt-Richardson, and Teresa Carter.na1011genNF.indd 36 8/24/11
10:43:14
AMForalimitedtimeonly,CuccioNaturalsbest-sellingnon-oily8oz. Butter
Blends are now available in a try me travel-friendly 1.5 oz. size.
If you havent tried it, now is the time to experience what has made
Cuccio Natural Butter Blends the beauty professionals top choice
for ultimate skin
hydration.cuccio.comfacebook.com/cucciospaPomegranate &
Fig#719448 Try the 1.5 oz. Butter BabiesLimited Time OnlyOnly
each$299Available through BSG sales consultants or CosmoProf
stores. Not all products available in all areas. US pricing only.
Visit cosmoprofbeauty.com or call 1-800-362-3186 (BSG East) or
1-800-544-9227 (BSG West).1ry t/e t., o:. Batter Baby u/t/ B/g
Batter
Beneft!,QWHQVH+\GUDWLQJ1RQ2LO\%XWWHU%OHQGV(QULFKHGZLWK9LWDPLQVDQG1XWULHQWVIRU6LON\6PRRWK6NLQIeea
1oarDry S//n!Fits easily into your purse foron-the-go instant
hydration!www.nailsmag.com/fifi/21102na1011genNF.indd 37 8/25/11
5:36:59 PM38| NAILS MAGAZINE| OCTOBER 2011No Lift Nails Cuticle Oil
brings together three of natures richest ingredients: Avocado,Oil,
Almond Oil and Vitamin E. The result is a superb natural oil that
conditions nails and softens skin with a single drop.Our unique
formula wont promote lifting. After all, its from No Lift Nails,
the industry leader for three decades.Available in 1/8 oz, 1 oz and
4 oz size, No Lift is a naturally rich cuticle oil for your
customers and a rich source of profits for
you.www.nailsmag.com/fifi/21249LefttorightareSarahFlood,VirginClubhouse
supervisor (Heathrow); Larry Byrne, Virgin Clubhouse
host;KellyClarke,Clubhousesupervisor(Gatwick), and Kay Pennington,
Sweet Squared sales
emissary.VirginAtlanticnamedCNDsShellacshadeWildretheofcialnail
colorforitsightattendants.Siren-redWildreShellaccoordinates
perfectly with their uniforms and promises two-week, round-trip
wear with no chipping, smudging, or dulling. And Shellac is not
just for the ight crew Virgin also now offers free manicures in its
Clubhouse loungestorst-andbusiness-classpassengers.Ithasadded
Shellac to its service menu as an upgrade option in its Clubhouse
at Heathrow and Gatwick. The service includes a take-away pack with
Solar Oil, one package of Shellac remover wraps, and a bottle of
acetone, along with consumer marketing
materials.Shellacwasthenumber-onerequestedpaidserviceinthe
LondonVirginAtlanticBusinessloungelessthantwomonths
afterbeinglaunchedonMay1.Asabonus,theightattendantsallsaythat they
have had amazing compliments on their nails and are all really
happy to be wearing Shellac.Shellac Is Flying HighStarry, Starry
NightNAILS received several versions of Van Goghs iconic painting
when we called for entries to our annual Mini Masterpiece contest.
Do you have a favorite?for entries to our annual Mini MYou can see
past mini-masterpieces at www.nailsmag.com/minimaster.Samantha
HartBarbourville, Ky.Stephanie SchoolcraftMontgomery, W.Va.Angela
PirowskiPrattsburgh, N.Y.Jamie Valentine-HessGreencastle,
Pa..comna1011genNF.indd 38 8/24/11 10:43:28
AMwww.nailsmag.com/fifi/21285na1011genNF.indd 39 8/24/11 10:43:35
AM40| NAILS MAGAZINE| OCTOBER
2011www.nailsmag.com/fifi/21232InJune,celebritynailstylistZoe
VokisMinxedMileyCyrusforthe AustralianlegofherGypsyHeart tour.
Miley wanted something really specialanduniqueforherngers
andtoesandhadalreadyaskedifI
couldprovideMinx,saysSydney-basedVokis.Mileychoseavariety
ofpatterns,includingSkulland Crossbones,MinxLusionFishnet,
andtheMetallicUnionJack,but Ialsousedalayeringtechnique combining
Yellow Chrome with Minx SnakeSkintocreateacompletely unique accent.
The end result was a wild and funky look that Miley loved, saying
it totally rocked!Life After Hannah Includes MinxNetwork in the
Northwest Education in the Northwest can be hard to come by and to
solve this problem ve years ago a group of nail techs got together
to sponsor an educational networking event. Since then the event
has grown into the four-day, one-of-a-kind Northwest Nailtechs
Networking Retreat. Set for October 14-17, this years event is
jam-packed with education, seminars, and lots of fun at a beautiful
waterfront retreat center outside Seattle.The fee of $439
includes:> Lodging and all meals >Transportation from the
airport to the retreat center> Tradeshow >Demo classes and
four- to six-hour hands-on workshops >Seminars including
marketing and busi-ness improvement>Entry to all competitions,
which result in cash prizes> Raf e tickets for prizes valued up
to $350> Goodie bag of free products and information For more
information, go to www.nwnailtechs.com or e-mail
[email protected]. ent-a-kindna1011genNF.indd 40 8/24/11
10:46:06 AMVS_sept_octinsert.indd 1 8/26/11 2:34:37
PMwww.chinaglaze.comwww.chinaglaze.comChina Glaze wishes you a
holiday season lled with glittering, shimmering,ravishing
colour.VS_sept_octinsert.indd 2 8/25/11 3:59:33 PM1c - crmeg -
glitters - shimmerRing inthe Red (g)80519Winter Berry
(c)80518Velvet Bow (c)80517GlitteringGarland (g)80516Holly-Day
(c)80515ChampagneBubbles (g)80514TwinkleLights (g)80513Snow Globe
(g)80435Icicle (s)80523Tinsel Town (g)80522BlueYears Eve
(s)80521Poinsettia (c)80520VS_sept_octinsert.indd 3 8/25/11 3:59:34
PMwww.chinaglaze.com 2Includes:Twinkle Lights, Champagne Bubbles,
Holly-Day, Glittering Garland, Velvet Bow, Winter Berry,Ring in the
Red, Poinsettia, Blue Years Eve, Tinsel Town, Icicle and Snow Globe
Item# 81047Let it Snow12 Piece Counter
DisplayVS_sept_octinsert.indd 4 8/25/11 3:59:36
PMwww.chinaglaze.com ww www.chin 3Includes 3 of each: Row 1 (left
to right) Twinkle Lights, Champagne Bubbles, Holly-Day, Glittering
GarlandRow 2 (left to right) Velvet Bow, Winter Berry, Ring in the
Red, PoinsettiaRow 3 (left to right) Blue Years Eve, Tinsel Town,
Icicle, Snow Globe Item# 81048Let it Snow36 Piece
RackVS_sept_octinsert.indd 5 8/25/11 3:59:36 PMwww.chinaglaze.com
4BELLE OF THE BALLGift set includes:Champagne Bubbles, Tinsel Town
and a Festive OrnamentItem# 81035Dazzle with a decorative
touchFestive OrnamentVS_sept_octinsert.indd 6 8/25/11 3:59:37
PMwww.chinaglaze.com 5SEASONAL SPARKLESGift set
includes:Poinsettia, Holly-Day and a NEW Limited Edition Holiday
Glitter PolishItem# 81038Holiday shine!Limited Edition:Twinkle
LightsVS_sept_octinsert.indd 7 8/25/11 3:59:37 PMwww.chinaglaze.com
6MEET ME UNDER THE MISTLETOEGift set includes:Ring in the Red,
Velvet Bow,Glittering Garland and Lip LacquerItem# 81042Kiss of
colour!Lip Lacquer10 mL .34 ozVS_sept_octinsert.indd 8 8/25/11
3:59:38 PMwww.chinaglaze.com 7Everyone loves adorable minisSANTAS
LITTLE HELPERSGift set includes:9.6 mL .325 oz minisRing in the
Red, Holly-Day, Twinkle Lights, Velvet BowItem#
81045VS_sept_octinsert.indd 9 8/25/11 3:59:38 PMwww.chinaglaze.com
8LET IT SNOWGift set includes:Blue Years Eve, Snow Globe and a Mini
Snow GlobeItem# 81039All a urry!Mini Snow
GlobeVS_sept_octinsert.indd 10 8/25/11 3:59:39 PMwww.chinaglaze.com
9HOLIDAY SPIRITSGift set includes:Icicle, Champagne Bubbles,
Glittering Garland and a Pewter Bottle StopperItem# 81040Dont stop
the funPewter Bottle StopperVS_sept_octinsert.indd 11 8/25/11
3:59:39 PMwww.chinaglaze.com 10BERRY SWEETGift set includes:Velvet
Bow, Ring in the Red and a Holiday Berry Moisturizing LotionItem#
81037Delightfully festive!Limited Edition:Holiday Berry
Moisturizing LotionVS_sept_octinsert.indd 12 8/25/11 3:59:40
PMwww.chinaglaze.com 11BABY ITS COLD OUTSIDEGift set
includes:Icicle, Blue Years Eve, Poinsettia and Fingerless
GlovesItem# 81041Keep cozy...while aunting a fabulous
maniFingerless GlovesVS_sept_octinsert.indd 13 8/25/11 3:59:40
PMwww.chinaglaze.com 12DECK THE HALLSGift set includes:Glittering
Garland, Champagne Bubbles and a Limited Edition Cuticle OilItem#
28931Fa la la la la....La la la la!Limited Edition:Holiday Berry
Cuticle OilVS_sept_octinsert.indd 14 8/25/11 3:59:41
PMwww.chinaglaze.com 13WINTER ICEGift set includes:Blue Years Eve,
Tinsel Town, Icicle, Snow Globe and a Snowake Charm NecklaceItem#
81043Winter Ice and everything nice!SnowakeCharm
NecklaceVS_sept_octinsert.indd 15 8/25/11 3:59:42
PMwww.chinaglaze.com 14HOLLY BEAR-YGift set includes:Holly-Day,
Winter Berry and your very own Holly BearItem# 81036Your new
B.F.F.(Bear Friend Forever)!Holly BearVS_sept_octinsert.indd 16
8/25/11 3:59:42 PMwww.chinaglaze.com 15CARRY ME AWAY FOR THE
HOLIDAYSGift set includes:Tinsel Town, Poinsettia, Velvet Bow,
Icicle and a Manicure Carrying Case with Nail FileItem# 28930Arrive
in styleManicure Carrying Caseand Nail FileVS_sept_octinsert.indd
17 8/25/11 3:59:43 PMwww.chinaglaze.comSalon Gift Giving
Complimentary gift bags make it the perfect client holiday favor.24
gift bags included with each displaywww.chinaglaze.com 16LIL
STUFFERSMini Holiday Berry Cuticle OilItem# 81046Perfect for
everyone on your list!24 Piece DisplayVS_sept_octinsert.indd 18
8/25/11 3:59:44 PMwww.chinaglaze.comVS_sept_octinsert.indd 19
8/25/11 3:59:44 PMwww.chinaglaze.comAmerican International
Industries, Los Angeles, CA 90040.China Glaze Nail Care Cosmetics
and the CG logo are RegisteredTrademarks of AII Printed in USA
14-7137 2011International$2.00VS_sept_octinsert.indd 20 8/25/11
3:59:45 PMwww.nailsmag.com/fifi/21119na1011genNF.indd 61 8/25/11
5:05:09 PM62| NAILS MAGAZINE| OCTOBER 2011SHOWcoverageFor the
second year in a row brush-on gel polish lines were the talk of the
nail world at Cosmoprof North America. The game-changing nail
category has steadily helped to reinvigorate the nail industry over
the last year since its initial introduction. In addition, we saw
some cool new nail art applications and advances in the pedicure
chair world. Cosmoprof North America, held July 31-August 2 at the
Mandalay Bay in Las Vegas, brought more than 760 exhibitors to
almost 25,000 attendees that included importers, distributors,
manufacturers, and global beauty leaders. The show, which is a
diferent format than your usual cash-and-carry beauty show, ofers a
unique opportunity for distributors and manufacturers to connect,
see new product lines, and conduct meaningful business meetings.
This year, a new aspect to help everyone stay connected during the
show was added by using Foursquare. Prior to and during the event,
attendees and exhibitors shared where they were on the show oor and
took advantage of show specials that were only available to users
by checking in on their phones or hand-held devices. Next years
show will be held July 22-24 at Mandalay Bay Convention Center in
Las Vegas. NAILS associate publisher Michelle Mullen got a chance
to try out Orlys new GelFX gel polish from Sarah Andersen.New and
Old Friends Come Together at Cosmoprof in Las Vegasors shared where
they wereStar Nail received a Partners in Progress award from Sally
Beauty at the distributors annual breakfast. From left to right are
Sue Davidson, Sally Beauty group vice president of merchandising;
Tony Cuccio, CEO of Star Nail; Elaine Watson, Star Nail vice
president of marketing and sales and director of education;
Christina Jahn, Star Nail director of marketing; and Linda Voracek,
Sally Beauty senior director of nail products.In addition to all of
his regular products, Noubar Abrahamian showcasedKatie Cazorlas The
Painted Nail line of polish and hand
treatments.>>>COSMOPROF LAS VEGAS} {nails fleRocio Jimenez
at Republic Nail showed NAILS sales manager Mary Baughman the
companys line of glow-in-the-dark polish and acrylic, which were a
big hit at the show. NAILS senior editor Tim Crowley got a chance
to discuss polish trends and music with Zoyas own Zoya Reyzis.In a
special partnership, Super Relax Zero-Gravity chairs are now
available with Gulfstreams pedicure spas. Gulfstream is also
ofering these unique room dividers and backdrops for salon
purchase.NSIs Staci Noble and Rick Slack have a few new products up
their sleeves. Keep your eyes open for new things from the
enhancement company.Dashing Divas Nancy Waspi, Pattie Yankee, and
Anna Lee showed us the companys new DesignFX nail
application.Yvette Holt (right) demonstrates LeChats Perfect Match
gel polish. na1011show.indd 62 8/24/11 10:25:30 AMNEW NEWDS
TEMPTATION & DS BOLDNEWCONTAINS NO DBP, TOLUENE, OR
FORMALDEHYDE Nail Lacquers feature OPIs exclusive ProWide Brush
(Patent pending). Call 800.341.9999 2011 OPI Products Inc.CONFIDENT
ELEGANCE. SEDUCTIVE GLAMOUR.Style for Fall 2011 is all about
dazzling color.New DS temptation and DS bold from Designer Series
by OPI complement this falls fashion season brilliantly with the
seductive glamour of the Designer Series diamond-dust
formulation.DS extravagance DS glow DS reserve DS opulence DS
reection DS classic DS mystery top coat DS temptationSHOWNDS magic
DS radiance DS boldSHOWNna1011show.indd 63 8/24/11 10:25:50 AM64|
NAILS MAGAZINE| OCTOBER 2011SHOWcoverageCOSMOPROF LAS VEGAS} {nails
fleContinuums Joe Galati holds a slab of high-grade terreon, an
extra strong material that the basins of the Maestro spa are made
of. Grahams Dan Hnilicka shows us the companys new HandsDown Nail
Wraps that can be used to efortlessly remove gel polish.Vicki
Heller, Ellen Ambrecht, and Dee Nguyen are excited about Entity One
Color Couture.Kupas uPower has new plastic slipcovers available to
help keep dust from getting into the machine.Barbicides Alan
Murphy, Leslie Roste, and Kevin Schuele are dedicated to salon
sanitation and cleanliness.Emmett and Beth Hickey look on as a
Marilyn Monroe lookalike sings Happy Birthday to Hand & Nail
Harmonys Danny Haile.Jessicas own Jessica Vartoughian is happy to
showcase her gel polish line, Geleration.Orly founder Jef Pink was
on hand to meet with distributors about Orly and SpaRituals
ever-expanding lines of natural nail care.Lisa and Greg Minuto
discussed the benets of using Prolanas natural nail treatments and
nail color.Luan Nguyen, Andy Nguyen, Kathy Phan, Dat Ton, and Hien
Ton were busy at the Alfalfa booth showcasing the companys GelArt
line.EOH Industries Emmett and Beth Hickey host the annual Hickey
Poker Showdown, a charity poker
tournament.caThiswastherstyearYoungNails hadaboothatCosmoprof.Ramon
Hernandez,TomHuynh,GregSalo, and Tracey Reierson were quite happy
with the outcome of their meetings.>>>na1011show.indd 64
8/24/11 10:27:06 AMBrush.Wear.Soak.Repeat.2011 Entity Beauty Inc.
entitybeauty.comModel is wearingWalk The Runway.
Entity OneColor Couture. Forget everything you know
aboutmanicures andtake your artto the next level.Weve combined the
long-lasting, high-gloss durability of gel with the ease and
versatility of enamel.No smudging,no chipping,and no dry time.Its
everything you love about color. Only
better.www.nailsmag.com/fifi/21131na1011show.indd 65 8/24/11
10:27:22 AM66| NAILS MAGAZINE| OCTOBER 2011NAILS Hannah Lee,
Dashing Divas Pattie Yankee, salon owners Maisie Dunbar and Katie
CazorlaNAILS Hannah Lee mans the bar.NAILS Mary Baughman with
Nubars Noubar Abrahamian, and Khatchig ArakelyanStar Nails Arica
Carpenter and NAILS Tim CrowleyVicki Peters and Medicools Steve
WallaceSHOWcoverageCOSMOPROF LAS VEGAS} {nails fleNAILS hosted a
happy hour during Cosmoprof on Monday, August 1, attended by a
number of professional nail care manufacturers, educators, and
other noted guests in the industry. It was a great time to relax
after the show, enjoy some cocktails and snacks, and mingle with
others who normally dont have a chance to get together. Happy Hour,
Happy Manufacturers, Happy NAILSStar Na r Naand NA nd
NAWallaceEuropean Touchs Sheila Newkirk and Dawn Holz with NAILS
Mary Baughman (center)Prolanas Lisa Minuto and Donna Louis with
LeChats Patti DiMarbieuxStar Nails Tony Cuccio, NAILS Cyndy
Drummey, Sweet Squareds Samantha Sweet, and Backscratchers Michael
Megnana1011show.indd 66 8/24/11 10:30:51 AMOCTOBER 2011 | NAILS
MAGAZINE | 67 Kupas Sarah Smith and Robert Authur Spilos Sally
Ferguson and Susan LewisBelavas Vladimir and Natalie Zolotnik with
Famous Names Linda NordstromThe Painted Nails Katie Cazorla, Young
Nails Greg Salo, and Dashing Divas Pattie YankeeNSIs Rick Slack and
NAILS Cyndy DrummeyKupas Richard HurterNSIs Christel De Cock, Staci
Noble, and Isabel FisheriNails Robert Powell and guest with NAILS
Michelle Mullen SNCRED PRs Julia Labaton, NAILS Cyndy Drummey, and
CNDs Herman PaezSweet Squareds Samantha Sweet and Sam Sweet with
salon owner Masie Dunbar (center)na1011show.indd 67 8/24/11
10:31:21 AM68| NAILS MAGAZINE| OCTOBER 2011Get the Top Deals of the
WeekNAILS Top Deals e-newsletter arrives in your inbox every Friday
with terric ofers on a whole variety of products. Be on the alert
for special pricing, exclusive discounts, and free bonuses. If
youre not already receiving Top Deals, go to
www.nailsmag.com/enews/signup.Go to www.nailsmag.com/freebies to nd
web-exclusive giveaways.freebiesgiveaways!{and}.comReceive a Free
DVD from Cuccio NaturalDouble your spa service business with an
informative, educational DVD from Cuccio Natural. The Spa
Techniques & Treatments DVD helps nail techs keep up with the
latest techniques and services, introduces the three levels of
services of manicures and pedicures, and includes business-building
tips from Tony Cuccio. To receive your DVD, e-mail [email protected]
with free DVD in the subject line.Dashing Diva Introduces Metallic
Crackle NailsCrackle nails are the latest addition to the Dashing
Diva Metallic Nails collection. Four readers can win a pack of
Metallic Crackle Nails (in Purrrfectly Pink, Call of the Wild,
Heavy Metal, or Animal Instincts) and a bottle of Tailor Bond, a
thick, exible adhesive used for application. The four bold designs
allow nail technicians to provide clients with an edgy alternative
look and new fashion-forward manicure service option. Technicians
will enjoy the fast application and simple soak-of removal, while
clients will experience a light, comfortable wear with some ash
that lasts for up to one week. Congratulations to Augusts
WinnersSix readers received a Footlogix Pediceuticals Salon Starter
Kit and 25 readers received a bottle of Crazed Expression Crackle
Nail Polish.To enter to win, go to www.nailsmag.com/freebies by
October 31.The Nail Superstores SuperSonic3 Professional Is
Powerful, QuietBe the lucky recipient of a SuperSonic3 Electric
Nail File Machine from The Nail Superstore. Designed for
professional nail technicians, this high-speed electric nail le
makes easy work of ling, shaping, and shortening nails. Features
include a forward/reverse switch, a lightweight, vibration-free
hand piece with an easy-to-use twist/lock chuck that allows nail
technicians to change bit heads quickly, and variable speed control
up to 25,000 RPMs. Speed can be controlled manually or with the
included foot pedal.GDWeiFriday with terric oferna1011freebies.indd
68 8/24/11 10:48:19 AMExtraordinary style deserves extraordinary
protection. CNDs award-winning Base Coats and Top Coats extend the
life of Nail Colour so your clients get more mileage from their
manis! SEALYOUR STYLE.cnd.com2011 Creative Nail Design,
Inc.na1011freebies.indd 69 8/24/11 10:48:23 AM70| NAILS MAGAZINE|
OCTOBER 2011} {Posh Nails BKon the
roadFROMNUMBERSTONAILSDuringher10
yearsbuildingacareerinnance,TerriStreat had a passion for the
beauty industry. In 2010, sheredirectedherpathtoopenasalonin
Brooklyn.Armedwithherbusinessmanage-ment skills and a newly
acquired license in nail technology, Posh BK opened its doors in
March 2011.StreatrecruitedDebraPakeman,along-time friend and nail
tech, who moved across the country to help manage the salon.
Pakeman is apivotalpartofthebusiness,providingover
15yearsofindustryexperience.Pakeman
performedmyultra-relaxingCNDTantalizing Citrus Spa Manicure, topped
with OPI Shatter.ASALONGROWSINBROOKLYNWhen
lookingforalocation,StreatfoundCrown Heights to have many signs of
revitalization: a gentrifyingareawithamixofyoung,old,and new
families; recent growth in small businesses; and residents with a
desire to patronize locally. Streat answered that need with Poshs
menu of naturalnailcareandwaxingservices.Clients are greeted by
Poshs brick interior, which was preserved from the buildings
original architec-ture.Thespacewasdesignedtobefamiliarto clients
who live in the brownstones Brooklyn is known
for.SANITATIONANDSWEETSInherresearch,
Streatfoundthatforotherlocalnailsalons,
sanitationseemedlowonthelistofpriorities.
AtPosh,everyimplementisdoublesanitized,
ordisposedof,andeachclientleaveswitha
charminglywrappedcarepackageincluding
le,pusher,andbuffer.Streatoptedforpipe-lesspedicurespasandthestaffexplainsthe
benetstonewclients.Still,asimportantas sanitation is at Posh, there
is no lack of fun: the dryingcounterhascandybowls,encouraging
clients to leave with a little something sweet.> On the day I
visited, Posh was the venue of a Pretty Little Princess Spa Day.
Little ladies brought in by moms and family members
weregivenacomplimentarymanicure orpedicureandtreatedtocupcakesand
refreshments.TheprincessesofCrown Heightsleftwithsparklingtiarasand
brightly colored ngers and toes.> Streat and Pakeman are keenly
aware of the tandemrelationshipbetweenmarketing and networking.
Streat believes in a grass-rootsapproachtoreachingclientswith
community events and co-op promotions.
Yettheyarealsoawareofthepartsocial
networkingplaysinthesuccessofanew
business.Clientscanfollowthesalonon
TwitterandlikeitsFacebookpagefor informationonupcomingevents,new
products, and service
specials.>TheCrowHillCommunityAssocia-tionprovidedtheplanterthataccents
thesalonsstorefront,oneofthemany
waysthe25-year-oldorganizationshows support for up-and-coming
businesses.MENU HIGHLIGHTS CND Tantalizing Citrus Spa Manicure:
$25; CND Shellac or Hand & Nail Harmonys Gelish Gel Color
Manicure: $35; Cool Mint Spa Pedicure: $40; Little Miss Manicure:
$10; Little Miss Pedicure: $15 PRODUCT HIGHLIGHTSPolish: OPI,
Essie, China Glaze, Zoya Gel Polish: CND Shellac, Hand & Nail
Harmonys GelishMani/Pedi Products: CND, OPI www.poshnailsbk.comPosh
staf members from left to right are Jacyna Murray,
NikkeyaSpence,TifanyGeorge,KenyattaJoiOfutt, Debra Pakeman
(manager), and Terri Streat (owner)..comFUN FACTS Open for less
than a year, this urban chic salon has a cool vibe that meshes well
in its up-and-coming Brooklyn neighborhood.BY CARLA
BENAVIDEZna1011otr.indd 70 8/24/11 3:36:57
PMwww.nailsmag.com/fifi/21104na1011otr.indd 71 8/25/11 2:18:38
PMSOAK-OFF GEL LACQUER SYSTEMPolish on and UV cure for results that
are nothing short of brilliant!Color lasts up to two weeks or more
in a service that will keepclients coming back for more of the
affordable luxury of OPI!Call 800.341.9999 or visit www.opi.com
2011 OPI Products Inc.Axxium Soak-Off Gel System is for
professional use only.Average cost per set is $1.33AVAILABLEIN 50
FAVORITE OPI SHADESna1011techNF.indd 72 8/24/11 3:12:45 PMOCTOBER
2011 | NAILS MAGAZINE | 73 TECHNIQUE }These Zebras Are Wild
Ifyourelookingtoletloosewithyour
nailartskills,thinkabouttryingtotame DanalynnStockwoodsfunzebranail
designs.TheFitchburg,Mass.-based nailtechusesaninnovativewidebrush
methodformakingthebackgroundand then a striper brush to paint the
stripes. 1. Choosethreeacrylicpaints,ranging from light to dark,
and place them on a paper plate.2.Blendthecolorsontoafanbrushand
apply to the nail.3.Use a striping brush to apply the zebra
lines.4.Addglitterbetweenthestripesfora
sparklyefect.Finishwithtwocoatsof top
coat.>>>1324na1011techNF.indd 73 8/24/11 3:12:51 PM74|
NAILS MAGAZINE| OCTOBER 2011If youre bored with just applying one
coat of color gel and curing, try Entitys One Color Couture Gels
and its custom-mix combinations. Educator Lorena Marquez shows how
many diferent shades can be achieved by starting with one dark
color base, and then applying other Entity color gels on top of it.
The farthest right photo shows three coats of Little Black Bottle
with no layering, then the other tips use that as a base while
layering on one coat of the specied color.1. Three coats of Little
Black Bottle with no color layering.2. Fashion French Pink.3. Posh
n Pink.4. Ms. Fancy Pants.5. Holo-glam It Up.6. Under The Lights.7.
Denim Diva.8. Posh Pixie.9. All Made Up.To properly layer the
gels:Cure each layer of the darker colors for three minutes in a UV
Lamp or 30 seconds in an LED Light. For light to medium colors,
cure each layer for two minutes in a UV Lamp or 20 seconds in an
LED Light. For more information, go to
www.nailsmag.com//21412.Luxury Class Air
FiltrationTheValentinoBeautyPureAir FiltrationunitistheLincolnTown
Carofdustvacuums.Theunitis specically designed to remove nail dust,
acrylicodors,andharmfulchemicalsand
wasdesignedbyveteransalonownerand
founderofValentinoBeautyPure,DavidDi Lorenzo, who came up with the
design after he was bothered by the air quality in his salons. The
Valentino Pure Air Filtration unit has a sleek design with built-in
dappen dish holders and a brush to dust off the unit. It features
an eco-friendly charcoal lter to capture odors and a powerful yet
quite vacuum system to ensure that dust particles are swept quickly
into the unit. For more information, go to
www.nailsmag.com//21411.Layering Soak-Off Color Gelsin a UV Lamp or
20 seconds iore information, go to
www.nailsmag.com//21412.123456789www.nailsmag.com/fifi/21198na1011techNF.indd
74 8/25/11 4:32:24 PMOCTOBER 2011 | NAILS MAGAZINE | 75
www.nailsmag.com/fifi/21289QQHave a technique question? (about
product application, troubleshooting, etc.) E-mail it to
[email protected] and check back here for an expert
answer.AQAND} {I need advice on how to get dried acrylic off my
nail brush. I did my frst set of flls today but now I am wondering
how to clean my brush. My friend
saidsoakitinacetoneandthenwashitreallywell.Couldthisaffectmy brush
or is it OK to clean it? The best way to clean an acrylic brush is
using a brush cleaner
speci-callymadeforit.Therearesomemanufacturerswhomakereallygood
ones, and that is what I use. Acrylic brushes are made of sable so
you need tomakesureyoudontcontaminatethebrush.Monomercanworkwell
between services, but brush cleaner does the best job.
Someacetonehassmalltracesofoilthatcancontaminatethebrush. Also make
sure to use only one brush for a product line; dont use it for two
differentacrylicproducts.Thisgoesforodorlessaswell.Pullingonthe
bristles will also damage the brush and the shape, so make sure you
dont pull them when cleaning. If there is already dried acrylic in
the brush, it is best to purchase a new one. Norma Sproles is an
educator and guest artist for
OPI.TherearemanygelnailsalonsaroundwhereIlive,meaningthereare many
people with gel nails. I do acrylic nails and Im wondering if there
is a special removal method to follow for gels because I know they
dont soakofflikeacrylic.Ihavealotofpeoplecomingtomewiththeirgel
nailsstillon.DoIjustthinthemdownasgoodasIcanandapplythe acrylic as
usual? Will the acrylic still adhere with that thin layer of gel
on? Or do I need to completely get rid of the gel and get to the
natural nail to be able to apply the acrylic?The only removal
method for a non-soak-off gel is to le it off.
Toansweryournextquestion,weknowthatmostgelswilladhereto
acrylicwiththerightsurfacetexture.Ipersonallyhavedonethismany
times. You le the gel as thinly as you can using a 150-grit le,
being very careful not to break through to the nail beneath. The
existing gel surface must be rough for the acrylic to adhere
properly, if it is too smooth you take the chance of the acrylic
popping or separating from the gel that is left. If you have broken
through to the natural nail while ling and thinning down the
existing gel, stop immediately. The 150-grit is way too harsh for
the natural nail and will damage your clients nails. Make sure you
do good prep work too. Improper prep is the biggest reason for
lifting. Renee Doran is an educator for OPI.na1011techNF.indd 75
8/25/11 4:32:45 PM76| NAILS MAGAZINE| OCTOBER
2011BarefootbyLCNisalight-curingpedicure
resindesignedtorestorethetoenailpartiallyor completely while
providing an attractive result. The resin has high exibility to
adjust to the movements of feet and toenails and is anti-mycotic to
prevent fungal infections. Barefoot by LCN can be used to match any
nail type and provide coverage on even the most unsightly nails.
The resins are available in clear, pink, opaque, cool pink, natural
beige, and pastel.1.Buff and prepare the nail and wipe with
cleaner. Be sure you have removed the shine.2.Apply the bonding
agent Connex Plus and let air dry for two minutes.3. Apply a thin
layer of Barefoot Resin and cure in the light for two minutes.
Apply the French smile line with FM Pearl White or any white (or
color) you desire. Cure for two minutes.4.Apply a thin layer of
Barefoot Clear and cure for two minutes.5.Remove the dispersion
layer with a swab and cleaner. Shape
thenailwithahandleoranelectricleifneeded.Brush away any dust from
ling with a dry swab or dust brush before applying Pedi Seal.6.
Apply a layer of Wilde-Pedi Seal (or any other LCN sealant) for a
perfect shine. Cure for two minutes.7.Remove the dispersion layer
with a swab and cleaner.Barefoot by LCN Pedicure 1 23
4567demosTECHNIQUE}For more information, go to
www.nailsmag.com/ff/21311na1011demos.indd 76 8/24/11 10:58:43 AMOPI
TITANIUM TOOLING Combining beauty, precision, and performance,
high-quality OPI Titanium Tooling implements are engineered with
superior 420 stainless steel and coated with ultra-hard,
corrosion-resistant Titanium for sharper, longer-lasting
tools.CUTICLES NEVER HAD IT SO GOOD!CHECK OUT OPIS ENTIRE
COLLECTION OF NINE COOL TOOLS AND THE GO-ANYWHERE TITANIUM TOOLING
WALLET AT www.opi.comFor more information, contact your local OPI
distributor. Call 800.341.99992011 OPI Products
Inc.na1011demos.indd 77 8/24/11 10:58:55 AM78| NAILS MAGAZINE|
OCTOBER
2011AngelLoveNailsisanorganic,protein-basedgelformulathatcreateslovelylooking
enhancements that are healthy for the natural nail. The Angel Love
gel line has a primer that is 80% organic, a base gel that is 95%
organic, and the gels are odorless and
actuallypromotehealthynailgrowth,saysthecompany.
Thelineusesaclearbuilder,whichcanhavepigmented powder added to it
and mixed to create any type of custom color shade.1.
Exfoliateandshapetheentirenail,thenuseacotton-tipped applicator to
cleanse and prime the entire nail.2.Brush an even amount of Base
Gel on the entire nail.3.Using a 6-watt UV lamp, ash cure the nail,
putting it in thelampforonesecond,andthenremovingitforfour seconds,
and then back in. Repeat this two to three times
thenleavethengerinthelampforapproximately30 seconds.4.
BrushanevenamountofBaseGelovertheentirenail. With the bottle of
Clear Builder Finish, apply a thin line down the center of the
nail, then apply a small amount on either side of the center
line.5.Turn the nger upside down and use the brush to guide the gel
into a nice and even almond shape. Then turn the ngernail right
side up again and allow the product to self level.6.Repeat step
three, remembering to ash the nail in the UV lamp. After ashing,
leave the nail in the light for 45 to 60 seconds, then put the lamp
in the down position and cure for four minutes.Clear Overlay Using
Angel Love Organic Nail System1 23 45 6demosTECHNIQUE}For more
information, go to www.nailsmag.com/ff/21312na1011demos.indd 78
8/24/11 10:59:11 AMAVAILABLE AT PROFESSIONAL BEAUTY SUPPLY STORES,
SALONS AND SALLY BEAUTY.www.nailsmag.com//21168ORLY Nail Lacquers
are Freeof DBP, Formaldehyde & Toluenerococo a-go-gorock the
worldrock itemberstonerock solidstone cold800.275.1111
orlybeauty.comFX MINERALna1011demos.indd 79 8/24/11 10:59:16 AM80|
NAILS MAGAZINE| OCTOBER 2011signature servicesKeldara Salon &
Spa uses:KeyanoAromaticsPumpkinSpiceMineralBath,Pumpkin Spice
Scrub, and Pumpkin Spice Butter Cream; Footlogix #13
FootSoakandCallusOf;PerfectSenseParaf
nhandtreat-ment;GigiSpicedPumpkinParaf n;CNDStickeybasecoat, OPI
Nail Lacquer, and Seche Vite top coat. 1.
Soaktheclientsfeetforveminutesinwarmwaterwith
Footlogix#13FootSoakandatablespoonofKeyano Aromatics Pumpkin Spice
Mineral Bath. 2.Ofer the client the signature beverage of cold
apple cider or hot chai tea.3. Spray Footlogix Callus Of on
cuticles and calluses and prep the clients toenails.4.
Useanickelfootletoreducecallusesandroughspots from the bottom and
sides of the clients
feet.5.ExfoliatetheclientsfeetandlowerlegswithKeyano Aromatics
Pumpkin Spice Scrub.6. Apply PerfectSense Paraf n to the clients
hands, then cover them in warm
mitts.7.MassagetheclientsfeetandlowerlegswithKeyano Pumpkin Spice
Butter Cream.8.Apply Gigi Spiced Pumpkin Paraf n to the clients
feet, then cover with warm booties.9.After ve to seven minutes,
remove paraf n from the hands and feet. 10.
ApplyCNDStickeybasecoat,twocoatsofOPINail Lacquer, then Seche Vite
fast-drying top coat. Pumpkin PedicureKeldara Salon & Spa,
Dedham, Mass.7810TECHNIQUE}Alternate Names: Spiced Pumpkin Feet
TreatFestive Fall PedicurePump Me Up Pediprice:
$80na1011sigserv.indd 80 8/24/11 11:01:02 AMCall 800.341.9999 or
visit www.opi.com 2011 OPI Products Inc.Traditional polish removers
falling short?New OPI Expert Touch Lacquer Remover provides
superior performance without the drying effects of harsh removers.
It sweeps away even the darkest shades of nail lacquer, while
leaving cuticles soft and smooth, instead of parched and dry
looking!More effective than traditional polish
removerRemovesdarknaillacquer shades
fast!Non-drying;leavesskin& cuticles soft and supplePleasant,
gentle aroma Formulated to meet even the strictest state
regulationsUsewithOPIExpertTouchNail WipesandExpertTouchTable
Towels for lint-free results.Nail
WipesTableTowelsRecommendedProduct forAxxium Soak-OffGel
LacquerRemovalna1011sigserv.indd 81 8/25/11 12:33:10
PMna1011sigserv.indd 82 8/24/11 11:01:17
AMwww.nailsmag.com/fifi/21285na1011sigserv.indd 83 8/24/11 11:01:22
AM84| NAILS MAGAZINE| OCTOBER 2011PHOTOGRAPHY BY VU ONG/KIMBERLY
PHAMLiving the DreamShelenaRobinsonhasspent13of
her14yearsasanailtechworking withCND.Ilovebeinganail professional,
she says. Ive had opportunities thatmanycanonlydreamofandIfeelvery
blessedtobeinthisindustry.Itsexciting,
creative,artistic,anditsbeenawonderful career path.
Asaneducator,Shelenahashadthe opportunitytotraveltheworld.Shesalso
workedNewYorkFashionWeekforthelast seven years as part of the team
responsible for creating nail styles for the designers. We make
surethemodelswalkdowntherunwaywith
the10mostbeautifulaccessoriesagirlcan have! And shes been able to
provide celebrity services at both the Oscars and the Grammys.
Inadditiontohermanyresponsibilitiesas an education ambassador for
CND, the Crooked River,Ore.-basedtechalsostillworkswith clients in
the salon when shes home. My core
objectiveistohelpelevateourindustryon every level we have available
to us from salon services, to education, to nail fashion and to
helpmakethisasuccessfulcareerpathfor others, inspiring them to
reach for the stars!For this months cover, we asked Shelena to
create a fun variation of the rain drop technique
shownatCNDsFashionFusioneventatthe
PremiereShowinOrlando.Sheshowedusa bunch of cool designs, but we
especially loved the contrast of this matte black nail with CNDs
new Shellac Zillionaire.behind the scenesWatch our Behind the
Scenes video on this technique at
www.nailsmag.com/Oct2011CoverVideo.TECHNIQUE}CNDeducationambassadorShelenaRobinson(left)ewdown
from Oregon to do these cool nails for our cover. Shes no stranger
toworkingunderpressure.Youcanusuallyndherbackstageat Fashion Week
in New York or at awards shows in Los Angeles. .comna1011bts.indd
84 8/26/11 9:46:30 AMOCTOBER 2011 | NAILS MAGAZINE | 85
15372648Heres how you can do these nails: 1.
Preparethenailsforproduct applicationusingtheCNDP.R.E.P.
procedure.(Youcanwatchthe P.R.E.P.videospotlightatwww.cnd.com. Just
login as a pro to watch.) 2.ApplyathincoatofShellacUVBase Coat to
ve nails at a time and cure for 10 seconds using the CND UV Lamp.
Repeat on other hand.3. Apply a thin layer of Shellac UV Color
CoatinBlackPooltovenailsand curefortwominutesintheCNDUV Lamp.
Repeat on other hand.4.ApplyasecondlayerofShellacUV Color Coat in
Black Pool to ve ngers and cure for 2 minutes in the CND UV Lamp,
repeat on other hand.5. ApplyathinlayerofShellacUVTop
Coattovengersandcurefortwo minutes in the CND UV Lamp. Repeat on
other hand.6. Removethetackylayerwith99%
isopropylalcoholandremovethe shinefromthetopcoatusinga180-grit
Boomerang Padded File to create a matte
nish.7.Applythecenterhourglassdesignin Shellac UV Color Coat in
Zillionaire to ve ngers. Use a #6 gel oval brush and
isopropylalcoholtoperfectthelines. CurefortwominutesintheCNDUV
Lamp. Repeat on other hand.8.Sealthedesignportionofthenail
withathincoatofShellacUVTop Coat and cure for two minutes. (Dont
applytopcoatoverthematte,or youll lose the nish.) Repeat on other
hand.Removethetackylayerusing 99% isopropyl alcohol.na1011bts.indd
85 8/24/11 12:09:21 PM86| NAILS MAGAZINE| OCTOBER 20111.Stick
decals onto the nail and apply a thin strip of
adhesivetabnearthecuticleextendingtoabout halfway up the nail
toward the free edge.2.Positionthevibratingmotoratthefrontofthe
nail,offoftheadhesivetabsoitisfreetomove, and press the wires into
the adhesive tab.3. Gluethelargerbluebutterytothetopofthe vibrating
motor, and glue the small pink buttery to the red wire.4.
Fastenthesmallbatteryontothecuticleareaof the nail, into the
adhesive tab to secure it.5. Thepinkbutteryislightenoughthatthered
wire supports it just above the battery. When it is pressed down
from above, bringing the red wire in contact with the battery, the
vibrating motor acti-vates and the blue buttery shakes.Cy Tymony
has been creating homemade
inven-tionssincechildhood,andwrotehisrstbook,
SneakyUsesforEverydayThings,in2003.The
bookwasasuccess,andledtoTymonybeing
featuredonCNNHeadlineNews,ABCsChicago
MorningShow,NPRsScienceFridaywithIra Flatow, and The Chicago
Tribune. Hehaspublishedeightbooksin the Sneaky Uses series. The
latest, whichincludesthisnaildemo,is SuperSneakyUsesforEveryday
Things. For more information, go to
www.sneakyuses.com.TECHNIQUE}You can see a video of Cy Tymony
making this vibrating nail at www.nailsmag.com/video/vibratingnail.
.comTymony12354Yep, you heard right. Though not a licensed nail
tech, Cy Tymony, author of the new book Super Sneaky Uses for
EverydayThings,hascreatedaninnovativewaytouse simple, small, and
inexpensive electronics to make a fun and interactive nail art
design that really shakes things up.Here is what youll
need:Full-wellnailtip,1.5-Vwatchbattery,1.5-Vvibratingmotor,exible
butterygure,adhesivetabs,butteryornament,butterydecals, and nail
glue. (The watch battery and vibrating motor can be found at local
electronic parts stores, and the buttery and adhesive tabs can be
found at craft stores.)The Vibrating MotorThe vibrating motor has
two wires, a blue and red. The red is applied to the battery with
an adhesive tab, and the blue is glued to the small pink buttery.
When the blue wire is pressed down on top of the battery, the
vibrating motor will shake.A Vibrating Nail?na1011vibrating.indd 86
8/25/11 8:11:45 AMwww.nailsmag.com/fifi/21260na1011vibrating.indd
87 8/24/11 11:05:44 AMBecauseyouwantnothingtogetbetween
youandyourwork,OPIArtistSeriesBrushes
aredesignedwithsleek,shorthandlesand handcrafted using the nest
materials to deliver perfection from the rst brush stroke to the
last.61/251/241/231/221/211/21/27654321SHORTSLEEKSENSATIONALFor
more information about OPI Artist Series Brushes, log on as a
professional at www.opi.com or contact your Authorized OPI
Distributor.2010 OPI Products Inc. Call 800.341.9999 or visit
opi.comACTUAL SIZEIN INCHESArtist Series Oval Gel BrushArtist
Series Flat Gel BrushArtist Series 2-Piece Kolinski Gel BrushArtist
Series 2-Piece Acrylic Oval BrushArtist Series Kolinski Mini Gel
BrushArtist Series Acrylic Oval BrushArtist Series 2-Piece Kolinski
Gel BrushCompact 4 1/2 inches #4 brush head ideal for OPI gels.
Great for travel.Artist Series Oval Gel BrushTapers to a sharp
point, excellent for details and clean, crisp smile lines.Acrylic
Oval BrushLightweight handle for a comfortable grip and effortless
brush control.2-Piece Acrylic Oval BrushCompact 4 1/2 inches
perfect for travel!Artist Series Flat Gel BrushPerfect for moving
quantities of gel for fast nail coverage.Artist Series Kolinski
Mini Gel Brush#2 brush head with a slim handle for precision and
comfort.na1011styleNF.indd 88 8/24/11 11:22:29 AMOCTOBER 2011 |
NAILS MAGAZINE | 89 STYLE}Nail Art Blogs Worth BookmarkingFOR YOUR
NAILS ONLYforyournailsonly.netThis blog is all freehand nail art
from a Cornell graduatewhostartedoutwithapolish
swatchblog,thentaughtherselfhowtodo
remarkablenailart.Wereamazedthatthere are no stamps or decals in
any of her stunning designs.Theblogalsohostsfuncontests, like the
Nail Polish Ambition Contest and the Palette Awards.HEY, NICE
NAILS!heynicenails.comTwosisters,aprofessionalmanicuristanda
graphicdesigner,sharetheirnailartdesigns.
Theytakeinspirationfromeverywhere, including New York Fashion Week
nail designs and seasonal trends.PAINTED LADY
FINGERSpaintedladyngers.comMorethan2,000followerscantbewrong.
ThisPhiladelphia-basedladyhasapenchant
forglitterandKonadnailartstamps.Enlarge any of her photos with a
click of the mouse. 365 DAYS OF NAIL
ARTblogs.nailsmag.com/365nailartThisisashamelessplugforoneofourown
blogs, but wed be remiss if we didnt mention 365 Days of Nail Art.
Featuring a nail art design adaybyblogreaders,youcouldgetlostin
these archives for days. Plus, use the lefthand menu bar to sort
the designs by category, such as acrylic, bridal, or murals.
>>>BURGERS AND NAILSnailburgerlar.tumblr.comThis quirky
blog features almost-daily postshighlightingtwoofourfavorite
things:burgersandnails.Thejuxta-positionofelegantOPIpolishagainst
mustard-falling-out-of-the-burgeris nottobemissed.Plus,manyofthe
submissions show the diners with cute nail art on their digits.51
2345na1011styleNF.indd 89 8/24/11 11:22:32 AM90| NAILS MAGAZINE|
OCTOBER 2011STRONGNAILTRITIONHelps stimulate faster nail growth and
strengthens peeling & splitting nailsorlybeauty.com
800.275.1111ORLY Nail Treatments are Free of DBP, Formaldehyde
& TolueneAVAILABLE AT PROFESSIONAL BEAUTY SUPPLY STORES, SALONS
AND SALLY BEAUTY.www.nailsmag.com//21214Hot ToddyAs an esthetically
pleasing alternative to the boring paper towel, use new Toddy
Cloths from Toddy Gear to do a quick clean-up of nail tables or
salon reception desks in between clients. The cloths come
inmorethan40vibrantprintsandfeaturedual-sidedcleaning:
plushmicrobermaterialononesidetocleanandadistinctively patterned
silk microber on the other side to buff and polish. The cloths also
feature an antimicrobial coating, protecting them against
microorganisms that contribute to bacteria, mold, and mildew. (Be
sure to still follow your state boards guidelines for the
disinfecting of your table.)If clients eye your Toddy Cloth, stock
them in your retail area for sale: They are gentle enough to use on
iPhones, glasses, TVs, and more. Plus, with the new Brand Your
Toddy option, you can even imprint the smart cloths with your
salons logo.For more information, go to www.nailsmag.com//21421.The
90-degree angle shows up creatively in fall designsRosa Vargas,
Nails by Rosa, Palm Springs, Fla.Cathelia Cowles, Sculptures,
Vicksburg, Mich.Yvette Pitt, The Lacquer Beauty Lounge,
Watsonville, Calif.TRENDwatch:the right anglena1011styleNF.indd 90
8/24/11 11:22:39 AMOCTOBER 2011 | NAILS MAGAZINE | 91 CUTICLE OIL+.
Moisturizes, heals and refreshes problem cuticles to promote nail
growth.orlybeauty.com 800.275.1111ORLY Nail Treatments are Free of
DBP, Formaldehyde & TolueneAVAILABLE AT PROFESSIONAL BEAUTY
SUPPLY STORES, SALONS AND SALLY
BEAUTY.www.nailsmag.com//21214CARING Clients who are known for
nicking or smudging their polishwithinminutesof
amanicuremaybenetfromNailsinMotionsTip Tops. These nail protectors
are clipped to the ngers before the polish step of the manicure,
then ipped over after the polish application to protect the polish
while the client digs for her wallet, nds her car keys,
orbucklesherseatbelt.ThecompanysMani-Pedi
ProtectionKitincludes10TipTopspluspedicure sandals with toe
separators and a carrying
case.Formoreinformation,gotowww.nailsmag.com//21422.Mani Table with
the WorksWhen G Elizondo couldnt nd a manicure table to meet all of
her specications, she designed her own. Elizondo, who works at
Radichi Salon & Spa in Las Vegas, drew out her blueprints then
had a carpenter build it out. We love how she built up, not out,
adding an extra horizontal tier to get the clean workspace she
desired. This table isnt for sale, but Elizondos happy to share her
blueprints with NAILS readers for those of you who want to get a
similar table built locally. You can view her blueprints at
www.nailsmag.com/GManiTable.CLIENTS SIDE> The extra tier houses
two UV nail lamps (one on each side) for convenient gel curing.>
A dropped-in piece of glass thats centered on the top tier allows
clients to see salon iers that are placed on the lower tier,
without the risk of the tech spilling something on the ier.> A
shared footrest near the table base has room for both the clients
and the techs feet.TECHS SIDE> Tools such as an e-le and safety
glasses are stored on the lower tier, meaning the top work surface
is unobstructed.> Deep drawers on the right side mean that a
tall monomer bottle can stand up (in the top drawer) and an entire
gallon of acetone can be stored (bottom drawer).> The entire
left side is drawers, which provides tons of storage, especially
for techs who dont have storage space elsewhere in the
salon.>>>In the Nick of Timena1011styleNF.indd 91 8/24/11
11:22:44 AM92| NAILS MAGAZINE| OCTOBER
2011PROTECTIVEPOLISHIELD3-in-1 topcoat bullet proofs your nail
lacquer for lasting shine with a protected nish.orlybeauty.com
800.275.1111ORLY Nail Treatments are Free of DBP, Formaldehyde
& TolueneAVAILABLE AT PROFESSIONAL BEAUTY SUPPLY STORES, SALONS
AND SALLY BEAUTY.www.nailsmag.com//21214QQQQAQAND} {Have a style
question? (about nail art, fashion, salon decor, etc.) E-mail it to
[email protected] and check back here for an expert answer.What
brand of acrylic paint is used for One-Stroke
painting?IloveusingFolkartEnamelPaints.Theyarestrongandwontchipoff
easily. They have a uffy consistency like shaving cream. You can
get frosts and metallics in these enamel paints, plus they work on
glass, metal, ceramic, mirrors, and more. But nail techs tend to
like the Folkart Acrylic Paints best. There are more metallics in
the acrylic paint, plus the top coat to seal it is a little
thinner. You can purchase most colors on my site
(www.dewberrycrafts.com)ortryyourlocalcraftstore.Theseallcomein2-oz.bottlesandlasta
long time. Donna Dewberry is the inventor of the One-Stroke
painting technique.If my clients want their Minx to last longer,
can I seal it with a gel top coat? And will this ruin the shiny
chrome effect of the Minx?Minx does not advocate the use of gel on
top of Minx, but in my experience it may be a wise choice in
certain cases, such as if the client has very oily nails or works a
lot in water. Applying gel on top will take the shine down a bit.
Its important to have a good understanding of proper Minx
application and the importance of heat before using anything on
top. It must be sold as an
add-on.Minxismarketedasneedingnobaseortopcoat.Sinceusinggelover
Minx is not part of the Minx process you should charge more for the
gel coat. A suggested way to use gel and Minx is to consider
applying gel over a clients
naturalnailplatebeforeapplyingMinx,incaseswherethereareridgesor
natural nail damage, so that there is a smooth surface to apply the
Minx. Naja Rickette is a Minx Master and lead trainer.
IvenoticedthatnailridgescanshowthroughMinxnailcoatings.Arethere
certainstylesofMinxthatIshoulduse(ornotuse)onclientswhohavevery
ridged
nails?IfsomeonehasdeepridgesinthenailsMinxmaynotcoverthemup.In
particular,SilverandGoldLightningMinxislikespandexforthenailit
willshowallimperfections.Forclientswhohaveridgednailsbutlikethe
chrome look of Gold and Silver Lightning, then suggest patterns
that are still
inthemetallicrangebutthathaveadesignthatcancamouageridgesor an
otherwise uneven nail plate. Some good options are the metallic
shnets, skulls, and cheetah patterns. Naja RicketteDo most salons
that have their employees purchase matching uniforms have each
employee buy just one uniform, or do they buy multiple ones? Most
of my techs work in the salon fve days in a row.Most salons
purchase at least three sets of uniforms per full-time employee
oriftheywearthemvedaysaweek.Thisrequireslesslaundering,which allows
for longer wear and a crisper, more professional-looking uniform.
Agnes Dalisay is founder and owner of Chi Couture Uniforms
(www.mychi.ca).na1011styleNF.indd 92 8/24/11 11:22:50
AM81085Haunting81087Near Dark80754Ghoulish Glow81053Black
Mesh81086Its Alive81088Crimson#80723 18pc Counter DisplayIncludes 3
each of .5oz lacquers:Haunting, Crimson, Near Dark, Its Alive,
Ghoulish Glow & Black Mesh Crackle Glaze#80724Buy3 Get 1 Free
Includes: Its Alive, Ghoulish Glow, Black Mesh Crackle Glaze &
Fast Forward Top CoatDont miss the HAUNTING beauty of this years
China Glaze Halloween selection which includes two daringly dark
Crme lacquers & two Limited Edition
Glitters.www.chinaglaze.comwww.nailsmag.com/fifi/21119na1011styleNF.indd
93 8/25/11 12:29:52 PM94| NAILS MAGAZINE| OCTOBER 2011Flutter and
Flowers1. Useaatbrushandwhiteacrylic paint to paint half the nail
diagonally. Useaatbrushandpinkpaintto paint the remainder.2.
Double-loadaatbrushwithlight blue and white paints, then push and
wiggle to create a buttery.3.Addgreenbladesofgrass.Accent them with
black. Add pink and white owers with black centers above the grass.
Add more colorful owers on top of the white paint. Candy Corn
French1.SculptaFrenchusingglitter orange acrylic.2. Use white paint
to create three triangles down the center of the nail, each
pointing in a diferent direction.3. Fade yellow and orange paint in
each triangle to nish the candy corn. Stripes and Sparkles1.Apply
two coats of bronze polish diagonally in two
corners.2.Useyellowpolishtollinthe center gap. Use an orange
striper tooutlinewherethebronzeand yellow meet.3.
Useblackacrylicpainttocreate zebrastripesovertheyellow
polish.4.Highlightthestripeswiththe orangestriper.Applygoldglitter
top coat.Jade Sewell, Just Nails, Great Falls, Mont.Brenda
Rodrigues, Nails by Brenda at Anaphora Salon, Atascadero,
Calif.Hanh Lisa Doan, Longs Nails Spa, Victorville,
Calif.PHOTOGRAPHY BY KELLY BRACKENnail art
studioSTYLE}na1011nas.indd 94 8/24/11 11:25:36 AMOCTOBER 2011 |
NAILS MAGAZINE | 95 Playful Pumpkin1.Paintthefreeedgedarkgreento
create a French.2. Useanorangestripertocreatea
pumpkin.Addtwoovalsforhands. Use a green striper to add a pumpkin
stem and curly accent lines.3.Use the green striper to create
blades of grass. Add two white ovals for eyes. Use black to outline
the pumpkin and to add a smile and other accents. Add white dots
inside the eyes.Tanya Arcuri-Gout, Poland, N.Y.Go Cats!1. Use
sparkly blue acrylic on the free edge to create a French.2. Add a
gold glitter smile line. 3. FinishtheFrenchwiththepinkof
yourclientschoice.Buf.Adda base coat.4. Usegoldacrylicpainttowrite
Catsincursivediagonallyacross the nail. Add gold beads in opposite
corners of the nail.Brandy Williams, Glendive, Mont.Trick or
Treat1. Applysilverglitteracrylic diagonally on the free edge.2.
Fillintherestofthefreeedge with orange
acrylic.3.Applypalepinkglitteracrylic over the entire
nail.4.Useastriperbrushandblack acrylic to highlight the smile line
and to the lines where the silver and orange acrylic meet. Cassi
Banning, Tips and Toes Nail Salon, Great Falls, Mont.For more nail
art step-by-steps, visit www.nailsmag.com/style, then click on Nail
Art.Want to see your nail art how-to here? Mail your tips (one for
each step) and instructions to Sree Roy, NAILS Magazine, 3520
Challenger St., Torrance, CA 90503. Make sure to include your name,
salon name (if applicable), city, state, and contact
information.,.comna1011nas.indd 95 8/24/11 11:25:40 AM96| NAILS
MAGAZINE| OCTOBER 2011We love it when we nd nail techs who truly
put the art into nail art, and Fumic Sueyoshi is a true gem in this
arena. She coined herself a jewelry nailist,
andwethinkhernailcreationsrivalthoseofany
jewelry-makeroutthere.Hernailartcombines
color,texture,andmovementtocreateedgy
yetelegantdesignsthatincorporateSwarovski
crystals,feathers,charms,andtheoccasionalrealgemstone.She runs a
private salon in New York City, and you can see more of her work at
www.jewelrynailist.com.Q Where did you get the bulk of your nail
art training? a Mostly in my native Japan. Nail art is extremely
popular there, and clients always want extra fancy embellishments.
Japanese and U.S. nail art are very diferent, so I created a fusion
style.Q Can you tell us a little about your mentor, Yukako
Tanimura? a Yukako Tanimura is a bonsai artist. She is the best Ive
ever seen. I met her in New York City while we were both traveling,
and later I
visitedherinTokyo.Hertalentismanifold:Shemakesjewelryand
nailarttoo.Atherplace,sheletmetrytocreatenailartwithher Swarovski
crystal collection. I made some pieces and loved it.QCan you tell
us about how developed your signature nail art style? a My designs
are based on what I love: combining materials and being creative.
Im always on the look-out for materials that can be used in my art.
Even while traveling, I get pieces for my new creations. I love
good quality pieces. Its very important to me how expensive my
nails look. SueyoshiThis New York City-based nail tech combines
jewelry, nail art, and creative energy to produce stunning nail
masterpieces.The Jewelry Nailist: Fumic
SueyoshiANDANDANDSTYLE}na1011fumic.indd 96 8/24/11 11:36:20
AMSuggested SalonPrice:$35.99eana1011fumic.indd 97 8/24/11 11:36:35
AMwww.nailsmag.com/fifi/21276na1011fumic.indd 98 8/24/11 11:36:39
AMwww.nailsmag.com/fifi/21197na1011fumic.indd 99 8/24/11 11:36:43
AM100| NAILS MAGAZINE| OCTOBER 2011Monster Mash Monster
MashInspired by this ghoulish time of year, ve talented nail
artists show of their fun designs and devilish skills as a treat
for you.STYLE}Ryoko Garcia of Altus, Okla., has the fright of
Halloween jump right out at you with her acrylic 3-D
sculpting.Stretching nail skills to the limit, Amanda Lehner of Las
Vegas covers all the Halloween nail art themes from the graveyard
to the doorstep.nail artists show of their fun designs and devilish
skills as a treat for you.Stretching nail skills to the
limit,na1011monster.indd 100 8/24/11 11:44:52 AMOCTOBER 2011 |
NAILS MAGAZINE | 101 Aracely Ruiz of San Antonio, Texas, weaves a
web of sculpted acrylic designs over spooky glittered nail
tips.Naomi Gonzalez of Sanford, Fla., aint afraid of no
ghosts.Erica Plyter of Hinesville, Ga., is the Faust of nail techs
with her precision nail art and creative designs.na1011monster.indd
101 8/24/11 11:44:57 AM102| NAILS MAGAZINE| OCTOBER 2011hair
feathersboutique1.HairFeathergivesyouaccessto
professional-grade,cruelty-free,rooster
featherextensionsthatcanstandupto
yourclientsdailyhairroutineforupto three months. Your clients can
wash, curl, and at iron the feathers. Hair Feather also
carriesfeathersforyourpetandcomes with a do-it-yourself kit.
www.nailsmag.com//214312.OriginalFeatherlocks,FatFeather-locks,BraiderFeatherlocksandPuppy-locksfromConditionCulturearereal
feathers that last up to eight weeks and
canbereappliedforalifetime.Inanar-ray of colors, Featherlocks can
be skinny, fat, or short. Braided Featherlocks can be cascaded down
a thin braid of hair or at-tachedwithFeatherlockssiliconebead
technology.Thelooptoolissoldsepa-ratelyandFeatherlocksareforlicensed
salons only. www.nailsmag.com//214323. From Bling Strands, these
Fancy Feathers are for professional use only and are not
pre-bonded, allowing every customer to mix and
matchfeatherstotheirliking.Thefeathers, which come long at 8 to 13
inches or short and ufy at 4 to 8 inches are available with
apeacocksheen.Theyareappliedusing
amicrobead,pliers,andathreadinghook.
BlingStrandshasvariouspliersandtools available, which are sold
separately. www.nailsmag.com//214334.BellaViasfeatherhairextensions
comewithfourcontrastingfeathersto
helpcreateauniquelytexturedlook.The
feathers,whichlastaboutfourmonths, are washable and can be styled
and curled intoyourclientsownhair.BellaViaalso has feather hair
charms that are attached tobraided,humanhairextensions.The braid
lasts about two months and can also be washed and styled.
www.nailsmag.com//214345.Thesehand-selectedfeathersfrom
FineFeatherheadscanbestyledany wayatupto450degrees,andtheylast
aboutfourmonths.FineFeatherheads workswithasinglefarmtoensure
ethicaltreatmentoftheroostersand usesmineral-baseddye.Thefeathers
areattachedontothehairusingamicro linkthatcanbeclampedintoplaceand
removed for later
use.www.nailsmag.com//214356.DonnaBellaMilansfeathersarereal
andcomefromfarm-raisedroosters. Theyareorganicallydyedtocreatefun
colorsandtextures.Theextensionslast uptofourmonthsandareattached
using micro beads. Clients can blow-dry, straighten, or curl their
hair while wearing thefeathers.Eachpackagecomeswith four feathers.
www.nailsmag.com//21436Forget the hair dye and get natural
versatility for your clients hair with feathers. Removable and easy
to apply, feather hair extensions give highlighted texture and
personality to their locks. PHOTOGRAPHY BY KIMBERLY PHAM
STYLE}na1011boutique.indd 102 8/24/11 11:52:20
AMwww.nailsmag.com/fifi/21136na1011boutique.indd 103 8/24/11
11:52:46 AMNAILS PERFECTED Only from
Akzentzwww.akzentz.comCOPYRIGHT HAIGH INDUSTRIES INC.COLOUR NAILS
THAT LASTVariety of luxurious colours No smudging, No chipping, No
crackingLong lasting very high gloss shineProtects the natural
nailEasily removed in 10 minutes100% pure
gelwww.nailsmag.com/fifi/21305na1011busNF.indd 104 8/24/11 11:53:49
AMOCTOBER 2011 | NAILS MAGAZINE | 105 BUSINESS}Who Doesnt Want to
Paint Their Puppy?Thedog-loversamongyourclientswillbe
thrilledtondPuppyPaintonyourretail shelves. From the makers of
Piggy Paint, Puppy Paint is a non-toxic, eco-friendly nail polish
that is specially formulated from natural ingredients. Made in the
U.S., Puppy Paints hypoallergenic,
odorlessformulaisgentleenoughtouseon sensitive puppies, yet it
dries to a hard, durable nish and even has an embittering agent in
the polish to prevent
licking.Formoreinformation,gotowww.nailsmag.com//21441.>>>PHOTOGRAPHY
ISTOCKPHOTO.COM/STOCKCUBE.comFind other pet-focused beauty products
for your salons boutique at
www.nailsmag.com/petretail.na1011busNF.indd 105 8/24/11 11:53:52
AM106| NAILS MAGAZINE| OCTOBER 2011www.nailsmag.com/fifi/21249Jump
Aboard the Welcome Wagon AdrienneSchodtlermaybetoobusy
atthesalontoreachoutpersonallyto eachofhernewneighborsinthetown
ofFuquay-Varina,N.C.,butSchodtler, ownerofNailsbyAdrienne,employsa
servicecalledNewNeighbortodojust that. New Neighbor receives lists
of new homeowners in the area and visits them with a complimentary
basket full of gifts fromlocalbusinesses,shesays.The
costis$3pervisitplusthecostofthe supplies put in the basket (card,
service menu, samples, etc.). My ladies average 50 visits per
month. At the end of the month I receive all of the contact info
for those that have been visited so I can follow up wit