Top Banner
72

2016 Biomass Industry Directory

Jul 25, 2016

Download

Documents

 
Welcome message from author
This document is posted to help you gain knowledge. Please leave a comment to let me know what you think about it! Share it to your friends and learn new things together.
Transcript
Page 1: 2016 Biomass Industry Directory
Page 2: 2016 Biomass Industry Directory
Page 3: 2016 Biomass Industry Directory
Page 4: 2016 Biomass Industry Directory

4 | 2016 Biomass Industry Directory

Sixth EditionJanuary 2016

Published byBBI International308 Second Ave. N., Suite 304Grand Forks, ND 58203phone: (701) 746-8385fax: (701) 746-5367

Copyright © January 2016All Rights ReservedPrinted in the United States of America

BiomassIndustry Directory2016

TM

directory.biomassmagazine.com

Page 5: 2016 Biomass Industry Directory

directory.biomassmagazine.com|

�nd it online at

One FREE Listing per Company

Page 6: 2016 Biomass Industry Directory

6 | 2016 Biomass Industry Directory

Contents

2016 U.S. BIOMASS POWER PLANT LIST 8

2015 U.S. & CANADA PELLET MILL LIST 11

AG PRODUCTS & SERVICES 16

Feedstock Collection Systems 16

Feedstock Procurement 16

ASSOCIATIONS & ORGANIZATIONS 16

CERTIFICATIONS 17

CONFERENCES/TRADE SHOWS & MEETINGS 17

DENSIFICATION & SIZE REDUCTION 18

Balers - Rectangle 18

Balers - Round 18

Briquetting 18

Chippers - Brush 18

Chippers - Rechipper 19

Chippers - Whole Log 19

Grinders - Horizontal 19

Grinders - Tub 21

Grinders - Vertical 21

Mills - Hammer 21

Pellet Mills 21

Pyrolysis 22

Torrefaction 22

EDUCATION 22

EMPLOYMENT 22

Executive Search 22

ENGINEERING & CONSTRUCTION 22

Anaerobic Digestion Systems 22

Biomethane 22

Buildings 23

CHP Systems 23

Civil Engineering 25

Detailed Design 25

District Heating Systems 25

Electrical 25

EPC 25

Fabrication 26

Gasifiers 26

Information Technology Services 27

Management Services 27

Piping 27

Plant Optimization 27

Power Plant Construction 27

Pyrolysis 29

Stacks 29

Structural Fabrication 29

Torrefaction 29

Water Treatment 30

FEEDSTOCK SUPPLY 30

Ag Residues 30

Biomass Based Fuel Oil 30

Briquettes 30

Dedicated Energy Crops 31

Pellets 31

Wood Chips 31

LEGAL SERVICES 31

Attorney 31

Business 33

Permit & License 33

MATERIAL HANDLING & STORAGE 33

Conveyor - Belt 33

Conveyor - Drag 33

Conveyor - Enclosed 33

Conveyor - Mechanical 34

Conveyor - Pneumatic 34

Conveyor - Screw 34

Cranes - Overhead 35

Dryer - Conveyor 35

Dryer - Rotary Drum 35

Elevator-Bolts 36

Elevator-Buckets 36

Loading Equipment 36

Railcar - Moving 37

Railcar - Parts 37

Scale - Bulk Weigh 37

Scale - Software 37

Screens - Disc 37

Screens - Disc Scalping 38

Screens - Fines 38

Screens - Other 38

Screens - Trommel 38

Specialty Parts and Equipment 38

Stockyard Equipment 39

Storage-Bins 39

Storage-Other 41

Storage-Silos 41

Storage - Silo Reclaimer 41

Trailer - Moving Floor 42

Transportation - Rail 42

Truck Receiving/Dumpers 42

Vibration Equipment 42

MEDIA 42

Publications 42

PROCESS EQUIPMENT & SERVICES 43

Air Pollution Control 43

Biogas-Capture 43

Biogas-Purification 44

Biogas-Storage 44

Boilers - Control Agents 44

Boilers - Direct Fired 44

Boilers - Firetube 45

Boilers - Fluidized Bed 45

Boilers - Hot Water 45

Boilers - Parts & Service 45

Boilers - Solid Fuel 45

Boilers - Steam 47

Boilers - Waste Heat Recovery 47

Cargo Inspection and Sampling 47

Centrifuges 48

CIP 48

Cleaning 48

Combustion Equipment 48

Compressed Air Systems 48

Condensors 48

Control Systems 48

Control Systems-Distributed 49

Distillation & Dehydration Systems 49

Dust Control - Baghouses 49

Dust Control - Inertial Separators 49

Dust Control - Unit Collectors 49

Dust Control - Wet Scrubbers 49

Energy Management 50

Environmental Testing 50

Fans 50

Filters 50

Fire Protection 50

Furnaces 51

Generator - Diesel / Biodiesel 51

Generator - Natural Gas/Biogas 51

Generator - Steam Turbine 52

Heat Exchangers - Direct Contact 52

Heat Exchangers - Phase-Change 52

Heat Exchangers - Shell & Tube 52

Heat Exchangers - Waste Heat Recovery Unit 53

Hoppers 53

Instrumentation 53

Laboratory Equipment 53

Laboratory Services 54

Lubricants 54

Maintenance Services 54

Marine Surveying 54

Mixers/Agitators 55

Moisture Analyzers 55

Operations & Maintenance 55

Pipe 55

Pipe-Fittings 55

Pipe-Flanges 55

Safety 56

Sensors 56

Separators 56

Separators-Magnetic 57

Tank Equipment 57

VOC Scrubbers 57

Wastewater Treatment 57

PROJECT DEVELOPMENT & FINANCE 58

Business Plans 58

Debt Financing 58

Due Diligence 58

Feasibility Studies 59

Insurance 59

Investors 59

Mergers & Aquisitions 59

Owner Representation 59

Permitting - Air 59

Permitting - Other 59

Risk Management 59

Site Selection 59

Software - Accounting 59

Technology Assessment 59

RESEARCH & DEVELOPMENT 60

Government 60

Private 60

University 60

ADVERTISER INDEX 61

COMPANY INDEX 62

Page 7: 2016 Biomass Industry Directory

for Biomass Power Plants

RESOURCE

Page 8: 2016 Biomass Industry Directory

8 | 2016 Biomass Industry Directory

U.S. Biomass Power Facilities List

Company Plant Name LocationNameplate Capacity (MW)

CHP Capability Cofire Coal Fuel Feedstock

Abengoa Abengoa Bioenergy Biomass of Kansas LLC Hugoton, KS 21 Yes No Corn stover, straw, switchgrass

Akeida Capital Management Ampersand Chowchilla Biomass LLC Chowchilla, CA 12.5 No No Agricultural wastes

Amador Biomass LLC Buena Vista Biomass Power Ione, CA 18 No No Woody biomass

Ameresco Inc. Savannah River Site Biomass Cogeneration Facility Aiken, SC 20 Yes Yes Forest residue, tire-derived fuel

Anderson Plant LLC Shasta Renewable Anderson, CA 6.8 No No Ag waste, forest and urban wood

Arlington County/ City of Alexandria Covanta Alexandria/Arlington Alexandria, VA 23 No No Municipal solid waste

Atlantic Power Piedmont Green Power Barnesville, GA 60 No No Woody biomass

Avista Corp. Kettle Falls Generating Station Kettle Falls, WA 53.4 No No Logging and mill residue

Biomass One LP (Parent) Biomass One White City, OR 30 No No Woody biomass

BlueFire Renewables Inc. BlueFire Renewables Fulton LLC - Biomass Power Fulton, MS 25 No No Wood waste

Boise Cascade LLC Medford Operation Medford, OR 11 Yes No Mill residue

Bridgewater Power Co. LP Bridgewater Power LP Plymouth, NH 15 No No Woody biomass

Burlington Electric Department Joseph C McNeil Generating Station Burlington, VT 59.5 No No Forest and mill residue, local wood waste

Burney Forest Products Burney Forest Power Burney, CA 31 Yes No Logging and mill residue

Caletta Renewable Energy Palmer Renewable Energy Springfield, MA 35 No No Wood chips

California Ethanol & Power LLC California Ethanol & Power LLC Imperial Valley, CA Yes No Sugarcane

Capital Power Corp. CPI USA North Carolina LLC Southport, NC 55 Yes Yes Wood residuals, tire-derived fuel

Capital Power Corp. Roxboro Facility Roxboro, NC 67.5 Yes Yes Wood, tire-derived fuel

Cate Street Capital Burgess BioPower Berlin, NH 75 No No Woody biomass

City and County of Honolulu Covanta Honolulu Resource Recovery Venture Kapolei, HI 90 No No Municipal solid waste

City of Long Beach Covanta Long Beach Renewable Energy Long Beach, CA 36 No No Municipal solid waste

City of Perham Perham Resource Recovery Facility Perham, MN 4.5 Yes No Municipal solid waste

City of Spokane City of Spokane Waste to Energy Facility West of Spokane, WA 26 No No Municipal solid waste

City of Tampa McKay Bay Refuse-to-Energy Facility Tampa, FL 22 No No Municipal solid waste

CMS Energy Craven County Wood Energy New Bern, NC 50 No No Mill residue

CMS Energy Genesee Power Station LP Flint, MI 40 No No Wood waste solids, animal bedding

CMS Energy Grayling Generating Station Grayling, MI 38 No No Mill residue, tire-derived fuel

Collins Company Collins Pine Company Kane, PA 12 Yes No Woody biomass

Concord Blue USA Concord Blue Eagar LLC Eagar, AZ 1 No No Woody biomass

Concord Steam Corporation Concord Steam Corporation Concord, NH 20 Yes No Whole tree chips

Connecticut Resources Recovery Authority Covanta SECONN Preston, CT 18 No No Municipal solid waste

Connecticut Resources Recovery Authority Mid-Conn. Resource Recovery Facility Hartford, CT 68 No No Municipal solid waste

Connecticut Resources Recovery Authority Wheelabrator Bridgeport LP Bridgeport, CT 67 No No Municipal solid waste

Constellation NewEnergy Albany Green Energy Albany, GA 50 Yes No Forest residue, urban waste wood, pecan shells, peanut hulls

Covanta Covanta Energy Mendota Delano, CA 25 No No Orchard and vineyard prunings, nut shells, stone fruit pits

Covanta Covanta Babylon Inc. West Babylon, NY 17 No No Municipal solid waste

Covanta Covanta Bristol Inc. Bristol, CT 16.3 No No Municipal solid waste

Covanta Covanta Burney Mountain Power Burney, CA 11.4 No No Woody biomass

Covanta Covanta Camden Energy Recovery Center Camden, NJ 21 No No Municipal solid waste

Covanta Covanta Delano Delano, CA 58 No No Orchard and vineyard prunings, nut shells, stone fruit pits

Covanta Covanta Delaware Valley LP Chester, PA 80 No No Municipal solid waste

Covanta Covanta Essex Company Newark, NJ 65 No No Waste stream

Covanta Covanta Fairfax Inc. (I-95 Energy) Lorton, VA 80 No No Municipal solid waste

Covanta Covanta Haverhill Inc. Haverhill, MA 49 No No Municipal solid waste

Covanta Covanta Hempstead Company Westbury, NY 80 No No Municipal solid waste

Covanta Covanta Hennepin Energy Resource Co. LP Minneapolis, MN 40 No No Municipal solid waste

Covanta Covanta Huntington LP East Northport, NY 25 No No Municipal solid waste

Covanta Covanta Indianapolis Inc. Indianapolis, IN 7 Yes No Municipal solid waste

Covanta Covanta Jonesboro Power Station Jonesboro, ME 24.5 No No Logging and mill residue

Covanta Covanta Lake Inc. Okahumpka, FL 15 No No Municipal solid waste

Covanta Covanta Marion Inc. Brooks, OR 13 No No Municipal solid waste

Covanta Covanta Mount Lassen Power Westwood, CA 11.5 No No Forest thinning

Covanta Covanta Niagara Company Niagara Falls, NY 30 No No Municipal solid waste

Covanta Covanta Onondaga LP Jamesville, NY 40 No No Municipal solid waste

Covanta Covanta Pacific Oroville Power Oroville, CA 16.5 Yes Yes Forest residue, ag and urban waste

Covanta Covanta Pittsfield Inc. Pittsfield, MA 4 Yes No Municipal solid waste

Covanta Covanta Plymouth Renewable Energy Ltd. Conshohocken, PA 32 No No Municipal solid waste

Covanta Covanta Projects of Wallingford LP Wallingford, CT 11 No No Municipal solid waste

Covanta Covanta SEMASS LP West Wareham, MA 54 No No Municipal solid waste

Covanta Covanta Springfield LLC Agawam, MA 9 No No Municipal solid waste

Covanta Covanta Stanislaus Inc. Crows Landing, CA 22.5 No No Municipal solid waste

Covanta Covanta Warren Energy Resource Co. LP Oxford, NJ 14 No No Municipal solid waste

Covanta Covanta WBH LLC Tulsa, OK 17 No No Municipal solid waste

Covanta Covanta West Enfield West Enfield, ME 25 No No Forest and mill residue

D.R. Johnson Lumber Company Co Gen Co Prairie City, OR 9 Yes No Forest thinnings

D.R. Johnson Lumber Company Co Gen Co 2 Riddle, OR 9 Yes No Woody biomass

Detroit Thermal Detroit Renewable Energy Detroit, MI 68 Yes No Municipal solid waste

Dominion Virginia Power Altavista Power Station Altavista, VA 51 No No Whole tree chips

Dominion Virginia Power Hopewell Power Station Hopewell, VA 51 No No Whole tree chips

Dominion Virginia Power Pittsylvania Power Station Hurt, VA 83 No No Whole tree chips

Dominion Virginia Power Southampton Power Station Franklin, VA 51 No No Wood waste

DTE Energy DTE Stockton LLC Stockton, CA 45 Yes No Woody biomass, ag residues

DTE Energy Services DTE Stoneman Station Cassville, WI 40 No No Woody biomass

DTE Energy Services Woodland Biomass Power Ltd. Woodland, CA 28 No No Woody biomass

Dutchess County Resource Recovery Agency Covanta Hudson Valley Renewable Energy LLC Poughkeepsie, NY 9 No No Municipal solid waste

East Texas Electric Cooperative Woodville Renewable Power Woodville, TX 49 No No Wood chips

Eastern Connecticut Resource Recovery Authority Wheelabrator Lisbon Inc. Lisbon, CT 15 No No Municipal solid waste

Color KeyExisting Under Construction Proposed Idled

Page 9: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 9

U.S. Biomass Power Facilities ListNote: Plant map data as of September 22, 2015The map indicates electricity generation plants that:-have the ability to supply all or a portion of their power to the grid-use greater than 40% biomass by volume in annual fuel mix-have a nameplate capacity equal to or greater than 1 MW

Company Plant Name LocationNameplate Capacity (MW)

CHP Capability Cofire Coal Fuel Feedstock

Ecomaine (Parent) Ecomaine (Biomass Power Plant) Portland, ME 14 No No Municipal solid waste

ecoPower - Hazard ecoPower - Hazard Chavies, KY 58 No No Woody biomass

EDF Renewable Energy EDF-RE Allendale Allendale, SC 17.8 No No Forestry wood waste

EDF Renewable Energy Pinelands Biomass - Dorchester Dorchester, SC 35.6 No No Logging residue

EMD Millipore Corporation EMD Millipore Corporation Jaffrey, NH TBD Yes No Wood chips, wood pellets

Energy Management Inc. Gainesville Renewable Energy Center Gainesville, FL 102.5 No No Logging and mill residue, urban waste wood

EnergyWorks BioPower Inc Gettysburg Energy & Nutrient Recovery Facility LLC York Springs, PA 3.25 No No Egg layer manure

Enpower Corp. Wadham Energy LP Williams, CA 26.5 No No Rice hulls

Escanaba Green Energy LLC Escanaba Generating Station Escanaba, MI 23 Yes Yes Wood waste, tire-derived fuel

Evergreen BioPower LLC (Parent) Evergreen Biopower LLC Lyons, OR 10 Yes No Mill residue

Evergreen Clean Energy Eagle Valley Clean Energy Gypsum, CO 11.5 Yes No Forest restoration residue

Ever-Green Energy LLC St. Paul Cogeneration LLC St. Paul, MN 37 Yes No Urban wood residues

EWP Renewable Corp. DG Fairhaven Power Samoa, CA 18.8 No No Woody biomass

EWP Renewable Corp. DG Whitefield LLC (Biomass Power Plant) Whitefield, NH 19 No No Woody biomass

EWP Renewable Corp. Springfield Power LLC Georges Mills, NH 19 No No Whole chipped trees, round wood

Florida Crystals New Hope Power Co. South Bay, FL 128.9 Yes No Bagasse, wood

Florida Power Development LLC Brooksville Brooksville, FL 70 No No Woody biomass

Fortistar Hillman Power LLC Hillman, MI 20 No No Wood waste, tire-derived fuel

GDF Suez Energy North America Inc. Bethlehem Power Station Bethlehem, NH 16.2 No No Logging residue, forest thinnings

GDF Suez Energy North America Inc. Fitchburg Power Station Westminster, MA 17 No No Woody biomass

GDF Suez Energy North America Inc. Lincoln Power Station Lincoln, MI 16 No No Waste wood, natural gas, tire-derived fuel, creosote treated wood, pentachlorophenol

GDF Suez Energy North America Inc. McBain Power Station McBain, MI 18 No No Wood waste, tire-derived fuel

GDF Suez Energy North America Inc. Northumberland Cogeneration Facility Northumberland, PA 16 Yes No Woody biomass

GDF Suez Energy North America Inc. Ryegate Power Station East Ryegate, VT 20.5 No No Whole chipped trees

GDF Suez Energy North America Inc. Tamworth Power Station Tamworth, NH 22.5 No No Woody biomass

Grays Harbor Paper LP Grays Harbor Paper LP - Powerhouse Hoquiam, WA 14 Yes No Paper mill sludge

Great River Energy Elk River Energy Recovery Station Elk River, MN 29 No No Municipal solid waste

Green Planet Power Solutions Maryland Bio Energy Federalsburg, MD 13.4 No No Chicken litter

Greenleaf Power LLC Desert View Mecca, CA 47 Yes No Ag residue, urban wood waste

Greenleaf Power LLC Eel River Plant Scotia, CA 28 Yes No Logging and mill residue

Greenleaf Power LLC Honey Lake Wendel, CA 30 No No Mill and logging residue, forest thinning, urban woodwaste

Greenleaf Power LLC Plainfield Renewable Energy Plainfield, CT 37.5 No No C&D waste

Greenleaf Power LLC Tracy Biomass Tracy, CA 20.5 No No Waste wood, orchard waste

Hawaiian Commercial & Sugar Co Ltd (Parent) Hawaiian Commercial & Sugar Puunene Mill Puunene, HI 46.1 Yes Yes Bagasse

Hillsborough County Solid Waste Department Covanta Hillsborough Inc. Tampa, FL 46.5 No No Municipal solid waste

Hoge Lumber Co Hoge Lumber New Knoxville, OH 3.7 Yes No Mill residue

Homeland Renewable Energy Inc. Fibrominn Biomass Power Plant Benson, MN 50 No No Poultry litter, ag residue

Hometown Bioenergy LLC Hometown Bioenergy LLC LeSueur, MN No No Food and ag waste

Hu Honua Bioenergy LLC Hu Honua Bioenergy Facility Pepeekeo, HI 24 No No Eucalyptus, other biomass

Imperial Valley Resource Recovery Imperial Valley Resource Recovery Imperial, CA 18.1 No No Woodwaste, ag residue

Indeck Energy Services Inc. Indeck Energy - Alexandria LLC Alexandria, NH 16 No No Wood waste

INEOS Bio INEOS - Indian River Bioenergy Center Vero Beach, FL 6 Yes No Vegetative waste, ag waste, municipal solid waste

InventivEnergy LLC Aspen Biomass Power Plant Lufkin, TX 44 No No Logging and mill residue, urban wood waste

Islip Resource Recovery Agency Covanta MacArthur Renewable Energy Inc. Ronkonkoma, NY 12 No No Municipal solid waste

Jamestown Energy Inc. Pacific Ultrapower Chinese Station Jamestown, CA 19.8 Yes No Woody biomass

KapStone Kraft Paper Corp. Longview Fibre Longview, WA 55 Yes No Mill residue

Kent County Covanta Kent Inc. Grand Rapids, MI 18 No No Municipal solid waste

Koda Energy LLC Koda Energy LLC Shakopee, MN 23.4 Yes No Oat & rice hulls, corn, barley & malt screening, urban tree waste

Lancaster County Solid Waste Authority Covanta Harrisburg Inc. Harrisburg, PA 24 Yes No Municipal solid waste

Lancaster County Solid Waste Authority Covanta Lancaster Inc. Bainbridge, PA 36 No No Municipal solid waste

L’Anse Warden Electric Company L’Anse Warden L’Anse, MI 20 Yes No Wood chips

Leaf Clean Energy Company Multitrade Telogia Bristol, FL 14 No No Logging and mill residue, hogged fuel, peanut hulls

Lee County Solid Waste Authority Covanta Lee Inc. Ft. Myers, FL 57 No No Municipal solid waste

London Economics Merced Power LLC Merced, CA 10.5 No No Woody biomass

Los Angeles County Sanitation Districts Commerce Refuse-to-Energy Facility Commerce, CA 11.5 No No Municipal solid waste

Macpherson Energy Corporation Mt. Poso Cogeneration Company LLC Bakersfield, CA 44 Yes No Orchard & vineyard prunings, nut shells, fruit pits, C&D waste

Maple Island FH Stoltze Land & Lumber Columbia Falls, MT 3 Yes No Mill residue

Marquette Green Energy LLC Marquette Green Energy LLC - Gwinn Gwinn, MI 34 Yes No Tire-derived fuel, wood, waste wood

Maryland Environmental Service Eastern Correctional Institute Cogeneration Plant Westover, MD 3.8 Yes No Woody biomass

MeadWestvaco MeadWestvaco Corporation - Covington Covington, VA 75 Yes No Logging and paper making residues

Miami-Dade County Covanta Dade Renewable Energy Doral, FL 77 No No Municipal solid waste, wood waste

Mid-Maine Waste Action Corp. MMWAC Resource Recovery Facility Auburn, ME 3.6 No No Municipal solid waste

Minnesota Power Hibbard Energy Center Duluth, MN 72.8 Yes Yes Cellulose mattress fill, wood waste, oily rags

Minnesota Power Rapids Energy Center Grand Rapids, MN 26.5 No Yes Logging and mill residue

New Hanover County New Hanover County WASTEC Wilmington, NC 10.3 No No Municipal solid waste

Nippon Paper Industries USA NPI USA Co-Generation Facility Port Angeles, WA 20 Yes No Logging and mill residue

North American Power Group Rio Bravo Fresno Fresno, CA 28 No No Woody biomass

North American Power Group Rio Bravo Rocklin Lincoln, CA 24.4 No No Urban wood, ag wood waste

Northeast Maryland Waste Disposal Authority Covanta Montgomery Inc. Dickerson, MD 55 No No Municipal solid waste

Northeast Maryland Waste Disposal Authority Wheelabrator Baltimore LP Baltimore, MD 64.5 Yes No Municipal solid waste

Novo Power LLC Novo BioPower LLC Snowflake, AZ 27 Yes No Forest thinnings, mill residue

Olmsted County Environmental Resources Olmsted Waste-To-Energy Facility Rochester, MN 9.6 Yes No Municipal solid waste

Oswego County Solid Waste Authority Oswego County Energy Recovery Facility Fulton, NY 3.6 No No Municipal solid waste

Pasco County Covanta Pasco Inc. Spring Hill, FL 31.2 No No Municipal solid waste

Patriarch Partners LLC Old Town Fuel & Fiber Old Town, ME 28.5 Yes No Mill residue, residual fuel oil

Pecan Row Landfill Pecan Row Landfill Valdosta, GA No No Municipal solid waste, biogas

Color KeyExisting Under Construction Proposed Idled

Page 10: 2016 Biomass Industry Directory

10 | 2016 Biomass Industry Directory

U.S. Biomass Power Facilities List (continued)Source: Biomass Magazine / BBI International Please contact Steve Stucko, Data & Content Manager, with questions or comments regarding the 2016 Biomass Power List at [email protected].

Company Plant Name LocationNameplate Capacity (MW)

CHP Capability Cofire Coal Fuel Feedstock

Phoenix Energy Cabin Creek Biomass Energy Facility Truckee, CA 2 No No Woody biomass

Pinellas County Utilities Pinellas County Resource Recovery Facility St Petersburg, FL 75 No No Municipal solid waste

PSNH - Public Service of New Hampshire Northern Wood Power Portsmouth, NH 50 No Yes Whole chipped trees

ReEnergy Holdings LLC ReEnergy Ashland Ashland, ME 39 No No Woody biomass

ReEnergy Holdings LLC ReEnergy Black River Fort Drum, NY 60 No No Woody biomass, tire-derived fuel

ReEnergy Holdings LLC ReEnergy Chateaugay Chateaugay, NY 21 No No Woody biomass

ReEnergy Holdings LLC ReEnergy Fort Fairfield Fort Fairfield, ME 37 No No Woody biomass

ReEnergy Holdings LLC ReEnergy Livermore Falls Livermore Falls, ME 39 No No Woody biomass

ReEnergy Holdings LLC ReEnergy Lyonsdale Lyons Falls, NY 22 Yes No Whole chipped trees

ReEnergy Holdings LLC ReEnergy Sterling Sterling, CT 30 No No Woody biomass, tire-derived fuel

ReEnergy Holdings LLC ReEnergy Stratton Stratton, ME 48 No No Woody biomass

ReVenture Park ReVenture Park Charlotte, NC 3.6 Yes No Landfill gas

Rio Grande Valley Sugar Growers Inc. Rio Grande Valley Sugar Growers Santa Rosa, TX 23.5 Yes No Bagasse

Riverstone Holdings Coastal Carolina Clean Power Kenansville, NC 35 Yes No Woody biomass

Robbins Lumber Inc. Robbins Lumber Searsmont, ME 1.2 Yes No Woody biomass

RockTenn RockTenn - Tacoma Tacoma, WA 64 Yes No Mill residue

Rollcast Energy Inc. Cadillac Renewable Energy Cadillac, MI 44 No No Forest residue

Roseburg Forest Products Dillard Complex Roseburg, OR 51.5 Yes No Softwood

Sappi Fine Paper North America S D Warren Westbrook Westbrook, ME 62.5 Yes Yes Mill residue, black liquor, tire-derived fuel

Sappi Fine Paper North America Sappi Cloquet Mill Cloquet, MN 60.7 Yes No Mill residue

Sappi Fine Paper North America Somerset Plant Skowhegan, ME 116.9 Yes Yes Mill residue

SDS Lumber Co. SDS Lumber Gorge Energy Division Bingen, WA 10 Yes No Logging and mill residue

Seneca Sawmill Company Seneca Sustainable Energy Eugene, OR 19.8 Yes No Mill residue, forest residues

Sierra Pacific Industries Sierra Pacific - Aberdeen Aberdeen, WA 18 Yes No Logging and mill residue

Sierra Pacific Industries Sierra Pacific - Anderson Anderson, CA 5 Yes No Logging and mill residue

Sierra Pacific Industries Sierra Pacific - Burlington Mount Vernon, WA 28 Yes No Logging and mill residue

Sierra Pacific Industries Sierra Pacific - Burney Burney, CA 20 Yes No Logging and mill residue

Sierra Pacific Industries Sierra Pacific - Lincoln Lincoln, CA 19.2 Yes No Woody biomass

Sierra Pacific Industries Sierra Pacific - Loyalton Loyalton, CA 20 Yes No Mill residue

Sierra Pacific Industries Sierra Pacific - Quincy Quincy, CA 27.5 Yes No Mill residue

Sierra Pacific Industries Sierra Pacific - Sonora Sonora, CA 7.5 Yes No Logging and mill residue

Sierra Power Corporation Sierra Power Cogen Terra Bella, CA 7.5 Yes No Agricultural, logging and mill residue

Smurfit-Stone Container Corp. Stone Container Panama City Mill Panama City, FL 34 Yes No Paper mill waste

Snider Industries Inc. Snider Industries Marshall, TX 5 Yes No Woody biomass

Solid Waste Authority of Palm Beach Palm Beach Renewable Energy #1 West Palm Beach, FL 62.3 No No Municipal solid waste

Solid Waste Authority of Palm Beach Palm Beach Renewable Energy #2 West Palm Beach, FL 100 No No Municipal solid waste

South Boston Energy LLC NOVEC Energy Production, Halifax County Biomass (NEPHCB) South Boston, VA 49.9 No No Forest slash

Southeast Renewable Fuels LLC Southeast Renewable Fuels LLC - Clewiston Clewiston, FL 25 Yes No Sweet sorghum

Southern Power Company Southern Co. Nacogdoches Generating Facility Sacul, TX 100 No No Forest residue, wood processing residue, municipal solid waste

SP Newsprint Company SP Fiber Technologies - Newberg Newberg, OR 36 Yes No Logging residue, paper waste, paper mill sludge

Standardkessel Baumgarte Green Energy Team LLC Koloa, Kauai, HI 7.5 Yes No Eucalyptus, albizia

Stimson Lumber Company Plummer Cogen Plummer, ID 6 Yes No Wood waste

Taylor Biomass Energy LLC TBE-Montgomery LLC Montgomery, NY 24 No No Municipal solid waste, C&D and wood waste

Telogia Power Telogia Power Telogia, FL 14 No No Logging and mill residue, hogged fuel, peanut hulls

The Powell Group Agrilectric Power Partners Ltd. Lake Charles, LA 12.1 No No Waste stream

U.S. EcoGen LLC U.S. EcoGen Clay Generating Facility Green Cove Springs, FL 66 No No Eucalyptus grandis

U.S. EcoGen LLC U.S. EcoGen Martin Generating Facility Indiantown, FL 66 No No Eucalyptus grandis

U.S. EcoGen LLC U.S. EcoGen Okeechobee LLC Okeechobee, FL 66 No No Eucalyptus grandis

U.S. EcoGen LLC U.S. EcoGen Polk Generating Facility Fort Meade, FL 66 No No Waste wood, eucalyptus grandis

Union County Utilities Authority Covanta Union Inc. Rahway, NJ 44 No No Municipal solid waste

United States Sugar Corporation United States Sugar Corporation Clewiston, FL 50 Yes No Bagasse

US Renewables Group Niagara Generation LLC Niagara Falls, NY 56 No Yes Woody biomass, treated wood, tire-derived fuel, petroleum coke

USA Energy Group LLC Penobscot Energy Recovery Orrington, ME 25 No No Municipal solid waste, woody biomass

Warm Springs Forest Products Industries Warm Springs Forest Products Warm Springs, OR 9 Yes No Mill residue

Wasatch Integrated Waste Management District Wasatch Integrated Energy Recovery Layton, UT 1.6 No No Municipal solid waste

We Energies Rothschild Biomass Cogeneration Plant Rothschild, WI 50 Yes No Urban wood waste, mill residue

Wheelabrator Technologies Inc. Wheelabrator Concord Company LP Concord, NH 14 No No Municipal solid waste

Wheelabrator Technologies Inc. Wheelabrator Falls Inc. Morrisville, PA 53.3 No No Municipal solid waste

Wheelabrator Technologies Inc. Wheelabrator Gloucester Company LP Westville, NJ 14 No No Municipal solid waste

Wheelabrator Technologies Inc. Wheelabrator Hudson Falls LLC Hudson Falls, NY 15 No No Municipal solid waste

Wheelabrator Technologies Inc. Wheelabrator Millbury Inc. Worcester, MA 46 No No Municipal solid waste

Wheelabrator Technologies Inc. Wheelabrator North Andover Inc. North Andover, MA 40 No No Municipal solid waste

Wheelabrator Technologies Inc. Wheelabrator North Broward Inc. Pompano Beach, FL 68 No No Municipal solid waste

Wheelabrator Technologies Inc. Wheelabrator Portsmouth Portsmouth, VA 60 Yes No Municipal solid waste

Wheelabrator Technologies Inc. Wheelabrator Ridge Energy Inc. Auburndale, FL 50 No No Woodwaste, tire-derived fuel, landfill gas

Wheelabrator Technologies Inc. Wheelabrator Saugus Inc. Saugus, MA 38 No No Municipal solid waste

Wheelabrator Technologies Inc. Wheelabrator Shasta Energy Co. Inc. Anderson, CA 50 No No Logging and mill residue, ag residue

Wheelabrator Technologies Inc. Wheelabrator South Broward Inc. Davie, FL 66 No No Municipal solid waste

Wheelabrator Technologies Inc. Wheelabrator Westchester LP Peekskill, NY 59.7 No No Municipal solid waste

Xcel Energy Bay Front Power Plant Ashland, WI 40 No No Wood waste, err ties

Xcel Energy French Island Generating Plant La Crosse, WI 30.4 No No Refuse-derived fuel, wood waste, RR ties

Xcel Energy Red Wing Red Wing, MN 20 No No Refuse-derived fuel, wood

Xcel Energy Wilmarth Generating Station Mankato, MN 20 No No Refuse-derived fuel, wood

York County Solid Waste Authority Covanta York Renewable Energy LLC York, PA 36.5 No No Municipal solid waste

Total Existing Nameplate Capacity: 6863 MW

Total Under Construction Nameplate Capacity: 107 MWTotal Proposed Nameplate Capacity: 479 MW

Page 11: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 11

Advantek Energy - Prospect PlantAgri Fibers Inc.ATP-SC LLCAlexander Energy Inc.Allegheny Pellet CorporationAllendale White Pellet PlantAmerican Pellet CompanyAmerican Wood Fibers - CirclevilleAmerican Wood Fibers - MarionAmerican Wood Fibers - WisconsinAppalachian Wood PelletsArbor Pellet LLCAssociated Harvest Inc.Barefoot Pellet CompanyBear Mountain Forest Products - Cascade LocksBear Mountain Forest Products- BrownsvilleBearlodge Forest ProductsBeaver Wood EnergyBiomass Power Louisiana LLCDry Creek ProductsPA PelletsBlue Mountain Lumber ProductsNew Biomass EnergyThermogen IndustriesConfluence Energy-KremmlingConfluence Energy-WaldenCorinth Wood Pellets LLCCornerstone Biomass Corp.Curran Renewable Energy LLCDejno’s Inc.Dover Resources Inc.Amite BioEnergyMorehouse BioEnergyEB Clean Energy Ltd. - BoardmanEden PelletsEnergex Pellet Fuel Inc.Enginuity Worldwide LLCEnova Energy Group - JohnstonEnova Energy Group - NahuntaEnova Energy Group - GordonEnviro Energy LLCEnvironmental Energy Partners LLCEnviva Pellets AhoskieEnviva Pellets AmoryEnviva Pellets Northampton LLCEnviva Pellets Southampton LLCEnviva Pellets WigginsE-Pellets Group - AthensEquustock - ChesterEquustock - ClareEquustock - MontebrookEquustock - TroyErnst BiomassEssex Pallet & PelletEureka Pellet MillsF.E. Wood & Sons - Natural EnergyFiber By-Products - White PigeonFiber Energy Products AR LLCOzark Hardwood PelletsFiber Recovery Inc.Fiber Resources Inc.Forest Energy Corp.Appling County Pellets LLCHazlehurst Wood Pellets, LLCFrank PelletsFulghum Graanul Oliver LLCOgeechee River Pellet MillGeneral Biofuels - GeorgiaGeneva Wood FuelsGerman Pellets Louisiana LLCGerman Pellets TexasGlobal Harvest OrganicsGo Green International Inc.Golden Peanut Co. - DawsonGolden Peanut Co. - HeadlandGreat Lakes Renewable Energy Inc.Green Circle Bio Energy-Miss. plantGreen Friendly Pellets LLCGreene Team Pellet Fuel CompanyGulf Coast Renewable EnergyHamer Pellet Fuel ElkinsHassell & Hughes Lumber CompanyHannas Candle CompanyHenry County Hardwoods Inc.Highland Pellets LLC - Pine BluffHorizon Biofuels Inc.Indeck Energy Ladysmith Biofuel Center LLC

ProspectRapid CityAllendaleSt. Mary’sYoungsvilleAllendaleCorunnaCirclevilleMarionSchofieldKingwoodSalt Lake CityLa FargevilleTroyCascade LocksBrownsvilleHulettFair HavenNatchitochesArcadeUlyssesPendletonQuitmanPortsmouthKremmlingWaldenCorinthLive OakMassenaKenoshaStocktonGlosterMorehouse ParishBoardmanChesapeakeMifflintownColumbiaJohnstonNahuntaGordonUnadillaSilver PlumeAhoskieAmoryGarysburgFranklinWigginsAthensChesterClareMontbrookTroyMeadvilleKeesevilleEurekaWest BaldwinWhite PigeonMountain ViewSeymourRinglePine BluffShow LowBaxleyHazlehurstMill CityOliverMillenSandersvilleStrongOllaWoodvilleAuroraPaigeDawsonHeadlandHaywardGeorge CountyBalsam LakeGarards FortWest MonroeElkinsCollinwoodFayettevilleParisWhite HallFremontLadysmith

MESDSCPAPASCMIOHVAWIWVUTNYPAORORWYVTLANYPAORMSNHCOCOMEFLNYWICAMSLAORVAPAMOSCGAGANYCONCMSNCVAMSGAVAMIFLVAPANYMTMEMIARMOWIARAZGAGAORGAGAGAMELATXMOTXGAALWIMSWIPALAWVTNARTNARNEWI

120,0008,047

13,0008,500

77,16266,13912,00050,00075,00025,000

Undisclosed60,000

8,00045,00040,000

120,0005,000

110,0001,000,000

100,00050,00020,000

250,000110,231100,000

65,00075,000

220,500100,000

40,00035,000

500,000496,040

30,00045,000

120,0006,000

500,000150,000545,644

1,80018,000

365,00090,000

551,156551,156136,000496,040

80,00036,00040,00040,00025,000

6,000Undisclosed

343,92165,00039,68385,00075,00050,00062,000

220,462551,156

21,000200,000396,832440,000

90,0001,100,000

551,15550,000

220,462UndisclosedUndisclosed

70,000500,000

17,00050,00060,00060,00030,000

2,00040,000

551,15620,00090,000

NoNoYesNoNoYesNoYesYesYesNoYesNoNoYesNoNoNoYesNoNoNoYesYesNoNoYesYesYesNoYesYesYesNoYesNoNoYesYesYesNoNoYesYesYesYesYesYesYesYesYesYesNoNoNoYesNoNoNoNoNoNoYesYesYesYesYesYesNoYesYesNoYesYesYesYesNoNoNoNoNoNoNoNoYesNoYes

Pine Beetle WoodPlant and Wood BiomassHardwoodHardwoodSoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwoodHardwood and SoftwoodHardwoodHardwoodSoftwoodSoftwoodSoftwoodHardwood and SoftwoodSoftwoodHardwoodSoftwoodHardwood and SoftwoodHardwood and SoftwoodWoody BiomassSoftwoodSoftwoodHardwood and SoftwoodMill Residue (Yellow Pine)Hardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodWoody BiomassWoody Biomass/Wheat/Corn Stover/Areundo DonuxHardwood and SoftwoodHardwoodCorn Stover/MiscanthusSoftwoodSoftwoodWoody BiomassMixed Grass/WeedsSoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and Softwood

Hardwood and SoftwoodHardwood and SoftwoodSoftwoodHardwood and SoftwoodSwitch GrassHardwood and SoftwoodSoftwoodHardwood and SoftwoodHardwoodHardwoodHardwoodHardwoodHardwoodSoftwoodHardwood and SoftwoodSoftwoodSoftwoodHardwood and SoftwoodWoody BiomassSoftwoodHardwoodSoftwoodHardwood and SoftwoodAlfalfa/Wood Residuals/Poultry LitterForest ThinningsPeanut HullsPeanut HullsHardwood and SoftwoodSoftwoodHardwoodHardwoodHardwood and SoftwoodHardwoodHardwoodWood Fiber/WaxHardwood

Hardwood and Softwood

Europe

Asia, EuropeAsia, EuropeAsia

Japan, Korea

Japan

Europe

EuropeEurope

United KingdomEuropeBelgium, Italy

Asia

United Kingdom

Europe

Europe

EuropeEuropeEuropeEuropeEuropeEuropeAustralia, Europe, Iceland, Italy, Korea, TaiwanAustralia, Europe, Iceland, Italy, Korea, TaiwanAustralia, Europe, Iceland, Italy, Korea, TaiwanAustralia, Europe, Iceland, Italy, Korea, Taiwan

Europe

EuropeEuropeEuropeEuropeEurope, United Kingdom

EuropeEurope

EuropeUnited KingdomUnited KingdomGermany, Netherlands, Poland

Europe

Canada

COMPANY PLANT NAME LOCATION FEEDSTOCK

PRODUCTIONCAPACITY (SHORT TONS/YR) EXPORTING DESTINATION

Note: Pellet mill map as of March 11, 2015-To add a pellet production facility to this map email [email protected]

Find up-to-date information at :www.biomassmagazine.com/plants/listplants/pellet/US/Source: Pellet Mill Magazine / BBI International

Pellet Mill Map List

Advantek Energy LLCAgri Fibers Inc.Agri-Tech Producers LLCAlexander Energy Inc.Allegheny Pellet CorporationAllendale White Pellet PlantAmerican Pellet CompanyAmerican Wood FibersAmerican Wood FibersAmerican Wood FibersAppalachian Wood PelletsArbor Pellet LLCAssociated Harvest Inc.Barefoot Pellet CompanyBear Mountain Forest ProductsBear Mountain Forest ProductsBearlodge Forest ProductsBeaver Wood EnergyBiomass Secure Power Inc.BioMaxx Inc.BioMaxx Inc.Blue Mountain Lumber ProductsBTH Quitman Hickory LLCCate Street CapitalConfluence Energy-KremmlingConfluence Energy-WaldenCorinth Wood Pellets LLCCornerstone Biomass Corp.Curran Renewable Energy LLCDejno’s Inc.Dover CapitalDrax Biomass International Inc.Drax Biomass International Inc.EB Clean Energy Ltd. - BoardmanEden PelletsEnergex CorporationEnginuity Worldwide LLCEnova Energy GroupEnova Energy GroupEnova Energy Group - GordonEnviro Energy LLCEnvironmental Energy Partners LLCEnviva LPEnviva LPEnviva LPEnviva LPEnviva LPE-Pellets Group LLCEquustock LLCEquustock LLCEquustock LLCEquustock LLCErnst BiomassEssex Pallet & PelletEureka Pellet Mills Inc.F.E. Wood & Sons - Natural EnergyFiber By-Products Corp.Fiber Energy Products AR LLCFiber Energy Products AR LLCFiber Recovery Inc.Fiber Resources Inc.Forest Energy Corp.Fram Renewable Fuels LLCFram Renewable Fuels LLCFrank PelletsFulghum Graanul Oliver LLCGeechee Energy LLCGeneral BiofuelsGeneva Wood Fuels LLCGerman Pellets GmbHGerman Pellets GmbHGlobal Harvest Organics LLCGo Green International Inc.Golden Peanut Company, Hull and FiberGolden Peanut Company, Hull and FiberGreat Lakes Renewable Energy Inc.Green Circle Bio Energy IncGreen Friendly Pellets LLCGreene Team Pellet Fuel CompanyGulf Coast Renewable EnergyHamer Pellet FuelHassell & Hughes Lumber CompanyHCC BrandsHenry County Hardwoods Inc.Highland Pellets LLCHorizon Biofuels Inc.Indeck Energy Services Inc.

Color KeyExisting Under Construction Proposed

Page 12: 2016 Biomass Industry Directory

12 | 2016 Biomass Industry Directory

U.S. Pellet Producers (continued)

International Biomass Energy LLCIsabella PelletNorthern Renewable EnergyGreen Circle Bio Energy IncJensen Lumber Co.Kirtland Products LLCKoetter & Smith Inc.Lee Energy SolutionsGreenwood FuelsLignetics of Idaho IncLignetics of Virginia Inc.Lignetics of West Virginia Inc.Log Hard Premium Pellets Inc.LowCountry BiomassMaeder Brothers Quality Wood Pellets Inc.Maine Woods Pellet CompanyMallard Creek Inc.Manke Lumber CompanyMarth Peshtigo Pellet Co. - PeshtigoMarth Wood Shavings SupplyMichigan TimberMichigan Wood FuelsMt. Taylor - WoodYouRecycleMt. Taylor Machine Pellet FuelNature’s Earth Pellets - LaurinburgNature’s Earth Pellets - ReformSpearfish Pellet Co. LLCDeposit Manufacturing FacilityJaffrey Manufacturing FacilitySchuyler Manufacturing FacilityNorth Idaho Energy Logs - HauserNorth Idaho Energy Logs - Moyie SpringsNortheast Pellets LLCNortheast Wood Products LLC - LigonierNortheast Wood Products LLC - PeeblesMalheur Pellet MillOlympus Pellets - SheltonO’Malley Wood PelletsOrganic Green Solutions - GreenvillePacific Pellet LLCPatterson Wood Products Inc.Pellet America Corp.Pellet Technology USAPellheat Inc.Penn Wood Products Inc.Colombo Energy Inc - GreenwoodPotomac Supply LLCLemhi Valley PelletsQueston Wood PelletsRisley Pellet Solutions LLCRocky Canyon Pellet Co.Dillard Composite SpecialtiesGeorgia BiomassShow Me Energy CooperativeSomerset Pellet FuelSouth Shore Biofuels LLCSouthern Indiana HardwoodsSouthern Kentucky Pellet Mill Inc.Southwest Renewable ResourcesSuperior Pellet Fuels LLCTelfair Forest Products LLCDeadwood Biofuels LLCWestervelt Renewable Energy LLCTrae Fuels Ltd - Pellet PlantTri State BiofuelsTurman Hardwood PelletsInstantheat Wood Pellets Inc.Varn Wood PelletsVermont Wood Pellet Co. LLCVulcan Renewables LLCVulcan Wood ProductsWest Oregon Wood Products - BanksWest Oregon Wood Products - Columbia CityWestern Wood Products Inc.Wood Pellet CoopWood Pellets C&C Smith LumberWoodgrain Millwork Inc.Woodshed Renewables LLCZilkha Biomass - CrockettZilkha Biomass - MonticelloZilkha Biomass - Selma

Lake IsabellaInternational FallsCottondaleOvidBoyne CityBordenCrossvilleGreen BayKootenaiKenbridgeLinnSpartansburgRidgelandWeidmanAthensRocklinTacomaPeshtigoMarathonFlintHollandAlbuquerqueMilanLaurinburgReformSpearsfishDepositJaffreySchuylerHauserMoyie SpringsAshlandLigonerPeeblesJohn DaySheltonTappahannockGreenvilleRedmondNacogdochesAppletonGretnaGlen HopeEast BerlinGreenwoodKinsaleSalmonWest WindsorMonticelloGrangevilleRoseburgWaycrossKingsvilleSomerset

HuntingburgGamalielSnowflakeNorth PoleLumber CityRapid CityAlicevilleBumpassLemont FurnaceGalaxAddisonHobokenNorth ClarendonSt AugustineVulcanBanksColumbia CityRatonPierzSummerhillPrinevilleFinleyCrockettMonticelloSelma

ALMIMNFLIDMIINALWIIDVAWVPASCMIMECAWAWIWIMIMINMNMNCALSDNYNHNYIDIDMEINOHORWAVAFLORTXWINEPAPASCVAIDVTWIIDORGAMOKYKYINKYAZAKGASDALVAPAVANYGAVTFLMIORORNMMNPAORNDTXARAL

Hardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodSoftwoodHardwood and SoftwoodHardwoodHardwoodPaper WasteSoftwoodHardwoodHardwoodHardwoodHardwoodHardwoodHardwood and SoftwoodSoftwoodSoftwoodHardwoodHardwoodSoftwoodHardwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodSoftwoodSoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodSoftwoodSoftwoodHardwood and SoftwoodHardwoodHardwood and SoftwoodSoftwoodSoftwoodHardwood

HardwoodSoftwoodPaper WasteCorn Stover/Corn Syrup/DDGSHardwoodHardwood

SoftwoodHardwood and SoftwoodSoftwoodHardwoodHardwood and SoftwoodSoftwoodSoftwoodBiomass CropsHardwoodHardwoodHardwoodHardwoodSoftwoodSoftwoodSoftwoodSoftwoodSoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwoodHardwoodSoftwoodSoftwoodSoftwoodHardwood and SoftwoodSoftwoodSoftwoodDebarked Clean Wood ChipsHardwoodHardwoodSoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and Softwood

485,01740,00050,000

660,00015,00035,00015,000

110,000120,000

80,00070,000

125,00025,000

220,46222,046

105,00060,00038,00064,00064,00018,00050,000

6,0006,000

100,00075,00055,00084,00084,00084,00060,00050,00040,000

130,00065,00022,00050,00040,000

100,00040,00040,00050,000

2,5005,0005,000

460,00050,000

2,60060,00042,00010,00040,000

825,00015,00050,000

100,00010,00012,00018,00035,000

150,00071,000

309,000130,000

50,00028,00050,00088,00016,600

132,2779,000

30,00050,00040,000

Undisclosed36,000

Undisclosed22,04644,000

413,000303,136

YesNoNoYesNoNoNoYesNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoYesYesNoNoNoYesNoNoNoNoYesNoNoNoNoNoYesNoNoNoNoNoYesNoNoNoNoNoNoNoYesYes

Europe, Japan, Scandinavia, S. Korea

United Kingdom

Canada, Italy, South KoreaCanada, Italy, South Korea

Japan

Italy

Undisclosed

Europe

Europe

EuropeEurope

Europe

Europe, Korea

Australia, Italy, S. KoreaAustralia, Italy, S. Korea

Asia, EuropeEuropeAsia, Europe

COMPANY PLANT NAME LOCATION FEEDSTOCK

PRODUCTIONCAPACITY (SHORT TONS/YR) EXPORTING DESTINATION

Total U.S. Existing Capacity - U.S. 11,158,927Total U.S. Under Construction Capacity - U.S. 3,381,698Total U.S. Proposed Capacity - U.S. 6,715,301

Pellet Mill Map List

International Biomass Energy LLCIsabella PelletJAL Holding LLCJCE Group ABJensen Lumber Co.Kirtland Products LLCKoetter & Smith Inc.Lee Energy SolutionsLibra GroupLigneticsLigneticsLigneticsLog Hard Premium Pellets Inc.LowCountry BiomassMaeder Bros. Inc.Maine Woods Pellet CompanyMallard Creek Inc.Manke Lumber CompanyMarth Peshtigo Pellet CompanyMarth Peshtigo Pellet CompanyMichigan TimberMichigan Wood FuelsMt. Taylor Machine Pellet FuelMt. Taylor Machine Pellet FuelNature’s Earth Pellet Energy LLCNature’s Earth Pellet Energy LLCNeiman Enterprises Inc.New England Wood Pellet LLCNew England Wood Pellet LLCNew England Wood Pellet LLCNorth Idaho energy Logs Inc.North Idaho energy Logs Inc.Northeast Pellets LLCNortheast Wood Products LLCNortheast Wood Products LLCOchoco Lumber CompanyOlympus PelletsO’Malley Wood PelletsOrganic Green SolutionsPacific Pellet LLCPatterson Wood Products Inc.Pellet America Corp.Pellet Technology USAPellheat Inc.Penn Wood Products Inc.PortucelPotomac Supply LLCQb Corp.Queston Inc.Risley Pellet Solutions LLCRocky Canyon Pellet Co.Roseburg Forest ProductsRWE Innogy CogenShow Me Energy CooperativeSomerset Pellet FuelSouth Shore Biofuels LLCSouthern Indiana HardwoodsSouthern Kentucky Pellet Mill Inc.Southwest Renewable ResourcesSuperior Pellet Fuels LLCTelfair Forest Products LLCThe Earth Partners LPThe Westervelt CompanyTrae Fuels ltdTri State BiofuelsTurman Hardwood PelletsTwo Rivers TimberVarn Wood ProductsVermont Wood Pellet Co. LLCVulcan Renewables LLCVulcan Wood ProductsWest Oregon Wood Products Inc.West Oregon Wood Products Inc.Western Wood Products Inc.Wood Pellet CoopWood Pellets C&C Smith LumberWoodgrain Millwork Inc.Woodshed Renewables LLCZilkha Biomass EnergyZilkha Biomass EnergyZilkha Biomass Energy

Color KeyExisting Under Construction Proposed

Page 13: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 13

Canadian Pellet Producers

Canadian Northern Timber Canadian Northern Timber Courtice IndustriesDansonsDiacarbon EnergyDirect Pellet Industries Inc.Energex CorporationFoothills Forest Products Inc.Gildale FarmsGranules LGGranules LGGroupe Savoie Inc.H.J. Crabbe & Sons Ltd.K.D. Quality PelletsLa Crete Sawmills Ltd.LacWood IndustriesLauzon Recycled Wood Energy Inc.Lauzon Recycled Wood Energy Inc.Manning Diversified Forest Products LTD.Marwood Ltd.Meadow Lake Tribal Council Pellet MillMuskoka Timber Mills Ltd.New Forest Industries (Parent)Northern Energy Solutions Ltd.Pacific BioEnergy CorporationPinnacle Renewable Energy Inc. (Parent)Pinnacle Renewable Energy Inc. (Parent)Pinnacle Renewable Energy Inc. (Parent)Pinnacle Renewable Energy Inc. (Parent)Pinnacle Renewable Energy Inc. (Parent)Pinnacle Renewable Energy Inc. (Parent)Pinnacle Renewable Energy Inc. (Parent)Premium Pellet Ltd.Princeton Co-Generation Corp.Protocol Energy CorpRentech Inc.Rentech Inc.Resolute Forest ProductsShaw Resources - BelleduneShaw Resources - ShubenacadieSMG Wood PelletSPB SolutionsT.P. Downey & Sons Ltd.Trebio Renewable BiomassVanderhoof Specialty Wood ProductsVanderwell Contractors Ltd.Viridis Energy Inc.Viridis Energy Inc.Wawasum GroupWhitesand First Nation

Atlantic Fiber Resources - GoosebayAtlantic Fiber Resources - ChandlerHamilton BiofuelFriendly Fuels LimitedMerritt Wood Pellet and Torrefaction PlantDirect Pellet IndustriesGranules Combustibles Energex, Inc.Foothills Forest Products, Inc.Gildale FarmsGranules LG Inc.Granules LG InternationalGroupe Savoie Inc.H.J. Crabbe & Sons Ltd.K.D. Quality PelletsLa Crete Sawmills Ltd.LacWood IndustriesLauzon Recycled Wood Energy - PapineauvilleLauzon Recycled Wood Energy - Saint-PaulinNorth Country 100% Softwood PelletsMarwood Ltd.Meadow Lake Tribal Council Pellet MillMuskoka Timber Mills Ltd.New Forest Industries (Pellet Mill)Northern Energy Solutions Ltd.Pacific Bioenergy Pellet MillHouston Pellet Limited Partnership, Houston, BCPinnacle Renewable Energy Inc. - ArmstrongPinnacle Renewable Energy Inc. - Burns LakePinnacle Renewable Energy Inc. - QuesnelPinnacle Renewable Energy Inc. - StrathnaverPinnacle Renewable Energy Inc. - Williams LakeTolko/Pinnacle Pellet Plant - LavingtonPremium Pellet Ltd.Princeton Co-Generation Corp.Protocol Biomass Corp.Rentech Inc. - AtikokanRentech Inc. - WawaThunder Bay Pellet PlantShaw Resources - BelleduneShaw Resources - ShubenacadieMission Wood PelletSPB Bio MaterialsT.P. Downey & Sons Ltd.Trebio Renewable BiomassVanderhoof Specialty Wood ProductsVanderwell Contractors Ltd.Okanagan Pellet Co. Inc.Scotia Atlantic Biomass Co. Inc.Wawasum GroupWhitesand First Nation

GoosebayChandlerHamiltonEdmontonMerrittHaliburtonLac-MéganticGrande CacheSt. MarysSt-FelicienMashteuiatshSt-QuentinBristolNew LiskeardLa CreteHearstPapineauvilleSaint-PaulinHotchkissFrederictonMeadow LakeBracebridgeNew RichmondMiramichiPrince GeorgeHoustonArmstrongBurns LakeQuesnelStrathnaverWilliams LakeLavingtonVanderhoofPrincetonPrescottAtikokanWawaThunder BayBelleduneShubenacadieMissionPeterboroughWeldonPortage-du-FortVanderhoofSlave LakeWest KelownaMiddle MusquodoboitGreenstoneArmstrong

NLQCONABBCONQCABONQCQCNBNBONABONQCQCABNBSKONQCNBBCBCBCBCBCBCBCBCBCBCONONONONNBNSBCONNBQCBCABBCNSONON

120,000190,000

50,00027,21685,000

Undisclosed120,000

30,00012,000

120,00080,00055,00040,00045,00070,00010,00058,00058,06015,00010,000

6,00050,000

125,000200,000400,000220,000

60,000440,000100,000220,000200,000270,000140,000108,000400,000100,000450,000

45,000100,000

50,000160,000

UndisclosedUndisclosed

130,00015,00050,00060,000

120,00067,00068,000

YesYesYesNoYesYesYesNoNoYesYesYesNoYesYesYesYesYesYesNoNoNoYesYesNoYesYesYesYesYesYesNoNoYesYesYesYesNoYesNoYesYesNoYesNoYesYesYesYesYes

Denmark, Sweden United Kingdom

KoreaItalyEurope, USA

Italy, USAItaly, USAEuropeUSAUnited KingdomUndisclosedItalyEurope

Asia, Europe, USA

Europe

Asia, EuropeAsia, EuropeAsia, EuropeAsia, EuropeAsia, EuropeAsia, Europe

Asia, EuropeEuropeEuropeEurope

Europe

AsiaUSA

Europe

USAEuropeEuropeEuropeEurope

SoftwoodHardwood and SoftwoodHardwood and SoftwoodSoftwoodMill ResidueHardwood and SoftwoodHardwood and SoftwoodSoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodSoftwoodHardwood and SoftwoodSoftwoodSoftwoodHardwoodHardwoodSoftwoodSoftwoodSoftwoodHardwood and SoftwoodHardwood and Softwood

SoftwoodSoftwoodSoftwoodSoftwoodSoftwoodHardwood and SoftwoodSoftwoodMill ResidueSoftwoodSoftwoodHardwood and Softwood

Crown Forest WoodSoftwoodHardwood and SoftwoodHardwood and Softwood

Oat HullsHardwood and SoftwoodHardwood and SoftwoodSoftwoodSoftwoodSoftwoodHardwood and SoftwoodHardwoodHardwood and Softwood

COMPANY PLANT NAME LOCATION FEEDSTOCK

PRODUCTION CAPACITY (METRIC TONS/YR) EXPORTING DESTINATION

Pellet Mill Map List

Total Existing Capacity - Canada 3,242,060Total Under Construction Capacity - Canada 855,000Total Proposed Capacity - Canada 1,452,216

Color KeyExisting Under Construction Proposed

Page 14: 2016 Biomass Industry Directory
Page 15: 2016 Biomass Industry Directory

PARTNERSHIPS FOR INNOVATIONDRIVING SUCCESS IN BIOENERGY

REGISTER NOW bioenergyconference.org

Contact us for more information: Event Manager, Cam McAlpinecam bioenergyconference.org • +1.250.961.6611

Join us in Prince George, Canada for the 7th International Bioenergy Conference and Exhibition.

Over the three days of the conference, held at the centre of one of the largest biomass fi bre baskets

in the world, there will be many opportunities to learn more about the industry in British Columbia

as well as the latest global trends in fi bre supply, sustainability, products, technology, policies and

other drivers of the future bioeconomy.

15 - 17 JUNE 2016PRINCE GEORGE, BC, CANADA

Page 16: 2016 Biomass Industry Directory

Ag Products & Services Feedstock Collection Systems

Ag Products & Services

Associations & Organizations

Feedstock Collection Systems

Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]

AGCO Corporation4205 River Green ParkwayDuluth, GA 30096 USGlenn Farris, Segment Strategy Manager, Biomass/IndustrialsPhone (770-662-0256)[email protected]

New Holland Agriculture500 Diller AvenueNew Holland, PA 17557 USJarrod Angstadt, Manager, Growth Initiatives, Biomass & SpecialtyPhone (281-687-9159) | Fax (281-763-2632)[email protected]/na

Feedstock Procurement

Equinox LLC4255 43rd Ave SFargo, ND 58104 USKyle Althoff, PresidentPhone (303-910-6052)[email protected]

Associations & Organizations

Advanced Biofuels USA507 North Bentz StreetFrederick, MD 21701 USJoanne Ivancic, Executive DirectorPhone (301-644-1395)[email protected]

Biomass Thermal Energy Council1211 Connecticut Ave NW #650Washington, DC 20036 USJoel Stronberg, Executive DirectorPhone (202-596-3974) | Fax (202-223-5537)[email protected]

International Bioenergy Conference & Exhibition PO Box 1421323 5th AvePrince George, V2L 4R9 CANADACam McAlpine, PresidentPhone (250-961-6611)[email protected]/SEE OUR AD ON PAGE 15

Page 17: 2016 Biomass Industry Directory

www.nsfsustainability.org | [email protected] | +1 734 827 5668

North American pellet manufacturers now have the opportunity

to obtain certification to the Sustainable Biomass Partnership

Framework through NSF Sustainability, the first approved

SBP certification body in North America and leader in forest

certification services.

Get certified to the SBP Framework through

Associations & Organizations

International Biomass Conference & ExpoPhone (866-746-8385)[email protected] OUR AD ON PAGE 14

Global Pellet Market Outlook SummitPhone (866-746-8385)[email protected]

Conferences/Trade Shows & Meetings

Maine Pellet Fuels Association 97A Exchange StreetSuite 305Portland, ME 04101 USWilliam Bell, Executive DirectorPhone (207-752-1392)[email protected]

Certifications

Associations & Organizations

Certifications

NSF International789 N. Dixboro RoadAnn Arbor, MI 48105 USJamie Bush, Business Development Manager - SustainabilityPhone (734-827-5668)[email protected] OUR AD ON PAGE 17

Control Union Certifications150 North University DriveSuite 210Plantation, FL 33324 USRobert Demianew, Regional DirectorPhone (954-900-2087)[email protected]://controlunion.com/en

Page 18: 2016 Biomass Industry Directory

18 | 2016 Biomass Industry Directory

Conferences/Trade Shows & Meetings

Conferences/Trade Shows & Meetings

Balers - Rectangle

AGCO Corporation4205 River Green ParkwayDuluth, GA 30096 USGlenn Farris, Segment Strategy Manager, Biomass/IndustrialsPhone (770-662-0256)[email protected]

Forest Concepts, LLC3320 West Valley Hwy NAuburn, WA 98001 USMike Perry, CEOPhone (253-333-9663) | Fax (253-833-2639)[email protected]

Balers - Round

Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]

Briquetting

DI PIÙ - Sunomi LLCP.O. Box 347Plainfield, VT 05667 USGiordano Checchi, PresidentPhone (802-454-9310)[email protected]

Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]

Chippers - Brush

Morbark, Inc. 8507 S. Winn Rd, PO Box 1000Winn, MI 48896 USMichael Stanton, Regional Sales ManagerPhone (800-831-0042) | Fax (989-866-2280)[email protected]

Please visit www.cbi-inc.com or call 603-382-0556Continental Biomass Industries

22 Whittier StreetNewton, NH 03858

RECYCLING SYSTEMS DONE RIGHT.

Within the construction and demolition waste recycling industry, CBI’s complete, custom systems allow for the separation of usable (recyclable) materials from mixed waste. The unusable waste is shredded into a reduced size; therefore, it takes up far less space in landfills. In some cases, a single landfill can be used for 30 years longer as a result of this size reduction. This results in less landfills and more natural surroundings!

CBI_Directory Listing_2016.indd 1 11/19/2015 11:23:32 AM

Densification & Size Reduction

International Fuel Ethanol Workshop & ExpoPhone (866-746-8385)[email protected]

Page 19: 2016 Biomass Industry Directory

Densification & Size ReductionDensification & Size Reduction Chippers - Brush

Please visit www.cbi-inc.com or call 603-382-0556Continental Biomass Industries

22 Whittier StreetNewton, NH 03858

RECYCLING SYSTEMS DONE RIGHT.

Within the construction and demolition waste recycling industry, CBI’s complete, custom systems allow for the separation of usable (recyclable) materials from mixed waste. The unusable waste is shredded into a reduced size; therefore, it takes up far less space in landfills. In some cases, a single landfill can be used for 30 years longer as a result of this size reduction. This results in less landfills and more natural surroundings!

CBI_Directory Listing_2016.indd 1 11/19/2015 11:23:32 AM

Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]

West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38

Chippers - Rechipper

West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38

Chippers - Whole Log

Morbark, Inc. 8507 S. Winn Rd, PO Box 1000Winn, MI 48896 USMichael Stanton, Regional Sales ManagerPhone (800-831-0042) | Fax (989-866-2280)[email protected]

Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]

ANDRITZ5405 Windward Parkway, Suite 100WAlpharetta, GA 30004 USDave Evans, Area Sales ManagerPhone (770-640-2431)[email protected] OUR AD ON PAGE 22

Grinders - Horizontal

Morbark, Inc. 8507 S. Winn Rd, PO Box 1000Winn, MI 48896 USMichael Stanton, Regional Sales ManagerPhone (800-831-0042) | Fax (989-866-2280)[email protected]

Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]

Apollo Equipment2062 20th Ave. S.E.Largo, FL 33771 USWayne Brown, Executive Vice PresidentPhone (503-585-1442) | Fax (727-585-3499)[email protected]

Page 20: 2016 Biomass Industry Directory
Page 21: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 21

Densification & Size Reduction Grinders - Horizontal

Continental Biomass Industries (a Terex brand)22 Whittier St.Newton, NH 03858 USArt Murphy, Marketing ManagerPhone (603-382-0556)[email protected] OUR AD ON PAGE 19

Rawlings Waste Wood Recovery SystemsPO Box 4485Missoula, MT 59806 USJohn Rawlings, PresidentPhone (406-728-6182) | Fax (406-728-7957)[email protected] OUR AD ON PAGE 18

Vecoplan, LLCPO Box 7224High Point, NC 27264 USYuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)[email protected] OUR AD ON PAGE 16

Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]

West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38

Grinders - Tub

Morbark, Inc. 8507 S. Winn Rd, PO Box 1000Winn, MI 48896 USMichael Stanton, Regional Sales ManagerPhone (800-831-0042) | Fax (989-866-2280)[email protected]

Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]

Grinders - Vertical

Virtus Equipment340 Commerce Drive, Unit BCrystal Lake, IL 60014 USThomas Breslin, PresidentPhone (815-477-2100)[email protected]

Renewable Energy Consultants, LLCPO Box 41Beavertown, PA 17813 USBob Rice, President/CEOPhone (570-765-2020)[email protected] OUR AD ON PAGE 23

Vecoplan, LLCPO Box 7224High Point, NC 27264 USYuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)[email protected] OUR AD ON PAGE 16

West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38

Mills - Hammer

CPM Global Biomass Group181 Davis Johnson Dr, Suite JRichland, MS 39218 USTim Gilbert, Sales ManagerPhone (601-932-9080) | Fax (601-932-9081)[email protected] OUR AD ON PAGE 20

ANDRITZ FEED AND BIOFUEL336 West PennMuncy, PA 17756 USMike Curci, Capital Sales Manager BiomassPhone (850-557-7674) | Fax (770-640-2521)[email protected]://www.andritz-sprout.com/SEE OUR AD ON PAGE 22

Bliss Industries, LLC1415 W. Summit AveP.O. Box 910 (74602)Ponca City, OK 74601 USChad Cook, V.P. Marketing & SalesPhone (580-765-7787) | Fax (580-762-0111)[email protected]

Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36

Pellet Mills

CPM Global Biomass Group181 Davis Johnson Dr, Suite JRichland, MS 39218 USTim Gilbert, Sales ManagerPhone (601-932-9080) | Fax (601-932-9081)[email protected] OUR AD ON PAGE 20

LM Machinery and Equipment, LLC401 Liberty Ave. Three Gateway Center, Suite 1651Pittsburgh, PA 15222 USWladimiro Labeikovsky, PresidentPhone (412-608-8528) | Fax (412-904-7530)[email protected]://www.lm-machinery.net/

ABC Machinery19F, Suite B, Global Trade Mansion, Wenfeng AvenueAnyang, HENAN 455000 ChinaTina Lee, General ManagerPhone (86-372-5965148)[email protected]://www.pellet-machine.com/

ANDRITZ FEED AND BIOFUEL336 West PennMuncy, PA 17756 USMike Curci, Capital Sales Manager BiomassPhone (850-557-7674) | Fax (770-640-2521)[email protected]://www.andritz-sprout.com/SEE OUR AD ON PAGE 22

Bliss Industries, LLC1415 W. Summit AveP.O. Box 910 (74602)Ponca City, OK 74601 USChad Cook, V.P. Marketing & SalesPhone (580-765-7787) | Fax (580-762-0111)[email protected]

Densification & Size Reduction

Page 22: 2016 Biomass Industry Directory

22 | 2016 Biomass Industry Directory

Densification & Size Reduction

Densification & Size Reduction Pellet Mills

Education

International Generator Technical CommunityPO Box 370Columbus, OH 43215 USJane Hutt, Webmaster and Site ManagerPhone (360-515-7861)webmaster@generatortechnicalforum.orgwww.powerplanttechnicalforum.org

Education

GEMCO Energy MachinerySuite B,4/F Jinhao Business Bld.,Renmin Rd.,Anyang,Henan,P.R.C455000 CHINAYanooka Yang, Pellet Mill ManufacturerPhone (0086-372-5965148)Fax (0086-372-5951936)[email protected]://www.gcmec.com

ProcessBarron2770 Welborn StreetPelham, AL 35124 USCliff Moss, Vice PresidentPhone (205-663-5330)[email protected] OUR AD ON PAGE 30

Renewable Energy Consultants, LLCPO Box 41Beavertown, PA 17813 USBob Rice, President/CEOPhone (570-765-2020)[email protected] OUR AD ON PAGE 23

Vecoplan Midwest4005 Earnings WayNew Albany, IN 47150 USBill Miller, Chief Operating OfficerPhone (812-923-4992)[email protected] OUR AD ON PAGE 16

Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]

Pyrolysis

Biochar Now, LLC1907 Gail CtLoveland, CO 80537 USJames Gaspard, EVP Business DevelopmentPhone (970-622-8071)[email protected]

Heyl & Patterson Inc.400 Lydia StreetCarnegie, PA 15106 USDavid Phillips, Marketing & Communications ManagerPhone (412-788-9810)Fax (412-788-9822)[email protected]

Vulcan Systems1414 Riley Industrial Dr., PO Box 98Moberly, MO 65270 USPreston Whitney, Vice President of Business DevelopmentPhone (660-263-7575) | Fax (660-263-2526)[email protected] OUR AD ON PAGE 32

Torrefaction

CNFbiofuel5038 Salida BlvdPO Box 1316Salida, CA 95368 USJohn Paoluccio, PresidentPhone (209-545-1663) | Fax (209-545-3533)[email protected]

Heyl & Patterson Inc.400 Lydia StreetCarnegie, PA 15106 USDavid Phillips, Marketing & Communications ManagerPhone (412-788-9810) | Fax (412-788-9822)[email protected]

Vulcan Systems1414 Riley Industrial Dr., PO Box 98Moberly, MO 65270 USPreston Whitney, Vice President of Business DevelopmentPhone (660-263-7575)Fax (660-263-2526)[email protected] OUR AD ON PAGE 32

Page 23: 2016 Biomass Industry Directory

Employment Executive Search

2017 Biomass Industry Directory | 23

Engineering & Construction

MULTI-FUEL, MOVING GRATE, BIOMASS BOILER

HOT WATER & STEAM / AUTOMATIC ASH REMOVAL

WOOD CHIPS, POULTRY LITTER / HORSE MANURE

PELLETS / RICE HULLS 2,000,000 BTU to 20,000,000 BTU

RENEWABLE ENERGY

CONSULTANTS, LLC

BIOMASS EQUIPMENT SUPPLY CO.(Div. of REC, LLC)

MULTI-FUEL BIOMASS BOILERBIOCHAR SYSTEM / AUTO ASH REMOVAL

CONTAINER SYSTEMS / COLORING SYSTEMSDRYING SYSTEM

100,000 BTU / 300,000 BTU / 500,000 BTU

ANDMULTI-FUEL HOT WATER BOILER

AUTO ASH REMOVALWOOD CHIPS / POULTRY LITTER /

HORSE MANUREGRASSES / PELLETS

68,000 BTU to 1,700,000 BTU

P.O. Box 41Beavertown, PA 17813

570-765-2020 / [email protected]://renewableenergyconsult.us

Densification & Size Reduction

Education

Anaerobic Digestion Systems

ADI Systems Inc.370 Wilsey RoadFredericton, NB E3B 6E9 CANADAShannon Grant, PresidentPhone (506-452-7307)[email protected]

BIOFerm Energy Systems440 Science DriveSte 300Madison, WI 53711 USWhitney Beadle, Marketing CommunicationsPhone (608-229-6504)[email protected]

BIOGAS Equity 2, Inc.130 Eleanor Dr.Woodside, CA 94062 USMike Muller, COOPhone (650-283-9555)[email protected]

Impact Bioenergy Inc.1001 NW 167th StShoreline, WA 98177 USJan Allen, PresidentPhone (206-250-3242)[email protected]

RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]

UEM1818 S. Australian Ave. Suite 110West Palm Beach, FL 33409 USNina Kshetry, Project ManagerPhone (561-294-0138)Fax (561-683-2996)[email protected]

Biomethane

Morrow Renewables, LLCPO Box 61447Midland, TX 79711 USLuke Morrow, PresidentPhone (432-563-0447)[email protected]

First Environment, Inc.91 Fulton StreetBoonton, NJ 07005 USKristy Cerullo, Marketing/Proposal ManagerPhone (973-334-0003Fax (973-334-0928)[email protected]

RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]

Three-esVia Libertà 105Lazzate, MB 20824 ITALYMarco Soldo, ManagerPhone (0039-02-9632-8225) | Fax (0039-02-9632-0029)[email protected]

Executive Search

H.T. PROF Clean Tech575 N. Patterson Ave.Suite 444Winston-Salem, NC 27101 USTodd Porter, PresidentPhone (770-420-7440) | Fax (770-420-7440)[email protected]/clean-tech.htm

Olson Search International, Inc.PO Box 3127Redmond, WA 98073 USJon Olson, PresidentPhone (800-985-5191) | Fax (406-756-5154)[email protected]

Employment

Page 24: 2016 Biomass Industry Directory

Engineering & Construction Buildings

Engineering & Construction

Buildings

Legacy Building Solutions 19500 County Rd 142South Haven, MN 55382 USJenniefer Halverson, Business ResourcePhone (320-258-0500)jhalverson@legacybuildingsolutions.comwww.legacybuildingsolutions.com/industries/waste-recycling/

Alberici Constructors, Inc.8800 Page Ave.Saint Louis, MO 63114 USVictoria Fleddermann, Director of Business DevelopmentPhone (314-733-2256)[email protected]

ICS, Inc. PO Box 13158Grand Forks, ND 58208-3158 USDavid Dangerfield, Project DevelopmentPhone (701-775-8480)Fax (701-775-8479)[email protected]

Miron Construction Co., Inc.1471 McMahon DriveNeenah, WI 54956 USDan Goymerac, Vice President Industrial Business DevelopmentPhone (920-969-7004)Fax (920-969-7393)[email protected]

Rubb Buildings Inc.1 Rubb LaneSanford, ME 04073 USChuck Auger, Marketing ManagerPhone (207-324-2877)[email protected]

CHP Systems

Turboden Srl628 Hebron Avenue, Suite 400Glastonbury, CT 06033 USIlaria Peretti, Manager, Sales & Business Development North AmericaPhone (860-881-0281)[email protected] OUR AD ON PAGE 28

PPS Group LLC 4717 Grand Ave. Suite 300Kansas City, MO 64112 USLou Gonzales, PresidentPhone (816-627-0606)Fax (816-531-2195)[email protected]

Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/

Renewable Energy Consultants, LLCPO Box 41Beavertown, PA 17813 USBob Rice, President/CEOPhone (570-765-2020)[email protected] OUR AD ON PAGE 23

RR Renewable Energy23 Lafayette StRumson, NJ 07760 USGeorge Saintonge, PresPhone (732-768-7007)Fax (732-741-2087)[email protected]

Experience and Innovation Working for You

We are a full service, consulting engineering firm that provides a broad range of professional engineering services. Our multi-disciplined staff has served state and local governments as well as industrial and commercial clients across the United States and around the world.

1658 Malvern AvenueHot Springs, AR 71901

501-321-2276

Multiple locations to serve you

200 MacKenan Drive Cary, NC 27511919-481-1084

70 Spring StreetMillinocket, ME 04462

207-723-6871

We have provided engineering services and management to Biomass, Bio-Energy & Green Energy Industries for projects and companies of every size at sites all across North America.

From the feedstock handling to the final emission controls, let us utilize our expertise and 45 years of experience

to design engineering solutions for your specific needs.

Call us today at

501-321-2276

www.mseco.comFor more information visit

Page 25: 2016 Biomass Industry Directory

Engineering & Construction

Engineering & Construction CHP Systems

RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]

Civil Engineering

Mid-South Engineering1658 Malvern AvenueHot Springs, AR 71901 USMark Culpepper, Vice PresidentPhone (501-321-2276)Fax (501-624-4214)[email protected] OUR AD ON PAGE 24

Detailed Design

PPS Group LLC 4717 Grand Ave. Suite 300Kansas City, MO 64112 USLou Gonzales, PresidentPhone (816-627-0606) | Fax (816-531-2195)[email protected]

Mid-South Engineering1658 Malvern AvenueHot Springs, AR 71901 USMark Culpepper, Vice PresidentPhone (501-321-2276) | Fax (501-624-4214)[email protected] OUR AD ON PAGE 24

District Heating Systems

Wisewood, Inc2409 N. Kerby Ave. Portland, OR 97227 USMeagan Nuss, Project Development CoordinatorPhone (503-706-6187) | Fax (503-715-0483)[email protected]

Electrical

APT Consulting Group Co., Ltd.3/1 Muang Thong Thani Bldg. C7Popular Road, BangpootPakgret, Nonthaburi, 11120 THAILANDJohn Diecker, Managing DirectorPhone (6624-02-5235)[email protected]

ISC Companies12905 Highway 55 WestMinneapolis, MN 55441 USLindsay Distel, MarketingPhone (763-559-0033) | Fax (763-519-1574)[email protected]

EPC

Dome Technology 4946 North 2900 EastIdaho Falls, ID 83401 USLane Roberts, Business Development ManagerPhone (208-227-1485)[email protected]

Alberici Constructors, Inc.8800 Page Ave.Saint Louis, MO 63114 USVictoria Fleddermann, Director of Business DevelopmentPhone (314-733-2256)[email protected]

Fagen, Inc.501 W Hwy 212Granite Falls, MN 56241 USRick Cantor, VP - Business DevelopmentPhone (864-627-0060) | Fax (320-564-3324)[email protected]

Page 26: 2016 Biomass Industry Directory

PPS Group LLC 4717 Grand Ave. Suite 300Kansas City, MO 64112 USLou Gonzales, PresidentPhone (816-627-0606) | Fax (816-531-2195)[email protected]

Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/

Fabrication

Columbia Specialty Co, Inc.5875 Obispo AveLong Beach, CA 90805 USGreg Stuck, Shop ManagerPhone (562-634-6425) | Fax (562-408-2914)[email protected] OUR AD ON PAGE 27

AGRA Industries1211 West Water StreetMerrill, WI 54452 USPat Hinner, PresidentPhone (800-842-8033)[email protected] OUR AD ON PAGE 26

Basic Machinery Company1220 Harold Andrews RoadSiler City, NC 27344-0688 USEd ONeil, Director of Business DevelopmentPhone (919-200-3435)[email protected] OUR AD ON PAGE 35

Kent Industrial Co., Ltd.No.17, Dou-Kung 9th Rd., Dou Liu Expanded Industrial Park, Dou Liu City,Yun Lin Hsien, 640 TAIWANSteve Lien, Sales ManagerPhone (88655575356) | Fax (88655575136)[email protected]://www.surface-grinder-kentind.com/

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]

Precision Injection-Multiplas Enginery Co., Ltd.No.65, Technology 7th Road, Hwa-Ya Technology Park,Taoyuan, 33333 TAIWANApple Wang, Marketing SpecialistPhone (88633180090) | Fax (88633975498)[email protected]://www.injection-molding-machines.com/

Gasifi ers

Biotech Energy102 Pineridge DriveMissoula, MT 59803Patrick Browne, Vice President of Sales and MarketingPhone (518-564-0513)[email protected] OUR AD ON PAGE 25

Columbia Specialty Co, Inc.5875 Obispo AveLong Beach, CA 90805 USGreg Stuck, Shop ManagerPhone (562-634-6425) | Fax (562-408-2914)[email protected] OUR AD ON PAGE 27

Green Star Gasifi ers, LLC127 Dishman Ln, Suite B-1Bowling Green, KY 42101 USChris Jeff ries, PresidentPhone (270-904-4964) | Fax (270-721-0134)info@greenstargasifi ers.comwww.GreenStarGasifi ers.com

Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/

Engineering & Construction EPC

www.AgrAInd.com800-842-8033 AGRA has Custom-DesigneD Biomass solutions for You!

to faBriCationfrom Design

AGRAIndustries

Your ePC ContraCtor

to ComPletion!

Engineering & Construction

Page 27: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 27

(562) 634-6425 | WWW.COLUMBIASPECIALTY.COM2) 634-6425 | WWW.COLUMBIASW.COLU BIAS62) 634-6425 | WWW.COLUMBIASPECIALTY.COWWW.CO| W2) MWWW

CALL US TODAY, WE WILL HELP YOUTURN YOUR IDEAS INTO FINISHED PRODUCTS

TODAY, WE WILL HELP YOUCALL US TODAY, WE WILL HELP YOUTODAY, WTODODAY, WE UP YLP YOUHE OTO OOCUSTOM MANUFACTURING

SPECIALIZING IN WELDING AND MACHINING OF HIGHTEMPERATURE, CORROSION RESISTANT ALLOYS.

ALIZING IN WELDING AND MACHINING OF HIGIN WELDING AND MACHINING OF HIGHCIALIZING IN WELDING AND ALIZZING IN WELDING AND ACHINING OF HIGHACMAMACAAAZZIZZIZZZ NGINZ G ACHINING OF HHIGC HCZZZZZ NZ NGH OIH GC ACIALC AERATURE CORROSION RESISTANT ALORROSION RESISTANT ALLOYSMPERATURE CORROSION RERATURE CORROSION R SISTANT ALLOYSREEE STANT ALLOOYSTT N L

DISTRIBUTOR AND FABRICATOR OF CARBON, STAINLESS AND ALLOY PIPING MATERIALS

Engineering & Construction Gasifi ers

Engineering & ConstructionSmart E2 Solutions14 Edgewood RoadRumson, NJ 07760 USGeorge St.Onge, Director of Business DevelopmentPhone (732-768-7007) | Fax (732-758-1169)[email protected]

Information Technology Services

ALDATA Software203, 211 Pembina Ave.Hinton, AB T7V 2B3 CANADAMike Meagher, President and CEOPhone (780-865-3249) | Fax (780-665-4242)[email protected]

Simplyfeye Softwares Pvt LtdFlat S1, 2nd Floor, 8-3-970Srinagar ColonyHyderabad 500073 INDIAAnshuman Bansal, DirectorPhone (914042217057)[email protected]://www.simplyfeye.com

Management Services

Alberici Constructors, Inc.8800 Page Ave.Saint Louis, MO 63114 USVictoria Fleddermann, Director of Business DevelopmentPhone (314-733-2256)[email protected]

Piping

Columbia Specialty Co, Inc.5875 Obispo AveLong Beach, CA 90805 USGreg Stuck, Shop ManagerPhone (562-634-6425) | Fax (562-408-2914)[email protected] OUR AD ON PAGE 27

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]

Plant Optimization

Mid-South Engineering1658 Malvern AvenueHot Springs, AR 71901 USMark Culpepper, Vice PresidentPhone (501-321-2276) | Fax (501-624-4214)[email protected] OUR AD ON PAGE 24

Power Plant Construction

Turboden Srl628 Hebron Avenue, Suite 400Glastonbury, CT 06033 USIlaria Peretti, Manager,Sales & Business Development North AmericaPhone (860-881-0281)[email protected] OUR AD ON PAGE 28

ASI Industrial1300 Minnesota AveBillings, MT 59101 USRobert Hamlin, PresidentPhone (406-245-6231) | Fax (406-245-6236)[email protected]

Casey Industrial, Inc.1400 West 122nd Ave., Ste 200Westminster, CO 80234 USTom Lepak, Vice PresidentPhone (720-974-2659)[email protected]

Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/

Page 28: 2016 Biomass Industry Directory

28 | 2016 Biomass Industry Directory

Page 29: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 29

Engineering & Construction

Engineering & Construction Power Plant Construction

TEi Construction Services170 Tucapau RdDuncan, SC 29334 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/tei-construction-services-incSEE OUR AD ON PAGE 7

Pyrolysis

Columbia Specialty Co, Inc.5875 Obispo AveLong Beach, CA 90805 USGreg Stuck, Shop ManagerPhone (562-634-6425) | Fax (562-408-2914)[email protected] OUR AD ON PAGE 27

Enginuity Worldwide651 E Commerce RoadMexico, MO 65255 USNancy Heimann, President, CEOPhone (573-567-4417)[email protected]

Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/

Vulcan Systems1414 Riley Industrial Dr., PO Box 98Moberly, MO 65270 USPreston Whitney, Vice President of Business DevelopmentPhone (660-263-7575) | Fax (660-263-2526)[email protected] OUR AD ON PAGE 32

Stacks

Hoffmann, Inc.6001 49th St. SouthMuscatine, IA 52761 USPaul Reed, Silo & Chimney Sales ManagerPhone (563-263-4733) | Fax (563-263-0919)[email protected]

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]

Structural Fabrication

Columbia Specialty Co, Inc.5875 Obispo AveLong Beach, CA 90805 USGreg Stuck, Shop ManagerPhone (562-634-6425) | Fax (562-408-2914)[email protected] OUR AD ON PAGE 27

Alaska Structures9024 Vanguard Drive #101Anchorage, AK 99507 USAlaska Structures, InquiryPhone (907-344-1565)[email protected]://alaskastructures.com

Basic Machinery Company1220 Harold Andrews RoadSiler City, NC 27344-0688 USEd ONeil, Director of Business DevelopmentPhone (919-200-3435)[email protected] OUR AD ON PAGE 35

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]

Torrefaction

Vulcan Systems1414 Riley Industrial Dr., PO Box 98Moberly, MO 65270 USPreston Whitney, Vice President of Business DevelopmentPhone (660-263-7575) | Fax (660-263-2526)[email protected] OUR AD ON PAGE 32

Page 30: 2016 Biomass Industry Directory

30 | 2016 Biomass Industry Directory

FUEL | AIR | GAS | ASH processbarron.com/biomass

205-663-5330

BIOMASS to ENERGYProcessBarron is there every step of the way.

Biomass diagram july 15.indd 1 6/9/2015 10:20:30 AM

Engineering & Construction

Engineering & Construction Water Treatment

Water Treatment

Columbia Specialty Co, Inc.5875 Obispo AveLong Beach, CA 90805 USGreg Stuck, Shop ManagerPhone (562-634-6425) | Fax (562-408-2914)[email protected] OUR AD ON PAGE 27

RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]

Feedstock Supply

Ag Residues

Global Sustainable Products, Inc.4879 Magnolia RoadMarianna, FL 32448 USJoe Busby, PresidentPhone (850-209-1331)[email protected]

Biomass Based Fuel Oil

Green Energy of FL12429 Colony Preserve DrBoynton Beach, FL 33436 USJeff Balsewich, CEOPhone (561-922-7475)[email protected]

Briquettes

Karr Group Co.14500 Roscoe Blvd. Ste 203Panorama City, CA 91402 USKevin Talwar, Sales DirectorPhone (805-479-5565) | Fax (805-479-5565)[email protected]

Page 31: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 31

www.cratos.us.com

Biomass Conveyor Systems Ash handling and fuel delivery

Lehra Energy Resources Pvt LtdLehra near Dehlon District Ludhiana PunjabLudhiana , 141118 INDIAHardeep Singh Ubhi, Executive Director Phone (00919815771137) | Fax (01612885137)[email protected]

Dedicated Energy Crops

Genera Energy Inc167 Tellico Port RoadVonore, TN 37803 USSam Jackson, VP, Business DevelopmentPhone (423-884-4110)[email protected]

Pellets

Curran Renewable Energy, LLC20 Commerce DriveMassena, NY 13662 USKelli Curran, Marketing ManagerPhone (315-769-2000)[email protected]

Golden Peanut and Tree NutsP.O. Box 186Headland, AL 36345 USBeverly Warrington, Director, Hull & Fiber ProductsPhone (334-693-0011) | Fax (334-693-0112)[email protected]

Lewis & Raulerson1759 State StreetWaycross, GA 31501 USMike Cifranic, Sales EngineerPhone (912-282-0975) | Fax (912-285-3283)[email protected]

ProcessBarron2770 Welborn StreetPelham, AL 35124 USCliff Moss, Vice PresidentPhone (205-663-5330)[email protected] OUR AD ON PAGE 30

ProPellet, LLC807 Broadway Street NE, Suite 185Minneapolis, MN 55413 USKathy Osborne, Business Development ManagerPhone (612-616-7409)[email protected]

Wood Chips

CDW Consultant GroupP.O. Box 923Bloomington, TX 77951 USCharles White, Managing MemberPhone (361-237-9339) | Fax (210-800-9993)[email protected]

M-E-C Company4401 Belle Oaks Drive,Suite 210Charleston, SC 29405 USStephen Rice, COOPhone (620-325-2673) | Fax (620-325-2678)[email protected]

Feedstock Supply

Feedstock Supply Briquettes

Legal Services

Attorney

Conn Maciel Carey5335 Wisconsin Avenue, NWSuite 660Washington, DC 20015 USEric J. Conn, Chair, OSHA Practice GroupPhone (202-715-6244) | Fax (202-827-7903)[email protected]

Davis Brown Law Firm215 10th Street, Suite 1300Des Moines, IA 50309 USBill Hanigan, AttorneyPhone (515-288-2500) | Fax (515-243-0654)[email protected]:/www.davisbrownlaw.com

Husch Blackwell LLP13330 California StSuite 200Omaha, NE 68154 USDavid Gardels, PartnerPhone (402-964-5027)[email protected]

Potomac Law Group, PLLC6225 Hampstead Ct.Port Tobacco, MD 20677 USNeil Belson, Of Counsel and Chair of Life Sciences PracticePhone (240-416-7239) | Fax (301-392-9806)[email protected]://www.potomaclaw.com/attorney-profiles/neil-belson/

Page 32: 2016 Biomass Industry Directory

Algae and Cellulose DryingAlgae and Cellulose Dryinggyinyingygae and Cellulond Celluloseuloseeaaa DDe Dosseselosee Dryryulol oseulose Drse DAlg eaaaa sosod Ced CAlggAAlga ee and CeAlgae and CeCellulose DDDDD y ngDrryi ggng

Woody Biomass DryingWoody Biomass Drying

Torrefaction & CharcoalTorrefaction & Charcoalaal

32 | 2014 Biomass Industry Directory

Page 33: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 33

Legal Services Attorney

Legal Services

Schnader Harrison Segal & Lewis LLPSuite 2700 Fifth Avenue Pl.120 Fifth AvenuePittssburgh , PA 15222 USMegan Harmon, PartnerPhone (412-577-5200)[email protected]

Business

LLJ Consulting & Business Development16675 Market AvenueCologne, MN 55322 USLarry Johnson, OwnerPhone (952-466-3363)[email protected]

Zhengzhou Victor Machinery Co LtdWenhua Roand and Sanquan RoadZhengzhou, CHINAJames Duan, SalesmanPhone (008637156747890)[email protected]://victormachinez.com/

Permit & License

Alcohol Tax Consultants, Inc.P.O. Box 1595Madison Square StationNew York, NY 10159 USMatt Zuckerman Phone (917-771-9906)[email protected]

Material Handling & Storage

Conveyor-Belt

4B Components Ltd.625 Erie AvenueMorton, IL 61550 USJohnny Wheat, PresidentPhone (309-698-5611)[email protected]/usa

Basic Machinery Company1220 Harold Andrews RoadSiler City, NC 27344-0688 USEd ONeil, Director of Business DevelopmentPhone (919-200-3435)[email protected] OUR AD ON PAGE 35

ProcessBarron2770 Welborn St.Pelham, AL 35124 USCliff Moss, VP and Director of Materials Handling DivisionPhone (205-663-5330)[email protected] OUR AD ON PAGE 30

Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]

Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 29

Conveyor-Drag

Sigma Thermal, Inc4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 53

AFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286) | Fax (717-763-1066)[email protected]

DI PIÙ - Sunomi LLCP.O. Box 347Plainfield, VT 05667 USGiordano Checchi, PresidentPhone (802-454-9310)[email protected]

ProcessBarron2770 Welborn StreetPelham, AL 35124 USCliff Moss, Vice PresidentPhone (205-663-5330)[email protected] OUR AD ON PAGE 30

RUD Chain Inc.PO Box 367Hiawatha, IA 52233 USMike Mews, North American Sales ManagerPhone (319-375-3224)| Fax (319-214-0003)[email protected] OUR AD ON PAGE 31

Sukup Manufacturing Co.PO Box 6771555 255th St.Sheffield, IA 50475-0677 USJohn Hanig, Bin Sales DirectorPhone (641-892-4222)| Fax (641-892-4629)[email protected]

Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]

Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 29

Conveyor-Enclosed

Hudco Industrial Products, Inc.3100 Morgan RoadBessemer, AL 35022 USBryant Allen, General ManagerPhone (800-247-9908)[email protected]://www.hudcoinc.com/SEE OUR AD ON PAGE 34

Page 34: 2016 Biomass Industry Directory

34 | 2016 Biomass Industry Directory

“The Most Efficient Belt Conveyor in the World, is also the Cleanest and most Reliable.”

Biomass Engineering & Equipment1457 Sunday DriveIndianapolis, IN 46217 USTim Brown, Product SpecialistPhone (317-522-0864) | Fax (317-346-0811)[email protected]

Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]

Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 29

Conveyor-Mechanical

ASGCO “Complete Conveyor Solutions”301 Gordon StreetAllentown, PA 18102 USAaron Gibbs, PresidentPhone (610-821-0216) | Fax (610-778-8991)[email protected] OUR AD ON PAGE 39

Basic Machinery Company1220 Harold Andrews RoadSiler City, NC 27344-0688 USEd ONeil, Director of Business DevelopmentPhone (919-200-3435)[email protected] OUR AD ON PAGE 35

RUD Chain Inc.PO Box 367Hiawatha, IA 52233 USMike Mews, North American Sales ManagerPhone (319-375-3224) | Fax (319-214-0003)[email protected] OUR AD ON PAGE 31

Stock Equipment Company16490 Chillicothe RoadChagrin Falls, OH 44023 USSusan Wiltshire, Technical WriterPhone (440-543-6000) | Fax (440-543-5944)[email protected]://www.schenckprocess.com/stockequipment

Vecoplan, LLCPO Box 7224High Point, NC 27264 USYuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)[email protected] OUR AD ON PAGE 16

Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]

Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 29

Conveyor-Pneumatic

Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]

Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]

Conveyor-Screw

Sigma Thermal, Inc.4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 53

Material Handling & Storage Conveyor - Enclosed

Material Handling & Storage

Page 35: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 35

Material Handling & Storage

Material Handling & Storage Conveyor - Screw

DI PIÙ - Sunomi LLCP.O. Box 347Plainfield, VT 05667 USGiordano Checchi, PresidentPhone (802-454-9310)[email protected]

Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748)Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821)Fax (800-554-4040)[email protected]

ProcessBarron2770 Welborn StreetPelham, AL 35124 USCliff Moss, Vice PresidentPhone (205-663-5330)[email protected] OUR AD ON PAGE 55

Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790)Fax (559-591-5728)[email protected]

Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040)Fax (763-576-9070)[email protected] OUR AD ON PAGE 29

Cranes-Overhead

Processbio A/SPO Box 34 Romeo, MI 48065 USJorgen Lyngso, American RepresentativePhone (586-255-7075)[email protected]

Dryer - Conveyor

CPM Wolverine Proctor, LLC251 Gilbraltar RoadHorsham, PA 19044 USChris Law, Industry ManagerPhone (215-443-5200)Fax (215-443-5206)[email protected] OUR AD ON PAGE 37

General Kinematics5050 Rickert Rd.Crystal Lake, IL 60014 USDick Reeves, Industry Director - Resource RecoveryPhone (815-455-3222)Fax (815-455-2285)[email protected]

Dryer - Rotary Drum

Uzelac Industries, Inc.6901 Industrial LoopGreendale, WI 53129 USMichael Uzelac, PresidentPhone (414-529-0240)[email protected]

www.uzelacind.com

Vulcan Systems1414 Riley Industrial Dr., PO Box 98Moberly, MO 65270 USPreston Whitney, Vice President of Business DevelopmentPhone (660-263-7575)Fax (660-263-2526)[email protected] OUR AD ON PAGE 32

Page 36: 2016 Biomass Industry Directory

Material Handling & Storage Dryer - Rotary Drum

Material Handling & Storage

Astec, Inc.4101 Jerome AvenueChattanooga, TN 37407 USMalcolm Swanson, PresidentPhone (423-867-4210)Fax (423-867-4636)[email protected] OUR AD ON PAGE 72

Heyl & Patterson Inc.400 Lydia StreetCarnegie, PA 15106 USDavid Phillips, Marketing & Communications ManagerPhone (412-788-9810)Fax (412-788-9822)[email protected]

The Dupps Company548 North Cherry Street Germantown, OH 45327 USRichard Weeks, SalesPhone (937-855-6555)[email protected]

Elevator-Bolts

4B Components Ltd.625 Erie AvenueMorton, IL 61550 USJohnny Wheat, PresidentPhone (309-698-5611)[email protected]/usa

Elevator-Buckets

4B Components Ltd.625 Erie AvenueMorton, IL 61550 USJohnny Wheat, PresidentPhone (309-698-5611)[email protected]/usa

TAPCO Inc.225 Rock Industrial Park DriveSt. Louis, MO 63044 USYassine Abbad, International Sales ManagerPhone (314-739-9191)[email protected]

Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040)Fax (763-576-9070)[email protected] OUR AD ON PAGE 29

Loading-Equipment

Astec Bulk Handling Solutions86470 Franklin BoulevardEugene, OR 97405 USConor Brogan, Technical Sales ManagerPhone (800-314-4656)[email protected]

BOOTH 1131

Page 37: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 37

DYNATEK Loading Systems200 North Harrison StNorth Prairie, WI 53153 USGary Kuehneman, Director of Marketing & SalesPhone (262-392-2162) | Fax (262-392-2984)[email protected]

SAMSON Materials Handling Ltd.Gemini House, Cambridgeshire Business Park1 Bartholomew’s WalkEly, Cambridgeshire, CB74EA ENGLANDMalcolm Youll, Managing DirectorPhone (441353665001) | Fax (441353666734)[email protected]

Railcar-Moving

Heyl & Patterson Inc.400 Lydia StreetCarnegie, PA 15106 USDavid Phillips, Marketing & Communications ManagerPhone (412-788-9810) | Fax (412-788-9822)[email protected]

Railcar-Parts

Greenfield Products2979 167th St.Hazel Crest, IL 60429 USBill Healy, SalesPhone (708-336-3254)[email protected]://www.greenfieldpi.com/

Scale-Bulk Weigh

CompuWeigh Corporation50 Middle Quarter Rd.Woodbury, CT 06798 USTim Ciucci, V.P. of Sales & MarketingPhone (906-235-5221) | Fax (203-262-9400)[email protected]

Scale-Software

ALDATA Software203, 211 Pembina Ave.Hinton, AB T7V 2B3 CANANDAMike Meagher, President and CEOPhone (780-865-3249) | Fax (780-665-4242)[email protected]

Screens-Disc

Basic Machinery Company1220 Harold Andrews RoadSiler City, NC 27344-0688 USEd ONeil, Director of Business DevelopmentPhone (919-200-3435)[email protected] OUR AD ON PAGE 35

Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36

West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38

Your Partner in Productivity

Material Handling & Storage Loading-Equipment

Material Handling & Storage

Page 38: 2016 Biomass Industry Directory

38 | 2016 Biomass Industry Directory

Material Handling & Storage Screens-Disc Scalping

Material Handling & Storage

Screens-Disc Scalping

Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36

West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38

Screens-Fines

EBM Manufacturing1014 Sherwood RdNorfolk, NE 68701 USTiffany Palmer, Director of Sales & MarketingPhone (877-370-4948) | Fax (402-371-9117)[email protected] OUR AD ON PAGE 41

Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36

Rotex Global1230 Knowlton StreetCincinnati, OH 45223 USAustin Kephart, Marketing ManagerPhone (513-541-1236)[email protected]

West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38

Screens-Other

ANDRITZ FEED AND BIOFUEL336 West PennMuncy, PA 17756 USMike Curci, Capital Sales Manager BiomassPhone (850-557-7674) | Fax (770-640-2521)[email protected]://www.andritz-sprout.com/SEE OUR AD ON PAGE 22

Komptech Americas10855 Dover Street, Suite 1000Westminster, CO 80021 USBrandon Lapsys, VP of Sales & OperationsPhone (303-669-5637)[email protected]

Rotex Global1230 Knowlton StreetCincinnati, OH 45223 USAustin Kephart, Marketing ManagerPhone (513-541-1236)[email protected]

West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38

Screens-Trommel

Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]

West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38

Specialty Parts and Equipment

BEDESCHI AMERICA INC3275 W. Hillsboro BlvdSuite 312Deerfield Beach, FL 33442 USTom Turano, V.P.Phone (954-602-2175) | Fax (954-602-5390)[email protected]

Price LogPro, LLC 400 Aviation Plaza, Suite BHot Springs, AR 71913 USJosh Krauss, Vice President of SalesPhone (800-826-7803) | Fax (501-844-4474)[email protected]

Page 39: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 39

Material Handling & Storage Stockyard Equipment

Stockyard Equipment

Astec Bulk Handling Solutions86470 Franklin BoulevardEugene, OR 97405 USConor Brogan, Technical Sales ManagerPhone (800-314-4656)[email protected]

FMW Industrieanlagen GmbH3207 Lake Forest Dr.Augusta, GA 30909 USWalter Lampp, North American ManagerPhone (706-829-3337) | Fax (706-733-4115)[email protected]

SCHADE Lagertechnik GmbHBruchstrasse 1Gelsenkirchen, North Rhine-Westphaua 45883 GERMANYKarl-Heinz Fiegenbaum, Managing DirectorPhone (4920950316122)Fax (4920950316188)[email protected]

Storage - Bins

Javo International1900 Cobb International BlvdSuites G & HKennesaw, GA 30152 USJay Honeycutt, North American Account ManagerPhone (770-428-4491) | Fax (770-424-6635)[email protected]

Sigma Thermal, Inc.4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 36

AFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286) | Fax (717-763-1066)[email protected]

Material Handling & Storage

Page 40: 2016 Biomass Industry Directory
Page 41: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 41

Material Handling & Storage

Material Handling & Storage Screens-Bins

Chief Industries Agri/Industrial4400 East 39th StreetKearney, NE 68848 USLiz McGowan, Marketing AssistantPhone (308-238-2781)[email protected]

Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]

Sukup Manufacturing Co.PO Box 6771555 255th St.Sheffield, IA 50475-0677 USJohn Hanig, Bin Sales DirectorPhone (641-892-4222) | Fax (641-892-4629)[email protected]

Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]

Storage - Other

Javo International1900 Cobb International BlvdSuites G & HKennesaw, GA 30152 USJay Honeycutt, North American Account ManagerPhone (770-428-4491) | Fax (770-424-6635)[email protected]

Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]

Storage - Silos

Dome Technology 4946 North 2900 EastIdaho Falls, ID 83401 USLane Roberts, Business Development ManagerPhone (208-227-1485)[email protected]

DI PIÙ - Sunomi LLCP.O. Box 347Plainfield, VT 05667 USGiordano Checchi, PresidentPhone (802-454-9310)[email protected]

Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36

Sukup Manufacturing Co.PO Box 6771555 255th St.Sheffield, IA 50475-0677 USJohn Hanig, Bin Sales DirectorPhone (641-892-4222) | Fax (641-892-4629)[email protected]

Storage – Silo Reclaimer

Basic Machinery Company1220 Harold Andrews RoadSiler City, NC 27344-0688 USEd ONeil, Director of Business DevelopmentPhone (919-200-3435)[email protected] OUR AD ON PAGE 35

Continental Conveyor Ltd.470, St. Alphonse Street SouthPO Box 729Thetford Mines, QC G6G 3V8 CANADABrian Lynn, Vice PresidentPhone (418-338-4682) | Fax (418-338-4751)[email protected]

Jeffrey Rader, a brand of TerraSource Global215 Parkway East, Suite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36

Page 42: 2016 Biomass Industry Directory

42 | 2016 Biomass Industry Directory

Material Handling & Storage Trailer - Moving Floor

Material Handling & Storage

Trailer - Moving Floor

Hallco Industries Inc.PO Box 505Tillamook, OR 97141 USRicardo Aguinaga, VP of Sales and MarketingPhone (503-842-8746)[email protected]

Transportation - Rail

AIRMATIC INC284 Three Tun RdMalvern, PA 19355-3981 USTerry Dougherty, Customer Support SpecialistPhone (800-332-9770) | Fax (215-331-9770)[email protected]

Truck Receiving/Dumpers

Airoflex Equipment6001 49th St. SouthMuscatine, IA 52761 USAndy Christy, SalesPhone (563-264-8066) | Fax (651-631-2539)[email protected]

Astec Bulk Handling Solutions86470 Franklin BoulevardEugene, OR 97405 USConor Brogan, Technical Sales ManagerPhone (800-314-4656)[email protected]

Columbia Industries, LLC5775 NW Wagon WayHillsboro, OR 97124 USJoe Canova, VP Sales & MarketingPhone (503-531-0600) | Fax (503-531-0601)[email protected]

Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 29

Vibration Equipment

Rotex Global1230 Knowlton StreetCincinnati, OH 45223 USAustin Kephart, Marketing ManagerPhone (513-541-1236)[email protected]

Biodiesel Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203 USCustomer ServicePhone (866-746-8385)Fax (701-746-5367)[email protected]

Biomass Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203 US Customer ServicePhone (866-746-8385)Fax (701-746-5367)[email protected]

Ethanol Producer Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203 USCustomer ServicePhone (866-746-8385)Fax (701-746-5367)[email protected]

Pellet Mill Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203 USCustomer ServicePhone (866-746-8385)Fax (701-746-5367)[email protected]/pellet-mill-magazine

Media - Publications

Page 43: 2016 Biomass Industry Directory

Process Equipment & Services Air Pollution Control

Process Equipment & Services

Air Pollution Control

Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]

AFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286) | Fax (717-763-1066)[email protected]

Atlantic Combustion Technologies2 Tupper BlvdAmherst, NS B4H 4J5 CANADADavid Digdon, VP Global Business DevelopmentPhone (902-667-2808)[email protected] OUR AD ON PAGE 3

Babcock & Wilcox MEGTEC830 Prosper StreetDe Pere, WI 54115 USKathy Brugman, Sales & Marketing SpecialistPhone (920-337-1582)[email protected]

Babcock Power Environmental5 Neponset StreetWorcester, MA 01615 USJennifer Pasquariello, Director Marketing & Communications Phone (864-949-2917)[email protected]/products/environmental/babcock-power-environmentalSEE OUR AD ON PAGE 7

Dustex LLC100 Chastain Center Blvd. NW, Suite 195Kennesaw, GA 30144 USDarlene Huggins, VP, Business DevelopmentPhone (770-429-5575) | Fax (770-429-5556)[email protected]

Ecospray Technologies S.r.l.5 Thawmont DriveSewickley, PA 15143 USJo Ann Pacinelli, Senior Partner & Business Development ManagerPhone (412-427-0133) | Fax (412-741-8386)[email protected]

McGill AirClean LLC1777 Refugee RoadColumbus, OH 43207 USJerry Childress, National Sales ManagerPhone (614-829-1350) | Fax (614-445-8759)[email protected]

Monitor Tech Corporation661 N. James Rd.Columbus, OH 43219 USRobert Mullowney, CEOPhone (614-231-0500) | Fax (614-231-0555)[email protected] OUR AD ON PAGE 49

Tenmat LimitedAshburton Road WestTrafford ParkManchester, M17 1RU ENGLANDJoshua Cullen, Technical Sales EngineerPhone (00441619552425)Fax (00441618727596)[email protected]

Biogas-Capture

Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094)Fax (201-529-0252)[email protected]

Loci Controls, Inc.28 Dane StreetSomerville, MA 02143 USShaun Bamforth, Director of Business DevelopmentPhone (954-325-0210)[email protected]

RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]

Page 44: 2016 Biomass Industry Directory

44 | 2016 Biomass Industry Directory

Process Equipment & ServicesBiogas-Purification

Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094)Fax (201-529-0252)[email protected]

Greenlane Biogas208 - 4288 Lozells AvenueBurnaby, BC V5A 0C7 CANADARicardo Hamdan, Business DevelopmentPhone (778-788-0774)[email protected]

Biogas-Storage

JDV Equipment Corporation1 Princeton AveDover, NJ 07801 USSean King, VPPhone (973-366-6556)Fax (973-366-3193)[email protected] OUR AD ON PAGE 52

RIX Industries4900 Industrial WayBenicia, CA 94510 USDave Savidge, Director of Industrial and Commercial CompressorsPhone (707-745-7112)[email protected] OUR AD ON PAGE 43

Boilers - Control Agents

Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (229-346-3545)[email protected] OUR AD ON PAGE 2

Boilers - Direct Fired

Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/

Process Equipment & Services Biogas-Purification

Page 45: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 45

Process Equipment & Services

Process Equipment & Services Biogas-Purification

Process Equipment & ServicesAFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286)Fax (717-763-1066)[email protected]

Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (229-346-3545)[email protected] OUR AD ON PAGE 2

Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42

Northwest Manufacturing, Inc./WoodMaster600 Polk Ave SWRed Lake Falls, MN 56750 USGrant Gagner, Commercial Sales ManagerPhone (800-932-3629)Fax (218-253-4409)[email protected] OUR AD ON PAGE 40

Boilers - Firetube

Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (229-346-3545)[email protected] OUR AD ON PAGE 2

Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42

Webco Industries9101 W 21st StreetSand Springs, OK 74063 USJene Harmon, Marketing DIrectorPhone (918-245-2211)Fax (918-246-7053)[email protected]

Boilers - Fluidized Bed

Valmet, Inc.3440 Toringdon WaySuite 300Charlotte, NC 28277 USKerry Flick, Director, TechnologyPhone (704-541-1453)[email protected]

Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42

Outotec Energy Products3568 W Industrial LoopCoeur d’Alene, ID 83815 USKent Pope, Director of Business DevelopmentPhone (208-765-1611) | Fax (208-765-0503)[email protected]

Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/

Boilers - Hot Water

AFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286) | Fax (717-763-1066)[email protected]

Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (229-346-3545)[email protected] OUR AD ON PAGE 2

Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42

Northwest Manufacturing, Inc./WoodMaster600 Polk Ave SWRed Lake Falls, MN 56750 USGrant Gagner, Commercial Sales ManagerPhone (800-932-3629) | Fax (218-253-4409)[email protected] OUR AD ON PAGE 40

Boilers - Parts & Service

Boiler Tube Company of America506 Charlotte HighwayLyman, SC 29365 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/boiler-tube-co-of-america SEE OUR AD ON PAGE 7

Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (229-346-3545)[email protected] OUR AD ON PAGE 2

Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42

Riley Power Inc.5 Neponset StreetWorcester, MA 01615-0040 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/riley-power-incSEE OUR AD ON PAGE 7

Boilers - Solid Fuel

GARN Wood Heating3425 33rd Ave. NEMinneapolis, MN 55418 USMartin Lunde, PE, PresidentPhone (612-326-1100)[email protected]

Process Equipment & Services Boilers - Direct Fired

Page 46: 2016 Biomass Industry Directory

46 | 2016 Biomass Industry Directory

FLAMEX® systems can be customized to address the

fire hazards inherent in your process:Spark Detection & Suppression to eliminate sparks emanatingfrom rotary dryers andhammermills.

Automatic Deluge Systems fordust collectors, bins and silos.

“Hot Particle” Detectors to detect overheated pelletsfrom pelletizers and coolers.

High Speed Abort Gatesand Backdraft Dampers for material handling andclean air ducting.

Let us help you lower risks, increase productivity and comply with regulations.

Process Equipment & Services Boilers - Solid Fuel

Process Equipment & Services

Renewable Energy Consultants, LLCPO Box 41Beavertown, PA 17813 USBob Rice, President/CEOPhone (570-765-2020)[email protected] OUR AD ON PAGE 23

ACT Bioenergy30 Commerce Park DriveSchenectady, NY 12305 USLarry Farrelly, PresidentPhone (518-344-7490)[email protected]

AFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286) | Fax (717-763-1066)[email protected]

AgFuel Energy Systems90 Route 171P.O. Box 875Woodstock, CT 06281 USAmanda Simoneau, Director of Marketing and Business DevelopmentPhone (860-928-0703)[email protected]

AHONA - Alternative Heating of North America1614 County Highway 16Burlington Flats, NY 13315 USNathan Schoellig, DirectorPhone (607-643-6122)[email protected]

Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (229-346-3545)[email protected] OUR AD ON PAGE 2

Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42

Northwest Manufacturing, Inc./WoodMaster600 Polk Ave SWRed Lake Falls, MN 56750 USGrant Gagner, Commercial Sales ManagerPhone (800-932-3629)Fax (218-253-4409)[email protected] OUR AD ON PAGE 40

Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/

SmokeLess Heat LLC2020 Cornwall RdLebanon, PA 17042 USDean Zook, OwnerPhone (717-389-0083) Fax (717-273-2248)[email protected]

Page 47: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 47

Process Equipment & Services Boilers - Steam

Process Equipment & Services

Boilers - Steam

Babcock Power Services5 Neponset StWorcester, MA 01615-0040 USJennifer Pasquariello, Director Marketng & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/babcock-power-services-incSEE OUR AD ON PAGE 7

Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (2293463545)[email protected] OUR AD ON PAGE 2

Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42

Wellons2525 W Firestone LaneVancouver, WA 98660 USSalesPhone (360-750-3500)Fax (360-750-3400)[email protected]

Boilers - Waste Heat Recovery

Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (2293463545)[email protected] OUR AD ON PAGE 2

Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE

Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42

RCBC Global Inc.15 Pine Dr.Mills River, NC 28759 USDoug King, Marketing DirectorPhone (828-696-2111)Fax (828-696-2191)[email protected]

Cargo Inspection and Sampling

Control Union (U.S.A.), Inc.115 James Drive WestSuite 150Saint Rose, LA 70087 USDaniel O’Rourke, PresidentPhone (504-468-5485)[email protected]

Page 48: 2016 Biomass Industry Directory

48 | 2016 Biomass Industry Directory

Process Equipment & Services Centrifuges

Centrifuges

RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]

CIP

Pick Heaters, Inc.730 S. Indiana Ave.PO Box 516West Bend, WI 53095 USSales Dept.Phone (262-338-1191)Fax (262-338-8489)[email protected]

Cleaning

Atlantic Combustion Technologies2 Tupper BlvdAmherst, NS B4H 4J5 CANADADavid Digdon, VP Global Business DevelopmentPhone (902-667-2808)[email protected] OUR AD ON PAGE 3

Rotex Global1230 Knowlton StreetCincinnati, OH 45223 USAustin Kephart, Marketing ManagerPhone (513-541-1236)[email protected]

Combustion Equipment

Sigma Thermal, Inc.4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 53

Detroit Stoker Company1510 East First StreetMonroe, MI 48161 USTim Loviska, Director - Contract SalesPhone (734-241-9500)Fax (734-241-7126)[email protected] OUR AD ON PAGE 44

Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/

Round for a Reason LLC11698 395th AveColumbia, SD 57433 USAndrew Murray, MemberPhone (605-396-2431)[email protected]

Compressed Air Systems

RIX Industries4900 Industrial WayBenicia, CA 94510 USDave Savidge, Director of Industrial and Commercial CompressorsPhone (707-745-7112)[email protected] OUR AD ON PAGE 43

Condensors

Thermal Engineering Int’l (USA)10375 Slusher DriveSanta Fe Springs, CA 90670 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-exchangers/thermal-engineering SEE OUR AD ON PAGE 7

Control Systems

Sigma Thermal, Inc4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 53

4B Components Ltd.625 Erie AvenueMorton, IL 61550 USJohnny Wheat, PresidentPhone (309-698-5611)[email protected]/usa

Process Equipment & Services

Page 49: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 49

Process Equipment & Services Control Systems

Process Equipment & Services

Biomass Controls, LLC99 Canal StreetPO Box109Putnam, CT 06260 USMadilyn Smith, Corporate CounselPhone (860-928-0712)[email protected]

NDC Technologies8001 Technology BlvdDayton, OH 45424 USJay Luis, Marketing Communications ManagerPhone (937-233-9935)[email protected] OUR AD ON PAGE 48

VIC-Vecoplan Integrated Controls5708 Uwharrie RoadArchdale, NC 27263 USTodd Carswell, VP of Technical ServicesPhone (336-861-6070)[email protected] OUR AD ON PAGE 16

Control Systems - Distributed

Valmet 2750 Morris RoadLansdale, PA 19446 USDarryl Haag, Director, Energy SolutionsPhone (267-421-9770)[email protected]/industries-we-serve/energy/

Distillation & Dehydration Systems

Vogelbusch USA, Inc.1810 Snake River RoadKaty, TX 77449-7747 USDan Mahon, Vice PresidentPhone (713-461-7374)[email protected]

Dust Control - Baghouses

AFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286) | Fax (717-763-1066)[email protected]

Babcock & Wilcox MEGTEC830 Prosper StreetDe Pere, WI 54115 USKathy Brugman, Sales & Marketing SpecialistPhone (920-337-1582)[email protected]

BWF Envirotec, USA1800 Worldwide BlvdHebron, KY 41048 USLarry Brown, Sales ManagerPhone (859-282-4550) | Fax (859-282-4555)[email protected]

Scientific Dust Collectors4101 W. 126th StreetAlsip, IL 60007 USAndrew Rutherford, Sales ManagerPhone (708-597-7090) | Fax (708-597-0313)[email protected]

Western Pneumatics, Inc.PO Box 21340Eugene, OR 97402 USBruce Livesay, Vice PresidentPhone (541-461-2600) | Fax (541-461-2606)[email protected]

Dust Control - Inertial Separators

Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]

Dust Control - Unit Collectors

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]

Latta Equipment Co330 E. Hebron St.Charlotte, NC 28273 USMike Brown, OwnerPhone (704-752-7944)[email protected] http://www.lattaequipment.com/

ProcessBarron2770 Welborn StreetPelham, AL 35124 USPhillip Gore, Product ManagerPhone (205-663-5330)[email protected] OUR AD ON PAGE 30

Dust Control - Wet Scrubbers

Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]

Page 50: 2016 Biomass Industry Directory

50 | 2016 Biomass Industry Directory

Process Equipment & Services Energy Management

Process Equipment & Services

Energy Management

Hydroflex Systems, IncPO Box 296Hummelstown, PA 17043 USCathleen Kaiser, Co-OwnerPhone (717-480-4200)[email protected]

Active Energy Coalswitch LimitedMwalden Business ParkBath House RoadCardigan, Ceredigion, SA43 1JY UKChas Fritz, CEOPhone (2398516304)[email protected]

Babcock & Wilcox MEGTEC830 Prosper StreetDe Pere, WI 54115 USKathy Brugman, Sales & Marketing SpecialistPhone (920-337-1582)[email protected]

Environmental Testing

Monitor Tech Corporation661 N. James Rd.Columbus, OH 43219 USRobert Mullowney, CEOPhone (614-231-0500) | Fax (614-231-0555)[email protected] OUR AD ON PAGE 49

Fans

AirPro Fan & Blower Co.PO Box 543Rhinelander, WI 54501 USKeith White, Sales EngineerPhone (715-365-3267)[email protected]

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]

ProcessBarron2770 Welborn StreetPelham, AL 35124 USAllen Ray, Director of Air HandlingPhone (205-663-5330)[email protected] OUR AD ON PAGE 30

Filters

CLARCOR Industrial Air11501 Outlook Street, Suite 100Overland Park, KS 66210 USTim Stark, Director Aftermarket SalesPhone (816-313-4955)[email protected]

Fire Protection

FLAMEX, Inc.4365 Federal DriveGreensboro, NC 27410 USAllen Wagoner, PresidentPhone (336-299-2933) | Fax (336-299-2944)[email protected]/SEE OUR AD ON PAGE 46

GreCon Spark Detection15875 SW 74th Ave.Tigard, OR 97224 USTerry Franklin, Technical Sales DirectorPhone (503-641-7731) | Fax (503-641-7508)[email protected]/spark-detection/SEE OUR AD ON PAGE 47

Firefly ABTextilgatan 31Stockholm, 12030 SWEDENMikael Jidenius, Area Sales ManagerPhone (4684492500) | Fax (4684492501)[email protected]

Page 51: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 51

Geltech Solutions1460 Park Lane South, Suite 1Jupiter, FL 33458 USMatt Struzziero, Director of Sales & Strategic OperationsPhone (800-924-4874) | Fax (561-427-6182)[email protected] OUR AD ON PAGE 50

Industrial Fire Prevention LLCPO Box 2046118 E. Hancock St.Milledgeville, GA 31059 USJeffrey Nichols, PresidentPhone (770-266-7223) | Fax (770-266-7223)info@industrialfireprevention.comwww.IndustrialFirePrevention.com

Furnaces

Sigma Thermal, Inc.4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 53

AgFuel NorthEast, LLC99 Canal StreetPO Box 109Putnam, CT 06260 USMadilyn Smith, Corporate CounselPhone (860-928-0703)[email protected]

Energy Unlimited Inc.P.O. Box 74855 Highway YZDodgeville, WI 53533 USDave Lundell, ForemanPhone (608-935-9119) | Fax (608-935-0008)[email protected]

Northwest Manufacturing, Inc./WoodMaster600 Polk Ave SWRed Lake Falls, MN 56750 USGrant Gagner, Commercial Sales ManagerPhone (800-932-3629) | Fax (218-253-4409)[email protected] OUR AD ON PAGE 40

Tulikivi U.S.Inc.172 South Pantops Dr, Suite BCharlottesville, VA 22911 USPäivi Saarelainen, Sales and Marketing ManagerPhone (800-843-3473)[email protected]

Generator-Diesel / Biodiesel

Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42

National Electric Coil800 King AvenueColumbus, OH 43212 USSteve Jeney, VP Marketing/SalesPhone (614-488-1151) | Fax (614-488-8892)sendinfo@national-electric-coil.comwww.national-electric-coil.com

Generator-Natural Gas / Biogas

National Electric Coil800 King AvenueColumbus, OH 43212 USSteve Jeney, VP Marketing/SalesPhone (614-488-1151) | Fax (614-488-8892)sendinfo@national-electric-coil.comwww.national-electric-coil.com

Process Equipment & Services

Process Equipment & Services Fire Protection

Page 52: 2016 Biomass Industry Directory

52 | 2016 Biomass Industry Directory

Process Equipment & Services Generator-Steam Turbine

Process Equipment & Services

Generator-Steam Turbine

Elliott Group901 North Fourth StreetJeannette, PA 15644 USTom Brown, Communications ManagerPhone (724-527-2811)[email protected]

National Electric Coil800 King AvenueColumbus, OH 43212 USSteve Jeney, VP Marketing/SalesPhone (614-488-1151) | Fax (614-488-8892)sendinfo@national-electric-coil.comwww.national-electric-coil.com

Vogt Power International13551 Triton Park BoulevardSuite 2000Louisville, KY 40223 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-recovery-systems/vogt-power-internationalSEE OUR AD ON PAGE 7

Heat Exchangers-Direct Contact

Hydroflex Systems, Inc.PO Box 296Hummelstown, PA 17043 USCathleen Kaiser, Co-OwnerPhone (717-480-4200)[email protected]

Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]

Pick Heaters, Inc.730 S. Indiana Ave.PO Box 516West Bend, WI 53095 USSales Dept.Phone (262-338-1191) | Fax (262-338-8489)[email protected]

Heat Exchangers-Phase-Change

AMSEnergy Corp.1111 Bear Creek PikeColumbia, TN 38401 USMichael Sams, President & CEOPhone (615-852-8412)[email protected]

Heat Exchangers-Shell & Tube

Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42

Thermal Engineering Int’l (USA)10375 Slusher DriveSanta Fe Springs, CA 90670 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-exchangers/thermal-engineeringSEE OUR AD ON PAGE 7

Page 53: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 53

Process Equipment & Services

Process Equipment & Services Heat Exchangers-Waste Heat Recovery Unit

Heat Exchangers-Waste Heat Recovery Unit

Sigma Thermal, Inc4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 53

Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]

Hoppers

DI PIÙ - Sunomi LLCP.O. Box 347Plainfield, VT 05667 USGiordano Checchi, PresidentPhone (802-454-9310)[email protected]

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]

ProcessBarron2770 Welborn StreetPelham, AL 35124 USCliff Moss, Vice PresidentPhone (205-663-5330)[email protected] OUR AD ON PAGE 30

Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 29

Instrumentation

Aplus Finetek Sensor, Inc.1741 Industrial Drive, Unit #3Sterling, IL 61081 USJoe Lewis, SalesPhone (815-632-3132) | Fax (815-716-8464)[email protected]

Control Instruments Corp.25 Law DriveFairfield, NJ 07004 USBob Nutting, National Sales ManagerPhone (973-575-9114) | Fax (973-575-0013)[email protected]

Monitor Tech Corporation661 N. James Rd.Columbus, OH 43219 USRobert Mullowney, CEOPhone (614-231-0500) | Fax (614-231-0555)[email protected] OUR AD ON PAGE 49

Laboratory Equipment

Applied Rigaku Technologies, Inc.9825 Spectrum DriveAustin, TX 78717 USRobert Bartek, PresidentPhone (512-225-1796) | Fax (512-633-1797)[email protected]

HEMCO Corporation711 South Powell RoadIndependence, MO 64056 USJerry Schwarz, Marketing / AdvertisingPhone (800-779-4362)Fax (816-796-3333)[email protected]

• Biomass HydrdrauaulicSystem

• Air-cooled Fuel Feeders

• Air-cooled Thermal Fluid Heat Dumps

Consider retrofi�ing your existing system with modifications or equipment upgr ades to increase your process efficiency and to take advantage of improved energy savings.

• Fuel Storage and Reclaim

• Fuel Feed Conveying Equipment

• Fuel Feeders and Metering Bins

• Thermal Oil Radiant Heaters

• Thermal Oil Convection Heaters

• Ash Conveyors

• Grate Bars

• Multi-Clones

• Fans

• Dampers

• Expansion Joints

• Thermal Fluid Heat Dumps

• Thermal Fluid Pumps

• Controls and Control Devices

• Electrical/ Functional Safety Engin.

• Combustion Control Systems

• Basic Process Control Systems (BPCS)

• Safety Instrumented Systems

• Field Support-Programming and Training

Page 54: 2016 Biomass Industry Directory

Process Equipment & Services Labratory Equipment

Process Equipment & ServicesIndustrial Sonomechanics, LLC479 W 146th St., Ground FloorNew York, NY 10031 USIva Gyurgina, Customer Relations and Marketing ManagerPhone (646-580-4676)[email protected]://sonomechanics.com/

Team Biogas23551 Rose Quartz DrPerris, CA 92570-7440 USMark Hintz, Sales ConsultantPhone (425-422-5970)Fax (866-593-3679)[email protected]

Laboratory Services

Biomass Energy Lab1641 Sigman RoadConyers, GA 30012 USTammy Hippchen, Business Development SpecialistPhone (218-461-2579)[email protected]

Timber Products Inspection1641 Sigman RoadConyers, GA 30012 USTammy Hippchen, Business Development SpecialistPhone (218-461-2579)[email protected]

Celignis LimitedT1-014 Tierney Building, University of LimerickLimerick, L111 IRELANDDaniel Hayes, DrPhone (353894555582)[email protected]

ClearStak, LLC99 Canal StreetPO Box 109Putnam, CT 06260 USMadilyn Smith, Corporate CounselPhone (860-237-8245)[email protected]

R W HEIDEN ASSOCIATES LLC1026 New Holland AvenuePO Box 5001Lancaster, PA 17601 USRichard Heiden, Chief Science and Technology OfficerPhone (717-299-6860)Fax (717-299-6868)[email protected]

Lubricants

Ayalytical Instruments2701 W. Fulton St., #5SChicago, IL 60612 USJuan Ayala, Managing DirectorPhone (312-476-9292)[email protected]

Schaeffer’s Specialized Lubricants102 Barton StreetSt. Louis, MO 63104 USSteve Rober, National Sales ManagerPhone (314-865-4100)Fax (314-865-4107)[email protected]

Maintenance Services

Sigma Thermal, Inc.4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 36

TGR Industrial Services1127 S Lewis AveTulsa, OK 74104 USGary Mathis, Advanced NDT ManagerPhone (918-629-2735)Fax (918-584-5598)[email protected]

Marine Surveying

Control Union (U.S.A.), Inc.115 James Drive WestSuite 150Saint Rose, LA 70087 USDaniel O’Rourke, PresidentPhone (504-468-5485)[email protected]

Page 55: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 55

Mixers/Agitators

DustMASTER Enviro Systems190 Simmons Ave.Pewaukee, WI 53012 USScott Adams, Product ManagerPhone (262-691-3100)Fax (262-691-3184)[email protected] OUR AD ON PAGE 58

SUMA America855 North Wood Dale RoadSuite AWood Dale, IL 60191 USEugene Smith, Sales Application EngineerPhone (847-427-7880)Fax (630-354-6840)[email protected]

Moisture Analyzers

GreCon Moisture Meters15875 SW 74th AveTigard, OR 97224 USMarshall LLoyd, SalesPhone (503-641-7731)Fax (503-641-7508)[email protected]://www.grecon-us.com/measurement/infrared-moisture-meter/SEE OUR AD ON PAGE 47

Operations & Maintenance (O&M)

Morrow Renewables, LLCPO Box 61447Midland, TX 79711 USLuke Morrow, PresidentPhone (432-563-0447)[email protected]

Atlantic Combustion Technologies2 Tupper BlvdAmherst, NS B4H 4J5 CANADADavid Digdon, VP Global Business DevelopmentPhone (902-667-2808)[email protected] OUR AD ON PAGE 3

Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/

REBL Refractories Evaluations Laboratory, ULC#109, 8484 162nd StreetSurrey, BC V4N 1B4 CANADABryce Jardine, Regional ManagerPhone (778-578-7551) | Fax (778-578-7571)[email protected]

Pipe

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]

Pipe-Fittings

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]

Proco Products, Inc.2431 N. Wigwam DriveStockton, CA 95205 USRob Coffee, VP Sales & MarketingPhone (209-943-6088) | Fax (209-943-0242)[email protected]

Pipe-Flanges

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]

Process Equipment & Services Mixers/Agitators

Process Equipment & Services

• Process & Plant Feasibility Studies• Foundation & Structural Design• Plant Layout & Equipment Specifications• Site Supervision & Start-up Equipment Procurement & Installation

Biomass and Wood Pellet Plant Specialist

Rainsville, Alabama866-354-PASS (72277)[email protected]

Page 56: 2016 Biomass Industry Directory

No matter what you’re processing – chemicals, food, pharmaceuticals, biomass, wood products – if it produces dusts or powders, there’s a high probability you have an explosion risk. All it takes to interrupt your plant productivity is a combustible material, oxygen and an ignition source. For more than six decades, IEP Technologies has provided the right explosion protection solution for every type of process application. From cyclone separators and dust collectors to milling equipment and dryers. We can analyze your challenge, design a protection system and surround you with 24/7 service and support. Protecting your plant starts with knowing your explosion risk.

Let’s develop a solution for you

Call the IEP engineering experts with the most experience in explosion protection at 1-855-793-8407 or visit IEPTechnologies.com.

P R O T E C T I N G T H E W O R L D ’ S P R O C E S S E S A G A I N S T E X P L O S I O N

Process Equipment & Services Safety

Process Equipment & Services

Safety

IEP Technologies417-1 South StreetMarlborough, MA 01752 USJohn Shea, Vice President - Marketing & Business DevelopmentPhone (855-793-8407) | Fax (508-485-3115)[email protected] OUR AD ON PAGE 56-57

Seals

Towertech Cooling System Pvt.Ltd103-B, Synergy Tower, Near Vodafone House,Corporate RoadPrahlad Nagar, Ahmedabad, Gujarat 380015 ISPhone (917940397842)[email protected]://www.towertechglobal.com/

Sensors

4B Components Ltd.625 Erie AvenueMorton, IL 61550 USJohnny Wheat, PresidentPhone (309-698-5611)[email protected]/usa

Aplus Finetek Sensor, Inc.1741 Industrial Drive, Unit #3Sterling, IL 61081 USJoe Lewis, SalesPhone (815-632-3132) | Fax (815-716-8464)[email protected]

Monitor Technologies LCC44W320 Keslinger RoadElburn, IL 60119 USGreg DeRudder, Director of SalesPhone (630-365-9403)[email protected]

optek-Danulat, Inc.N118W18748 Bunsen DrGermantown, WI 53022 USJoe Ferrelli, Product SpecialistPhone (888-901-4288)[email protected]

Separators

Ecohog LtdQuarry RoadCarrickmore, Omagh BT79 9JX UKColleen McDermott, MrsPhone (02880761295)[email protected]

Rotex Global1230 Knowlton StreetCincinnati, OH 45223 USAustin Kephart, Marketing ManagerPhone (513-541-1236)[email protected]

Page 57: 2016 Biomass Industry Directory

No matter what you’re processing – chemicals, food, pharmaceuticals, biomass, wood products – if it produces dusts or powders, there’s a high probability you have an explosion risk. All it takes to interrupt your plant productivity is a combustible material, oxygen and an ignition source. For more than six decades, IEP Technologies has provided the right explosion protection solution for every type of process application. From cyclone separators and dust collectors to milling equipment and dryers. We can analyze your challenge, design a protection system and surround you with 24/7 service and support. Protecting your plant starts with knowing your explosion risk.

Let’s develop a solution for you

Call the IEP engineering experts with the most experience in explosion protection at 1-855-793-8407 or visit IEPTechnologies.com.

P R O T E C T I N G T H E W O R L D ’ S P R O C E S S E S A G A I N S T E X P L O S I O N

Separators-Magnetic

Ecohog LtdQuarry RoadCarrickmore, Omagh BT79 9JX UKColleen McDermott, MrsPhone (02880761295)[email protected]

ANDRITZ FEED AND BIOFUEL336 West PennMuncy, PA 17756 USMike Curci, Capital Sales Manager BiomassPhone (850-557-7674) | Fax (770-640-2521)[email protected]://www.andritz-sprout.com/SEE OUR AD ON PAGE 22

Master Magnetics747 S. Gilbert St.Castle Rock, CO 80104 USJim Madsen, Sales ManagerPhone (888-293-9399)[email protected]

Tank Equipment

Hydroflex Systems, Inc.PO Box 296Hummelstown, PA 17043 USCathleen Kaiser, Co-OwnerPhone (717-480-4200)[email protected]

VOC Scrubbers

Babcock & Wilcox MEGTEC830 Prosper StreetDe Pere, WI 54115 USKathy Brugman, Sales & Marketing SpecialistPhone (920-337-1582)[email protected]

Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]

Wastewater Treatment

ADI Systems Inc.370 Wilsey RoadFredericton, NB E3B 6E9 CANADAShannon Grant, PresidentPhone (1-506-452-7307)[email protected]

Babcock & Wilcox MEGTEC830 Prosper StreetDe Pere, WI 54115 USKathy Brugman, Sales & Marketing SpecialistPhone (920-337-1582)[email protected]

RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]

Process Equipment & Services Separators-Magnetic

Process Equipment & Services

Page 58: 2016 Biomass Industry Directory

Project Development & Finance Business Plans

Business Plans

BBI International Project Development308 Second Avenue North, Suite 304Grand Forks, ND 58203 USCustomer ServicePhone (866-746-8385) | Fax (701-746-5367)[email protected]

Renewable Energy Consultants, LLCPO Box 41Beavertown, PA 17813 USBob Rice, President/CEOPhone (570-765-2020)[email protected] OUR AD ON PAGE 23

Debt FinancingCHP VenturesKemp House152 Old City RdLondon. England, EC1V 2NX UKRoger Willmott, DirectorPhone (442081339554)[email protected]

SLS Financial Services200 S, O’Connell StreetSuite 400Marshall, MN 56258 USKennedy Gilbertson, National Account ManagerPhone (605-444-1106) | Fax (605-271-7133)[email protected]

Syntek Resource Corporation2143 18th Avenue CourtGreeley, CO 80631 USSandra Robnett, Chm/CEOPhone (970-356-9004) | Fax (970-356-9004)[email protected]

Due Diligence

BBI International Project Development308 Second Avenue North, Suite 304Grand Forks, ND 58203 USCustomer ServicePhone (866-746-8385) | Fax (701-746-5367)[email protected]

Arc5 Environmental Consulting LLC20 Rockwood LnGroton, MA 01450 USDavid Minott, PresidentPhone (978-877-7719)[email protected]

Luminate, LLC1801 BroadwaySuite 1620Denver, CO 80202 USMichael Robinson, President & CEOPhone (303-860-7627) | Fax (303-860-7647)[email protected]

PPS Group LLC 4717 Grand Ave. Suite 300Kansas City, MO 64112 USLou Gonzales, PresidentPhone (816-627-0606) | Fax (816-531-2195)[email protected]

Project Development & Finance

Page 59: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 59

Project Development & Finance

Project Development & Finance Due Diligence

Feasibility Studies

BBI International Project Development308 Second Avenue North, Suite 304Grand Forks, ND 58203 USCustomer ServicePhone (866-746-8385) | Fax (701-746-5367)[email protected]

EcoEngineers300 East Locust Street, Suite 313Des Moines, IA 50309 USKathy MacBeth, Director of Sales & MarketingPhone (515-309-1279)[email protected] OUR AD ON PAGE 54

Mid-South Engineering1658 Malvern AvenueHot Springs, AR 71901 USMark Culpepper, Vice PresidentPhone (501-321-2276) | Fax (501-624-4214)[email protected] OUR AD ON PAGE 24

PPS Group LLC 4717 Grand Ave. Suite 300Kansas City, MO 64112 USLou Gonzales, PresidentPhone (816-627-0606) | Fax (816-531-2195)[email protected]

Process and Storage Solutions3446 County Road 90Rainsville, AL 35986 USDonald Land, Co-OwnerPhone (866-354-7277) | Fax (256-638-1839)[email protected] OUR AD ON PAGE 55

RSG - Resource Systems Group, Inc.55 Railroad RowWhite River Junction, VT 05001 USJohn Hinckley, DirectorPhone (802-295-4999)[email protected]

Insurance

HUB International New England, LLC formerly FieldEddy InsurancePO Box 70996 Shaker RdEast Longmeadow, MA 01028 USTeresa Petit de Mange, Vice PresidentPhone (413-233-2108) | Fax (413-733-3191)[email protected]

Marsh & McLennan Agency1001 Haxall Point, Suite 800Richmond, VA 23219 USGeorge Phillips, Sr. Vice presidentPhone (804-915-5630)[email protected]

Investors

New Canaan Capital Mgmt LLC. Post Office Box 94831344 Crayton Road Naples , FL 34101 USJeffrey Weisz , Managing Member Phone (239-919-8825) | Fax (917-957-9703)[email protected]

Mergers & Acquisitions

Maas Companies Inc.P. O. Box 7127Rochester, MN 55903-7127 USTyler Maas, Director of Sales & MarketingPhone (507-285-1444) | Fax (507-285-0034)[email protected]

Owner Representation

PPS Group LLC 4717 Grand Ave. Suite 300Kansas City, MO 64112 USLou Gonzales, PresidentPhone (816-627-0606) | Fax (816-531-2195)[email protected]

Mid-South Engineering1658 Malvern AvenueHot Springs, AR 71901 USMark Culpepper, Vice PresidentPhone (501-321-2276) | Fax (501-624-4214)[email protected] OUR AD ON PAGE 24

Permitting-Air

Arc5 Environmental Consulting LLC20 Rockwood LnGroton, MA 01450 USDavid Minott, PresidentPhone (978-877-7719)[email protected]

RSG - Resource Systems Group, Inc.55 Railroad RowWhite River Junction, VT 05001 USJohn Hinckley, DirectorPhone (802-295-4999)[email protected]

Permitting-Other

RSG - Resource Systems Group, Inc.55 Railroad RowWhite River Junction, VT 05001 USJohn Hinckley, DirectorPhone (802-295-4999)[email protected]

Risk Management

Wildephor Consulting Services, LLC481 N Santa Cruz Ave #280Los Gatos, CA 95030 USW. David Featherman, PE, PrincipalPhone (510-845-0016)[email protected]

Site Selection

BBI International Project Development308 Second Avenue North, Suite 304Grand Forks, ND 58203 USCustomer ServicePhone (866-746-8385) | Fax (701-746-5367)[email protected]

Software-Accounting

TRAXPayroll - Online Payroll Services740 Alfred Nobel DriveHercules, CA 94547 USSales/AdminPhone (866-611-5410) | Fax (510-964-9322)[email protected]

Technology Assessment

ENVINT Consulting2233 Ch St AntoineLaval, QC H7R6C7 CANADAMartin Tampier, MrPhone (450-627-1003)[email protected]

ICF International1725 Eye Street NWWashington, DC 20006 USStacy Noblet, Senior ManagerPhone (202-862-1147)[email protected]

Pure Dwelling LLCP.O. Box 863Sun Prairie, WI 53590 USGregory Brown, PrincipalPhone (608-630-0225)[email protected]

Page 60: 2016 Biomass Industry Directory

Research & Development Government

Make a world of difference with your career.

Earn a Master’s or Graduate Certi�cate in Renewable Energy, and gain the technical expertise and project development skills to drive clean energy initiatives. With our online bioenergy program, you can learn about:

crop production

ecology

engineering

fermentation

genetics

harvesting

value chain systems modeling

Learn more at worldcampus.psu.edu/biomass

Government

Kentucky Division of Biofuels500 Mero Street, 6th FloorFrankfort, KY 40601 USTim Hughes, DirectorPhone (5025647192) | Fax (502-564-7406)[email protected]/biofuels/Pages/default.aspx

Private

AgriKinetics LtdTrigate HouseHagley Road WestBirmingham, B68 0NP UKDavid Stone, DirectorPhone (441212225090)[email protected]://agrikinetics.com

American Science and Technology1367 W. Chicago Ave.Chicago, IL 60642 USAli Manesh, PresidentPhone (312-433-3800) | Fax (312-433-3807)[email protected]

Biomass Energy Enhancements597 N. 1250 W., Suite #4Centerville, UT 84014 USChas Fritz, CEOPhone (239-851-6304)[email protected]

Cellulose Pilot and Processing Lab6445 Packer Dr.Wausau, WI 54401 USEric Singsaas, DirectorPhone (715-340-2591)[email protected]

FPInnovations570 Saint-Jean BlvdPointe-Claire, QC H9R3J9 CANADAJennifer Ellson, Senior Communications SpecialistPhone (514 630-4100)[email protected]

Refined BioProducts1718 Pine StreetStevens Point, WI 54481 USJohn Leschke, New Business DevelopmentPhone (715-869-7866)[email protected]

University

Iowa State University BioCentury Research Farm1041 Food Sciences Bldg.Ames, IA 50011-1061 USKevin Keener, DirectorPhone (515-294-0160) | Fax (515-294-6261)[email protected]

Penn State Biomass Energy Center249 Ag Engineering BuildingUniversity Park, PA 16802 USTom Richard, DirectorPhone (814-863-0291) | Fax (814-863-1031)[email protected] OUR AD ON PAGE 60

Research & Development

Page 61: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 61

AD INDEX

2016 International Biomass Conference & Expo 14

Agra Industries 26

Andritz Feed & Biofuel A/S 22

ASGCO 39

Astec, Inc. 72

Atlantic Combustion/CoMate 3

Babcock Power 7

Basic Machinery Co., Inc. 35

BBI International Project Development 61

Biotech Energy 25

Columbia Specialty Company, Inc. 27

Continential Biomass Industries, Inc. 19

CPM Global Biomass Group 20

CPM Wolverine Proctor, LLC 37

D3 Max 71

Detroit Stoker Company 44

DustMASTER Enviro Systems 58

EBM Manufacturing 41

EcoEngineers 54

RUD Chain 31

Schaeffer Manufacturing Co. 51

Sigma Thermal, Inc. 53

TerraSource Global (Jeffrey Rader) 36

The Pennsylvania State University 60

Turboden S.r.l. 28

Vecoplan LLC 16

Vulcan Systems 32

West Salem Machinery Col 38

Wolf Material Handling Systems 29

WoodMaster 40

FLAMEX Inc. 46

Geltech Solutions 50

GreCon, Inc. 47

Hudco Industrial Products, Inc. 34

Hurst Boiler & Welding Co. Inc. 2

IEP Technologies 56-57

Indeck Power Equipment Co. 42

International Bioenergy Conference & Exhibition Society

33

JDV Equipment Corporation 52

Mid-South Engineering Company 24

MonitorTech Corporation 49

NDC Technologies Ltd 48

NSF International 17

Process and Storage Solutions 55

ProcessBarron 30

Rawlings Waste Wood Recovery Systems 18

Renewable Energy Consultations LLC 23

RIX Industries 43

Page 62: 2016 Biomass Industry Directory

62 | 2016 Biomass Industry Directory

Company Index

4B Components Ltd.625 Erie AvenueMorton, IL 61550 USJohnny Wheat, PresidentPhone (309-698-5611)[email protected]/usa

AABC Machinery (Anyang Best Complete Machinery Engi19F, Suite B, Global Trade Mansion, Wenfeng AvenueAnyang, Henan 455000 CHINATina Lee, General ManagerPhone (863725965148)[email protected]://www.pellet-machine.com/

ACT Bioenergy30 Commerce Park DriveSchenectady, NY 12305 USLarry Farrelly, PresidentPhone (518-344-7490)[email protected]

Active Energy Coalswitch LimitedMwalden Business ParkBath House RoadCardigan, Ceredigion, SA43 1JY UKChas Fritz, CEOPhone (2398516304)[email protected]

ADI Systems Inc.370 Wilsey RoadFredericton, NB E3B 6E9 CANADAShannon Grant, PresidentPhone (1-506-452-7307)[email protected]

Advanced Biofuels USA507 North Bentz StreetFrederick, MD 21701 USJoanne Ivancic, Executive DirectorPhone (301-644-1395)[email protected]

AFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286) | Fax (717-763-1066)[email protected]

AGCO Corporation4205 River Green ParkwayDuluth, GA 30096 USGlenn Farris, Segment Strategy Manager, Biomass/IndustrialsPhone (770-662-0256)[email protected]

AgFuel Energy Systems90 Route 171P.O. Box 875Woodstock, CT 06281 USAmanda Simoneau, Director of Marketing and Business DevelopmentPhone (860-928-0703)[email protected]

AgFuel NorthEast, LLC99 Canal StreetPO BOX 109Putnam, CT 06260 USMadilyn Smith, Corporate CounselPhone (860-928-0703)[email protected]

AGRA Industries1211 West Water StreetMerrill, WI 54452 USPat Hinner, PresidentPhone (800-842-8033)[email protected] OUR AD ON PAGE 26

AgriKinetics LtdTrigate HouseHagley Road WestBirmingham, B68 0NP ENGLANDDavid Stone, DirectorPhone (441212225090)[email protected]://agrikinetics.com

AHONA - Alternative Heating of North America1614 County Highway 16Burlington Flats, NY 13315 USNathan Schoellig, DirectorPhone (607-643-6122)[email protected]

AIRMATIC INC.284 Three Tun RdMalvern, PA 19355-3981 USTerry Dougherty, Customer Support SpecialistPhone (800-332-9770) | Fax (215-331-9770)[email protected]

Airoflex Equipment6001 49th St. SouthMuscatine, IA 52761 USAndy Christy, SalesPhone (563-264-8066) | Fax (651-631-2539)[email protected]

AirPro Fan & Blower Co.PO Box 543Rhinelander, WI 54501 USKeith White, Sales EngineerPhone (715-365-3267)[email protected]

Alaska Structures9024 Vanguard Drive #101Anchorage, AK 99507 USAlaska Structures, InquiryPhone (907-344-1565)[email protected]://alaskastructures.com

Alberici Constructors, Inc.8800 Page Ave.Saint Louis, MO 63114 USVictoria Fleddermann, Director of Business DevelopmentPhone (314-733-2256)[email protected]

Alcohol Tax Consultants, Inc.P.O. Box 1595Madison Square StationNew York, NY 10159 USMatt Zuckerman, Phone (917-771-9906)[email protected]

ALDATA Software203, 211 Pembina Ave.Hinton, AB T7V 2B3 CANADAMike Meagher, President and CEOPhone (780-865-3249) | Fax (780-665-4242)[email protected]

American Science and Technology1367 W. Chicago Ave.Chicago, IL 60642 USAli Manesh, PresidentPhone (312-433-3800) | Fax (312-433-3807)[email protected]

AMSEnergy Corp.1111 Bear Creek PikeColumbia, TN 38401 USMichael Sams, President & CEOPhone (615-852-8412)[email protected]

ANDRITZ5405 Windward Parkway Suite 100WAlpharetta, GA 30004 USDave Evans, Area Sales ManagerPhone (770-640-2431)[email protected] OUR AD ON PAGE 22

ANDRITZ FEED AND BIOFUEL336 West PennMuncy, PA 17756 USMike Curci, Capital Sales Manager BiomassPhone (850-557-7674) | Fax (770-640-2521)[email protected]://www.andritz-sprout.com/SEE OUR AD ON PAGE 22

Aplus Finetek Sensor, Inc.1741 Industrial Drive, Unit #3Sterling, IL 61081 USJoe Lewis, SalesPhone (815-632-3132) | Fax (815-716-8464)[email protected]

Apollo Equipment2062 20th Ave. S.E.Largo, FL 33771 USWayne Brown, Executive Vice PresidentPhone (503-585-1442) | Fax (727-585-3499)[email protected]

Applied Rigaku Technologies, Inc.9825 Spectrum DriveAustin, TX 78717 USRobert Bartek, PresidentPhone (512-225-1796) | Fax (512-633-1797)[email protected]

APT Consulting Group Co., Ltd.3/1 Muang Thong Thani Bldg. C7Popular Road, BangpootPakgret, Nonthaburi, 11120 THAILANDJohn Diecker, Managing DirectorPhone (6624025235)[email protected]

Arc5 Environmental Consulting LLC20 Rockwood LnGroton, MA 01450 USDavid Minott, PresidentPhone (978-877-7719)[email protected]

ASGCO “Complete Conveyor Solutions”301 Gordon StreetAllentown, PA 18102 USAaron Gibbs, PresidentPhone (610-821-0216) | Fax (610-778-8991)[email protected] OUR AD ON PAGE 39

ASI Industrial1300 Minnesota AveBillings, MT 59101 USRobert Hamlin, PresidentPhone (406-245-6231) | Fax (406-245-6236)[email protected]

Astec Bulk Handling Solutions86470 Franklin BoulevardEugene, OR 97405 USConor Brogan, Technical Sales ManagerPhone (800-314-4656)[email protected]

Astec, Inc.4101 Jerome AvenueChattanooga, TN 37407 USMalcolm Swanson, PresidentPhone (423-867-4210) | Fax (423-867-4636)[email protected] OUR AD ON PAGE 72

Atlantic Combustion Technologies2 Tupper BlvdAmherst, NS B4H 4J5 CANADADavid Digdon, VP Global Business DevelopmentPhone (902-667-2808)[email protected] OUR AD ON PAGE 3

Ayalytical Instruments2701 W. Fulton St. #5SChicago, IL 60612 USJuan Ayala, Managing DirectorPhone (312-476-9292)[email protected]

BBabcock & Wilcox MEGTEC830 Prosper StreetDe Pere, WI 54115 USKathy Brugman, Sales & Marketing SpecialistPhone (920-337-1582)[email protected]

Babcock Power Environmental5 Neponset StreetWorcester, MA 01615 USJennifer Pasquariello, Director Marketing & Communications Phone (864-949-2917)[email protected]/products/environmental/babcock-power-environmentalSEE OUR AD ON PAGE 7

Babcock Power Services5 Neponset StWorcester, MA 01615-0040 USJennifer Pasquariello, Director Marketng & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/babcock-power-services-incSEE OUR AD ON PAGE 7

Basic Machinery Company1220 Harold Andrews RoadSiler City, NC 27344-0688 USEd ONeil, Director of Business DevelopmentPhone (919-200-3435)[email protected] OUR AD ON PAGE 35

A

Page 63: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 63

Company Index

BEDESCHI AMERICA INC3275 W. Hillsboro BlvdSuite 312Deerfield Beach, FL 33442 USTom Turano, V.P.Phone (954-602-2175) | Fax (954-602-5390)[email protected]

Biochar Now, LLC1907 Gail CtLoveland, CO 80537 USJames Gaspard, EVP Business DevelopmentPhone (970-622-8071)[email protected]

BIOFerm Energy Systems440 Science DriveSte 300Madison, WI 53711 USWhitney Beadle, Marketing CommunicationsPhone (608-229-6504)[email protected]

BIOGAS Equity 2, Inc.130 Eleanor Dr.Woodside, CA 94062 USMike Muller, COOPhone (650-283-9555)[email protected]

Biomass Controls, LLC99 Canal StreetPO BOX 109Putnam, CT 06260 USMadilyn Smith, Corporate CounselPhone (860-928-0712)[email protected]

Biomass Energy Enhancements597 N. 1250 W., Suite #4Centerville, UT 84014 USChas Fritz, CEOPhone (239-851-6304)[email protected]

Biomass Energy Lab1641 Sigman RoadConyers, GA 30012 USTammy Hippchen, Business Development SpecialistPhone (218-461-2579)[email protected]

Biomass Engineering & Equipment1457 Sunday DriveIndianapolis, IN 46217 USTim Brown, Product SpecialistPhone (317-522-0864) | Fax (317-346-0811)[email protected]

Biomass Thermal Energy Council1211 Connecticut Ave NW#650Washington, DC 20036 USJoel Stronberg, Executive DirectorPhone (202-596-3974) | Fax (202-223-5537)[email protected]

Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]

Biotech Energy54 Echo Place Unit 1Williston, VT 05495 USBrad Noviski, Vice President EngineeringPhone (802-658-0956) | Fax (802-660-8904)[email protected] OUR AD ON PAGE 25

Bliss Industries, LLC1415 W. Summit AveP.O. Box 910 (74602)Ponca City, OK 74601 USChad Cook, V.P. Marketing & SalesPhone (580-765-7787) | Fax (580-762-0111)[email protected]

Boiler Tube Company of America506 Charlotte HighwayLyman, SC 29365 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/boiler-tube-co-of-americaSEE OUR AD ON PAGE 7

BWF Envirotec, USA1800 Worldwide BlvdHebron, KY 41048 USLarry Brown, Sales ManagerPhone (859-282-4550) | Fax (859-282-4555)[email protected]

CCasey Industrial, Inc.1400 West 122nd Ave., Ste 200Westminster, CO 80234 USTom Lepak, Vice PresidentPhone (720-974-2659)[email protected]

CDW Consultant GroupP.O. Box 923Bloomington, TX 77951 USCharles White, Managing MemberPhone (361-237-9339) | Fax (210-800-9993)[email protected]

Celignis LimitedT1-014 Tierney Building, University of LimerickLimerick, L111 IRELANDDaniel HayesPhone (353894555582)[email protected]

Cellulose Pilot and Processing Lab6445 Packer Dr.Wausau, WI 54401 USEric Singsaas, DirectorPhone (715-340-2591)[email protected]

Chief Industries Agri/Industrial4400 East 39th StreetKearney, NE 68848 USLiz McGowan, Marketing AssistantPhone (308-238-2781)[email protected]

CHP VenturesKemp House152 Old City RdLondon. England, EC1V 2NX UKRoger Willmott, DirectorPhone (442081339554)[email protected]

CLARCOR Industrial Air11501 Outlook Street, Suite 100Overland Park, KS 66210 USTim Stark, Director Aftermarket SalesPhone (816-313-4955)[email protected]

ClearStak, LLC99 Canal StreetPO BOX 109Putnam, CT 06260 USMadilyn Smith, Corporate CounselPhone (860-237-8245)[email protected]

CNFbiofuel5038 Salida BlvdPO Box 1316Salida, CA 95368 USJohn Paoluccio, PresidentPhone (209-545-1663) | Fax (209-545-3533)[email protected]

CNFbiofuel.comColumbia Industries, LLC5775 NW Wagon WayHillsboro, OR 97124 USJoe Canova, VP Sales & MarketingPhone (503-531-0600) | Fax (503-531-0601)[email protected]

Columbia Specialty Co, Inc.5875 Obispo AveLong Beach, CA 90805 USGreg Stuck, Shop ManagerPhone (562-634-6425) | Fax (562-408-2914)[email protected] OUR AD ON PAGE 27

CompuWeigh Corporation50 Middle Quarter Rd.Woodbury, CT 06798 USTim Ciucci, V.P. of Sales & MarketingPhone (906-235-5221) | Fax (203-262-9400)[email protected]

Conn Maciel Carey5335 Wisconsin Avenue NWSuite 660Washington, DC 20015 USEric J. Conn, Chair, OSHA Practice GroupPhone (202-715-6244) | Fax (202-827-7903)[email protected]

Continental Biomass Industries (a Terex brand)22 Whittier St.Newton, NH 03858 USArt Murphy, Marketing ManagerPhone (603-382-0556)[email protected] OUR AD ON PAGE 19

Continental Conveyor Ltd.470, St. Alphonse Street SouthPO Box 729Thetford Mines, QC G6G 3V8 CANADABrian Lynn, Vice PresidentPhone (418-338-4682) | Fax (418-338-4751)[email protected]

Control Instruments Corp.25 Law DriveFairfield, NJ 07004 USBob Nutting, National Sales ManagerPhone (973-575-9114) | Fax (973-575-0013)[email protected]

Control Union (U.S.A.), Inc.115 James Drive WestSuite 150Saint Rose, LA 70087 USDaniel O’Rourke, PresidentPhone (504-468-5485)[email protected]

Control Union Certifications150 North University DriveSuite 210Plantation, FL 33324 USRobert Demianew, Regional DirectorPhone (954-900-2087)[email protected]://controlunion.com/en

CPM Global Biomass Group181 Davis Johnson Dr, Suite JRichland, MS 39218 USTim Gilbert, Sales ManagerPhone (601-932-9080) | Fax (601-932-9081)[email protected] OUR AD ON PAGE 20

CPM Wolverine Proctor, LLC251 Gilbraltar RoadHorsham, PA 19044 USChris Law, Industry ManagerPhone (215-443-5200) | Fax (215-443-5206)[email protected] OUR AD ON PAGE 37

Curran Renewable Energy, LLC20 Commerce DriveMassena, NY 13662 USKelli Curran, Marketing ManagerPhone (315-769-2000)[email protected]

DDavis Brown Law Firm215 10th Street, Suite 1300Des Moines, IA 50309 USBill Hanigan, AttorneyPhone (515-288-2500) | Fax (515-243-0654)[email protected]:/www.davisbrownlaw.com

Detroit Stoker Company1510 East First StreetMonroe, MI 48161 USTim Loviska, Director - Contract SalesPhone (734-241-9500) | Fax (734-241-7126)[email protected] OUR AD ON PAGE 44

DI PIÙ - Sunomi LLCP.O. Box 347Plainfield, VT 05667 USGiordano Checchi, PresidentPhone (802-454-9310)[email protected]

Dome Technology 4946 North 2900 EastIdaho Falls, ID 83401 USLane Roberts, Business Development ManagerPhone (208-227-1485)[email protected]

Page 64: 2016 Biomass Industry Directory

64 | 2016 Biomass Industry Directory

Company Index

Dustex LLC100 Chastain Center Blvd. NW, Suite 195Kennesaw, GA 30144 USDarlene Huggins, VP, Business DevelopmentPhone (770-429-5575) | Fax (770-429-5556)[email protected]

DustMASTER Enviro Systems190 Simmons Ave.Pewaukee, WI 53012 USScott Adams, Product ManagerPhone (262-691-3100) | Fax (262-691-3184)[email protected] OUR AD ON PAGE 58

DYNATEK Loading Systems200 North Harrison StNorth Prairie, WI 53153 USGary Kuehneman, Director of Marketing & SalesPhone (262-392-2162) | Fax (262-392-2984)[email protected]

EEBM Manufacturing1014 Sherwood RdNorfolk, NE 68701 USTiffany Palmer, Director of Sales & MarketingPhone (877-370-4948) | Fax (402-371-9117)[email protected] OUR AD ON PAGE 41

EcoEngineers300 East Locust Street, Suite 313Des Moines, IA 50309 USKathy MacBeth, Director of Sales & MarketingPhone (515-309-1279)[email protected] OUR AD ON PAGE 54

Ecohog LtdQuarry RoadCarrickmore, Omagh BT79 9JX IRELANDColleen McDermottPhone (02880761295)[email protected]

Ecospray Technologies S.r.l.5 Thawmont DriveSewickley, PA 15143 USJo Ann Pacinelli, Senior Partner & Business Development ManagerPhone (412-427-0133) | Fax (412-741-8386)[email protected]

Elliott Group901 North Fourth StreetJeannette, PA 15644 USTom Brown, Communications ManagerPhone (724-527-2811)[email protected]

Energy Unlimited Inc.P.O. Box 74855 Highway YZDodgeville, WI 53533 USDave Lundell, ForemanPhone (608-935-9119) | Fax (608-935-0008)[email protected]

Enginuity Worldwide651 E Commerce RoadMexico, MO 65255 USNancy Heimann, President, CEOPhone (573-567-4417)[email protected]

ENVINT Consulting2233 Ch St AntoineLaval, QB H7R 6C7 CANADAMartin Tampier, MrPhone (4506271003)[email protected]

Equinox LLC4255 43rd Ave SFargo, ND 58104 USKyle Althoff, PresidentPhone (303-910-6052)[email protected]

FFagen, Inc.501 W Hwy 212Granite Falls, MN 56241 USRick Cantor, VP - Business DevelopmentPhone (864-627-0060) | Fax (320-564-3324)[email protected]

Firefly ABTextilgatan 31Stockholm, 12030 SWEDENMikael Jidenius, Area Sales ManagerPhone (4684492500) | Fax (4684492501)[email protected]

First Environment, Inc.91 Fulton StreetBoonton, NJ 07005 USKristy Cerullo, Marketing/Proposal ManagerPhone (973-334-0003) | Fax (973-334-0928)[email protected]

FLAMEX, Inc4365 Federal DriveGreensboro, NC 27410 USAllen Wagoner, PresidentPhone (336-299-2933) | Fax (336-299-2944)[email protected]/SEE OUR AD ON PAGE 46

FMW Industrieanlagen GmbH3207 Lake Forest Dr.Augusta, GA 30909 USWalter Lampp, North American ManagerPhone (706-829-3337) | Fax (706-733-4115)[email protected]

Forest Concepts, LLC3320 West Valley Hwy NAuburn, WA 98001 USMike Perry, CEOPhone (253-333-9663) | Fax (253-833-2639)[email protected]

FPInnovations570 Saint-Jean BlvdPointe-Claire, QB H9R 3J9 CANADAJennifer Ellson, Senior Communications SpecialistPhone (514-630-4100)[email protected]

GGARN Wood Heating3425 33rd Ave. NEMinneapolis, MN 55418 USMartin Lunde, PE, PresidentPhone (612-326-1100)[email protected]

Geltech Solutions1460 Park Lane South, Suite 1Jupiter, FL 33458 USMatt Struzziero, Director of Sales & Strategic OperationsPhone (800-924-4874) | Fax (561-427-6182)[email protected] OUR AD ON PAGE 50

GEMCO Energy MachinerySuite B,4/F Jinhao Business Bld.,Renmin Rd.,Anyang,Henan,P.R.CHenan, 455000 CHINAyanooka yang, Pellet Mill ManufacturerPhone (008603725965148)Fax (008603725951936)[email protected]://www.gcmec.com

Genera Energy Inc167 Tellico Port RoadVonore, TN 37803 USSam Jackson, VP, Business DevelopmentPhone (423-884-4110)[email protected]

General Kinematics5050 Rickert Rd.Crystal Lake, IL 60014 USDick Reeves, Industry Director - Resource RecoveryPhone (815-455-3222) | Fax (815-455-2285)[email protected]

Global Sustainable Products, Inc.4879 Magnolia RoadMarianna, FL 32448 USJoe Busby, PresidentPhone (850-209-1331)[email protected]

Golden Peanut and Tree NutsP.O. Box 186Headland, AL 36345 USBeverly Warrington, Director, Hull & Fiber ProductsPhone (334-693-0011) | Fax (334-693-0112)[email protected]

GreCon Moisture Meters15875 SW 74th AveTigard, OR 97224 USMarshall LLoyd, SalesPhone (503-641-7731) | Fax (503-641-7508)[email protected]://www.grecon-us.com/measurement/infrared-moisture-meter/SEE OUR AD ON PAGE 47

GreCon Spark Detection15875 SW 74th Ave.Tigard, OR 97224 USTerry Franklin, Technical Sales DirectorPhone (503-641-7731) | Fax (503-641-7508)[email protected]/spark-detection/SEE OUR AD ON PAGE 47

Green Energy of FL12429 Colony Preserve DrBoynton Beach, FL 33436 USJeff Balsewich, CEOPhone (561-922-7475)[email protected]

Green Star Gasifiers, LLC127 Dishman Ln, Suite B-1Bowling Green, KY 42101 USChris Jeffries, PresidentPhone (270-904-4964) | Fax (270-721-0134)[email protected]

Greenfield Products2979 167th St.Hazel Crest, IL 60429 USBill Healy, SalesPhone (708-336-3254)[email protected]://www.greenfieldpi.com/

Greenlane Biogas208 - 4288 Lozells AvenueBurnaby, BC V5A 0C7 CANADARicardo Hamdan, Business DevelopmentPhone (778-788-0774)[email protected]

HH.T. PROF Clean Tech575 N. Patterson Ave.Suite 444Winston-Salem, NC 27101 USTodd Porter, PresidentPhone (770-420-7440) | Fax (770-420-7440)[email protected]/clean-tech.htm

Hallco Industries Inc.PO Box 505Tillamook, OR 97141 USRicardo Aguinaga, VP of Sales and MarketingPhone (503-842-8746)[email protected]

HEMCO Corporation711 South Powell RoadIndependence, MO 64056 USJerry Schwarz, Marketing / AdvertisingPhone (800-779-4362) | Fax (816-796-3333)[email protected]

Heyl & Patterson Inc.400 Lydia StreetCarnegie, PA 15106 USDavid Phillips, Marketing & Communications ManagerPhone (412-788-9810) | Fax (412-788-9822)[email protected]

Hoffmann, Inc.6001 49th St. SouthMuscatine, IA 52761 USPaul Reed, Silo & Chimney Sales ManagerPhone (563-263-4733) | Fax (563-263-0919)[email protected]

HUB International New England, LLC formerly FieldEddy InsurancePO Box 70996 Shaker RdEast Longmeadow, MA 01028 USTeresa Petit de Mange, Vice PresidentPhone (413-233-2108) | Fax (413-733-3191)[email protected]

Page 65: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 65

Company Index

Hudco Industrial Products, Inc.3100 Morgan RoadBessemer, AL 35022 USBryant Allen, General ManagerPhone (800-247-9908)[email protected]://www.hudcoinc.com/SEE OUR AD ON PAGE 34

Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (2293463545)[email protected] OUR AD ON PAGE 2

Husch Blackwell LLP13330 California StSuite 200Omaha, NE 68154 USDavid Gardels, PartnerPhone (402-964-5027)[email protected]

Hydroflex Systems, Inc.PO Box 296Hummelstown, PA 17043 USCathleen Kaiser, Co-OwnerPhone (717-480-4200)[email protected]

IICF International1725 Eye Street NWWashington, DC 20006 USStacy Noblet, Senior ManagerPhone (202-862-1147)[email protected]

ICS, Inc. PO Box 13158Grand Forks, ND 58208-3158 USDavid Dangerfield, Project DevelopmentPhone (701-775-8480) | Fax (701-775-8479)[email protected]

IEP Technologies417-1 South StreetMarlborough, MA 01752 USJohn Shea, Vice President - Marketing & Business DevelopmentPhone (855-793-8407) | Fax (508-485-3115)[email protected] OUR AD ON PAGE 56-57

Impact Bioenergy Inc.1001 NW 167th StShoreline, WA 98177 USJan Allen, PresidentPhone (206-250-3242)[email protected]

Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42

Industrial Fire Prevention LLCPO Box 2046118 E. Hancock St.Milledgeville, GA 31059 USJeffrey Nichols, PresidentPhone (770-266-7223) | Fax (770-266-7223)info@industrialfireprevention.comwww.IndustrialFirePrevention.com

Industrial Sonomechanics, LLC479 W 146th St., Ground FloorNew York, NY 10031 USIva Gyurgina, Customer Relations and Marketing ManagerPhone (646-580-4676)[email protected]://sonomechanics.com/

International Bioenergy Conference & Exhibition PO Box 1421323 5th AvePrince George, BC V2L 4R9 CANADACam McAlpine, PresidentPhone (250-961-6611)[email protected]/‎SEE OUR AD ON PAGE 33

International Generator Technical CommunityPO Box 370Columbus, OH 43215 USJane Hutt, Webmaster and Site ManagerPhone (360-515-7861)webmaster@generatortechnicalforum.orgwww.powerplanttechnicalforum.org

Iowa State University BioCentury Research Farm1041 Food Sciences Bldg.Ames, IA 50011-1061 USKevin Keener, DirectorPhone (515-294-0160) | Fax (515-294-6261)[email protected]

ISC Companies12905 Highway 55 WestMinneapolis, MN 55441 USLindsay Distel, MarketingPhone (763-559-0033) | Fax (763-519-1574)[email protected]

JJavo International1900 Cobb International BlvdSuites G & HKennesaw, GA 30152 USJay Honeycutt, North American Account ManagerPhone (770-428-4491) | Fax (770-424-6635)[email protected]

JDV Equipment Corporation1 Princeton AveDover, NJ 07801 USSean King, VPPhone (973-366-6556) | Fax (973-366-3193)[email protected] OUR AD ON PAGE 52

Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36

KKarr Group Co.14500 Roscoe Blvd. Ste 203Panorama City, CA 91402 USKevin Talwar, Sales DirectorPhone (805-479-5565) | Fax (805-479-5565)[email protected]

Kent Industrial Co., Ltd.No.17, Dou-Kung 9th Rd., Dou Liu Expanded Industrial Park, Dou Liu City,Yun Lin Hsien, 640 TWSteve Lien, Sales ManagerPhone (88655575356) | Fax (88655575136)[email protected]://www.surface-grinder-kentind.com/

Kentucky Division of Biofuels500 Mero Street, 6th FloorFrankfort, KY 40601 USTim Hughes, DirectorPhone (5025647192) | Fax (502-564-7406)[email protected]/biofuels/Pages/default.aspx

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]

Komptech Americas10855 Dover Street, Suite 1000Westminster, CO 80021 USBrandon Lapsys, VP of Sales & OperationsPhone (303-669-5637)[email protected]

LLatta Equipment Co330 E. Hebron St.Charlotte, NC 28273 USMike Brown, OwnerPhone (704-752-7944)[email protected] http://www.lattaequipment.com/

Legacy Building Solutions 19500 County Rd 142South Haven, MN 55382 USJenniefer Halverson, Business ResourcePhone (320-258-0500)jhalverson@legacybuildingsolutions.comwww.legacybuildingsolutions.com/industries/waste-recycling/

Lehra Energy Resources Pvt LtdLehra near Dehlon District Ludhiana PunjabLudhiana, 141118 INDIAHardeep Singh Ubhi, Executive Director Phone (00919815771137)Fax (01612885137)[email protected]

Lewis & Raulerson1759 State StreetWaycross, GA 31501 USMike Cifranic, Sales EngineerPhone (912-282-0975) | Fax (912-285-3283)[email protected]

LLJ Consulting & Business Development16675 Market AvenueCologne, MN 55322 USB, OwnerPhone (952-466-3363)[email protected]

LM Machinery and Equipment, LLC401 Liberty Ave. Three Gateway Center, Suite 1651Pittsburgh, PA 15222 USWladimiro Labeikovsky, PresidentPhone (412-608-8528) | Fax (412-904-7530)[email protected]://www.lm-machinery.net/

Loci Controls, Inc.28 Dane StreetSomerville, MA 02143 USShaun Bamforth, Director of Business DevelopmentPhone (954-325-0210)[email protected]

Luminate, LLC1801 BroadwaySuite 1620Denver, CO 80202 USMichael Robinson, President & CEOPhone (303-860-7627) | Fax (303-860-7647)[email protected]

MM-E-C Company4401 Belle Oaks Drive,Suite 210Charleston, SC 29405 USStephen Rice, COOPhone (620-325-2673) | Fax (620-325-2678)[email protected]

Maas Companies Inc.P. O. Box 7127Rochester, MN 55903-7127 USTyler Maas, Director of Sales & MarketingPhone (507-285-1444) | Fax (507-285-0034)[email protected]

Maine Pellet Fuels Association 97A Exchange StreetSuite 305Portland, ME 04101 USWilliam Bell, Executive DirectorPhone (207-752-1392)[email protected]

Marsh & McLennan Agency1001 Haxall Point, Suite 800Richmond, VA 23219 USGeorge Phillips, Sr. Vice presidentPhone (804-915-5630)[email protected]

Master Magnetics747 S. Gilbert St.Castle Rock, CO 80104 USJim Madsen, Sales ManagerPhone (888-293-9399)[email protected]

McGill AirClean LLC1777 Refugee RoadColumbus, OH 43207 USJerry Childress, National Sales ManagerPhone (614-829-1350) | Fax (614-445-8759)[email protected]

Page 66: 2016 Biomass Industry Directory

66 | 2016 Biomass Industry Directory

Company Index

McGill AirClean LLC1777 Refugee RoadColumbus, OH 43207 USJerry Childress, National Sales ManagerPhone (614-829-1200) | Fax (614-445-8759)[email protected]

Mid-South Engineering1658 Malvern AvenueHot Springs, AR 71901 USMark Culpepper, Vice PresidentPhone (501-321-2276) | Fax (501-624-4214)[email protected] OUR AD ON PAGE 24

Miron Construction Co., Inc.1471 McMahon DriveNeenah, WI 54956 USDan Goymerac, Vice President Industrial Business DevelopmentPhone (920-969-7004) | Fax (920-969-7393)[email protected]

Monitor Tech Corporation661 N. James Rd.Columbus, OH 43219 USRobert Mullowney, CEOPhone (614-231-0500) | Fax (614-231-0555)[email protected] OUR AD ON PAGE 49

Monitor Technologies LCC44W320 Keslinger RoadElburn, IL 60119 USGreg DeRudder, Director of SalesPhone (630-365-9403)[email protected]

Morbark, Inc. 8507 S. Winn Rd, PO Box 1000Winn, MI 48896 USMichael Stanton, Regional Sales ManagerPhone (800-831-0042) | Fax (989-866-2280)[email protected]

Morrow Renewables, LLCPO Box 61447Midland, TX 79711 USLuke Morrow, PresidentPhone (432-563-0447)[email protected]

NNational Electric Coil800 King AvenueColumbus, OH 43212 USSteve Jeney, VP Marketing/SalesPhone (614-488-1151) | Fax (614-488-8892)sendinfo@national-electric-coil.comwww.national-electric-coil.com

NDC Technologies8001 Technology BlvdDayton, OH 45424 USJay Luis, Marketing Communications ManagerPhone (937-233-9935)[email protected] OUR AD ON PAGE48

New Canaan Capital Mgmt LLC. Post Office Box 94831344 Crayton Road Naples, FL 34101 USJeffrey Weisz, Managing Member Phone (239-919-8825) | Fax (917-957-9703)[email protected]

New Holland Agriculture500 Diller AvenueNew Holland, PA 17557 USJarrod Angstadt, Manager, Growth Initiatives, Biomass & SpecialtyPhone (281-687-9159) | Fax (281-763-2632)[email protected]/na

Northwest Manufacturing, Inc./WoodMaster600 Polk Ave SWRed Lake Falls, MN 56750 USGrant Gagner, Commercial Sales ManagerPhone (800-932-3629) | Fax (218-253-4409)[email protected] OUR AD ON PAGE 40

NSF International789 N. Dixboro RoadAnn Arbor, MI 48105 USJamie Bush, Business Development Manager - SustainabilityPhone (734-827-5668)[email protected] OUR AD ON PAGE 17

OOlson Search International, Inc.PO Box 3127Redmond, WA 98073 USJon Olson, PresidentPhone (800-985-5191) | Fax (406-756-5154)[email protected]

optek-Danulat, Inc.N118W18748 Bunsen DrGermantown, WI 53022 USJoe Ferrelli, Product SpecialistPhone (888-901-4288)[email protected]

Outotec Energy Products3568 W Industrial LoopCoeur d’Alene, ID 83815 USKent Pope, Director of Business DevelopmentPhone (208-765-1611) | Fax (208-765-0503)[email protected]

PPenn State Biomass Energy Center249 Ag Engineering BuildingUniversity Park, PA 16802 USTom Richard, DirectorPhone (814-863-0291) | Fax (814-863-1031)[email protected] OUR AD ON PAGE60

Pick Heaters, Inc.730 S. Indiana Ave.PO Box 516West Bend, WI 53095 USSales Dept., SalesPhone (262-338-1191) | Fax (262-338-8489)[email protected]

Potomac Law Group, PLLC6225 Hampstead Ct.Port Tobacco, MD 20677 USNeil Belson, Of Counsel and Chair of Life Sciences PracticePhone (240-416-7239) | Fax (301-392-9806)[email protected]://www.potomaclaw.com/attorney-profiles/neil-belson/

PPS Group LLC 4717 Grand Ave. Suite 300Kansas City, MO 64112 USLou Gonzales, PresidentPhone (816-627-0606) | Fax (816-531-2195)[email protected]

Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/

Precision Injection-Multiplas Enginery Co., Ltd.No.65, Technology 7th Road, Hwa-Ya Technology Park,Taoyuan, 33333 TAIWANApple Wang, Marketing SpecialistPhone (88633180090) | Fax (88633975498)[email protected]://www.injection-molding-machines.com/

Price LogPro, LLC. 400 Aviation Plaza, Suite BHot Springs, AR 71913 USJosh Krauss, Vice President of SalesPhone (800-826-7803) | Fax (501-844-4474)[email protected]

Process and Storage Solutions3446 County Road 90Rainsville, AL 35986 USDonald Land, Co-OwnerPhone (866-354-7277) | Fax (256-638-1839)[email protected] OUR AD ON PAGE 55

ProcessBarron2770 Welborn St.Pelham, AL 35124 USCliff Moss, VP and Director of Materials Handling DivisionPhone (205-663-5330)[email protected] OUR AD ON PAGE 30

ProcessBarron2770 Welborn StreetPelham, AL 35124 USCliff Moss, Vice PresidentPhone (205-663-5330)[email protected] OUR AD ON PAGE 30

ProcessBarron2770 Welborn StreetPelham, AL 35124 USAllen Ray, Director of Air HandlingPhone (205-663-5330)[email protected] OUR AD ON PAGE 30ProcessBarron2770 Welborn StreetPelham, AL 35124 USPhillip Gore, Product ManagerPhone (205-663-5330)[email protected] OUR AD ON PAGE 30

Processbio A/SPO Box 34 Romeo, MI 48065 USJorgen Lyngso, American representativePhone (586-255-7075)[email protected]

Proco Products, Inc.2431 N. Wigwam DriveStockton, CA 95205 USRob Coffee, VP Sales & MarketingPhone (209-943-6088) | Fax (209-943-0242)[email protected]

ProPellet, LLC807 Broadway Street NE, Suite 185Minneapolis, MN 55413 USKathy Osborne, Business Development ManagerPhone (612-616-7409)[email protected]

Pure Dwelling LLCP.O. Box 863Sun Prairie, WI 53590 USGregory Brown, PrincipalPhone (608-630-0225)[email protected]

RR W HEIDEN ASSOCIATES LLC1026 New Holland AvenuePO Box 5001Lancaster, PA 17601 USRichard Heiden, Chief Science and Technology OfficerPhone (717-299-6860) | Fax (717-299-6868)[email protected]

Rawlings Waste Wood Recovery SystemsPO Box 4485Missoula, MT 59806 USJohn Rawlings, PresidentPhone (406-728-6182) | Fax (406-728-7957)[email protected] OUR AD ON PAGE 18

RCBC Global Inc.15 Pine Dr.Mills River, NC 28759 USDoug King, Marketing DirectorPhone (828-696-2111) | Fax (828-696-2191)[email protected],com

RCBC Global Inc.401 North Main St. Suite 201Hendersonville, NC 28792 USDoug King, VP MarketingPhone (828-696-2111)[email protected]

REBL Refractories Evaluations Laboratory, ULC#109, 8484 162nd StreetSurrey, BC V4N 1B4 CANADABryce Jardine, Regional ManagerPhone (778-578-7551) | Fax (778-578-7571)[email protected]

Refined BioProducts1718 Pine StreetStevens Point, WI 54481 USJohn Leschke, New Business DevelopmentPhone (715-869-7866)[email protected]

Page 67: 2016 Biomass Industry Directory

2016 Biomass Industry Directory | 67

Company Index

Renewable Energy Consultants, LLCPO Box 41Beavertown, PA 17813 USBob Rice, President/CEOPhone (570-765-2020)[email protected] OUR AD ON PAGE 23

Riley Power Inc.5 Neponset StreetWorcester, MA 01615-0040 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/riley-power-incSEE OUR AD ON PAGE 7

RIX Industries4900 Industrial WayBenicia, CA 94510 USDave Savidge, Director of Industrial and Commercial CompressorsPhone (707-745-7112)[email protected] OUR AD ON PAGE 43

Rotex Global1230 Knowlton StreetCincinnati, OH 45223 USAustin Kephart, Marketing ManagerPhone (513-541-1236)[email protected]

Round for a Reason LLC11698 395th AveColumbia, SD 57433 USAndrew Murray, MemberPhone (605-396-2431)[email protected]

RR Renewable Energy23 Lafayette StRumson, NJ 07760 USGeorge Saintonge, PresidentPhone (732-768-7007) | Fax (732-741-2087)[email protected]

RSG - Resource Systems Group, Inc.55 Railroad RowWhite River Junction, VT 05001 USJohn Hinckley, DirectorPhone (802-295-4999)[email protected]

Rubb Buildings Inc.1 Rubb LaneSanford, ME 04073 USChuck Auger, Marketing ManagerPhone (207-324-2877)[email protected]

RUD Chain Inc.PO Box 367Hiawatha, IA 52233 USMike Mews, North American Sales ManagerPhone (319-375-3224) | Fax (319-214-0003)[email protected] OUR AD ON PAGE 31

RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]

SSAMSON Materials Handling Ltd.Gemini House, Cambridgeshire Business Park1 Bartholomew’s WalkEly, Cambridgeshire, CB74EA GBMalcolm Youll, Managing DirectorPhone (441353665001)Fax (441353666734)[email protected]

SCHADE Lagertechnik GmbHBruchstrasse 1Gelsenkirchen, 45883 DEKarl-Heinz Fiegenbaum, Managing DirectorPhone (4920950316122) Fax (4920950316188)[email protected]

Schaeffer’s Specialized Lubricants102 Barton StreetSt. Louis, MO 63104 USSteve Rober, National Sales ManagerPhone (314-865-4100) | Fax (314-865-4107)[email protected] OUR AD ON PAGE

Schnader Harrison Segal & Lewis LLPSuite 2700 Fifth Avenue Pl.120 Fifth AvenuePittssburgh , PA 15222 USMegan Harmon, PartnerPhone (412-577-5200)[email protected]

Scientific Dust Collectors4101 W. 126th StreetAlsip, IL 60007 USAndrew Rutherford, Sales ManagerPhone (708-597-7090) | Fax (708-597-0313)[email protected]

Sigma Thermal, Inc4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 53

Simplyfeye Softwares Pvt LtdFlat S1, 2nd Floor, 8-3-970Srinagar ColonyHyderabad, 500073 INAnshuman Bansal, DirectorPhone (914042217057)[email protected]://www.simplyfeye.com

SLS Financial Services200 S., O’Connell StreetSuite 400Marshall, MN 56258 USKennedy Gilbertson, National Account ManagerPhone (605-444-1106) | Fax (605-271-7133)[email protected]

Smart E2 Solutions14 Edgewood RoadRumson, NJ 07760 USGeorge St.Onge, Director of Business DevelopmentPhone (732-768-7007) | Fax (732-758-1169)[email protected]

SmokeLess Heat LLC2020 cornwall RDLebanon, PA 17042 USDean Zook, OwnerPhone (717-389-0083) | Fax (717-273-2248)[email protected]

Stock Equipment Company16490 Chillicothe RoadChagrin Falls, OH 44023 USSusan Wiltshire, Technical WriterPhone (440-543-6000) | Fax (440-543-5944)[email protected]://www.schenckprocess.com/stockequipment

Sukup Manufacturing Co.PO Box 6771555 255th St.Sheffield, IA 50475-0677 USJohn Hanig, Bin Sales DirectorPhone (641-892-4222) | Fax (641-892-4629)[email protected]

SUMA America855 North Wood Dale RoadSuite AWood Dale, IL 60191 USEugene Smith, Sales Application EngineerPhone (847-427-7880) | Fax (630-354-6840)[email protected]

Syntek Resource Corporation2143 18th Avenue CourtGreeley, CO 80631 USSandra Robnett, Chm/CEOPhone (970-356-9004) | Fax (970-356-9004)[email protected]

TTAPCO Inc.225 Rock Industrial Park DriveSt. Louis, MO 63044 USYassine Abbad, International Sales ManagerPhone (314-739-9191)[email protected]

Team Biogas23551 Rose Quartz DrPerris, CA 92570-7440 USMark Hintz, Sales ConsultantPhone (425-422-5970) | Fax (866-593-3679)[email protected]

TEi Construction Services170 Tucapau RdDuncan, SC 29334 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/tei-construction-services-incSEE OUR AD ON PAGE 7

Tenmat LimitedAshburton Road WestTrafford ParkManchester, M17 1RU ENGLANDJoshua Cullen, Technical Sales EngineerPhone (00441619552425)Fax (00441618727596)[email protected]

TGR Industrial Services1127 S Lewis AveTulsa, OK 74104 USGary Mathis, Advanced NDT ManagerPhone (918-629-2735) | Fax (918-584-5598)[email protected]

The Dupps Company548 North Cherry Street Germantown, OH 45327 USRichard Weeks, SalesPhone (937-855-6555)[email protected]

Thermal Engineering Int’l (USA)10375 Slusher DriveSanta Fe Springs, CA 90670 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-exchangers/thermal-engineeringSEE OUR AD ON PAGE 7

Three-esVia Libertà 105Lazzate, 20824 ITALYMarco Soldo, ManagerPhone (00390296328225) | Fax (00390296320029)[email protected]

Timber Products Inspection1641 Sigman RoadConyers, GA 30012 USTammy Hippchen, Business Development SpecialistPhone (218-461-2579)[email protected]

Towertech Cooling System Pvt.Ltd103-B, Synergy Tower, Near Vodafone House, Corporate Road,Prahlad Nagar, 380015 INDIAPhone (917940397842)[email protected]://www.towertechglobal.com/

TRAXPayroll - Online Payroll Services740 Alfred Nobel DriveHercules, CA 94547 USSales/AdminPhone (866-611-5410) | Fax (510-964-9322)[email protected]

Tulikivi U.S.Inc.172 South Pantops Dr, Suite BCharlottesville, VA 22911 USPäivi Saarelainen, Sales and Marketing ManagerPhone (800-843-3473)[email protected]

Page 68: 2016 Biomass Industry Directory

68 | 2016 Biomass Industry Directory

Company Index

Turboden Srl628 Hebron Avenue, Suite 400Glastonbury, CT 06033 USIlaria Peretti, Manager, Sales & Business Development North AmericaPhone (860-881-0281)[email protected] OUR AD ON PAGE 28

UUEM1818 S. Australian Ave. Suite 110West Palm Beach, FL 33409 USNina Kshetry, Project ManagerPhone (561-294-0138) | Fax (561-683-2996)[email protected]

Uzelac Industries, Inc.6901 Industrial LoopGreendale, WI 53129 USMichael Uzelac, PresidentPhone (414-529-0240)[email protected]

VValmet 2750 Morris RoadLansdale, PA 19446 USDarryl Haag, Director, Energy SolutionsPhone (267-421-9770)[email protected]/industries-we-serve/energy/

Valmet, Inc.3440 Toringdon WaySuite 300Charlotte, NC 28277 USKerry Flick, Director, TechnologyPhone (704-541-1453)[email protected]

Vecoplan Midwest4005 Earnings WayNew Albany, IN 47150 USBill Miller, Chief Operating OfficerPhone (812-923-4992)[email protected] OUR AD ON PAGE 16

Vecoplan, LLCPO Box 7224High Point, NC 27264 USYuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)[email protected] OUR AD ON PAGE 16

Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]

VIC-Vecoplan Integrated Controls5708 Uwharrie RoadArchdale, NC 27263 USTodd Carswell, VP of Technical ServicesPhone (336-861-6070)[email protected] OUR AD ON PAGE 16

Virtus Equipment340 Commerce Drive Unit BCrystal Lake, IL 60014 USThomas Breslin, PresidentPhone (815-477-2100)[email protected]

Vogelbusch USA, Inc.1810 Snake River RoadKaty, TX 77449-7747 USDan Mahon, Vice PresidentPhone (713-461-7374)[email protected]

Vogt Power International13551 Triton Park BoulevardSuite 2000Louisville, KY 40223 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-recovery-systems/vogt-power-internationalSEE OUR AD ON PAGE 7

Vulcan Systems1414 Riley Industrial Dr., PO Box 98Moberly, MO 65270 USPreston Whitney, Vice President of Business DevelopmentPhone (660-263-7575) | Fax (660-263-2526)[email protected] OUR AD ON PAGE 32

WWarren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]

Webco Industries9101 W 21st StreetSand Springs, OK 74063 USJene Harmon, Marketing DIrectorPhone (918-245-2211) | Fax (918-246-7053)[email protected]

Wellons2525 W Firestone LaneVancouver, WA 98660 USSalesPhone (360-750-3500) | Fax (360-750-3400)[email protected]

West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38

Western Pneumatics, Inc.PO Box 21340Eugene, OR 97402 USBruce Livesay, Vice PresidentPhone (541-461-2600) | Fax (541-461-2606)[email protected]

Wildephor Consulting Services, LLC481 N Santa Cruz Ave #280Los Gatos, CA 95030 USW. David Featherman, PE, PrincipalPhone (510-845-0016)[email protected]

Wisewood, Inc2409 N. Kerby Ave. Portland, OR 97227 USMeagan Nuss, Project Development CoordinatorPhone (503-706-6187) | Fax (503-715-0483)[email protected]

Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 29

ZZhengzhou Victor MachineryCo LtdWenhua Roand and Sanquan Road Zhengzhou ChinaJames Duan, salesmanPhone (008637156747890)[email protected]://victormachinez.com/

Page 69: 2016 Biomass Industry Directory

Notes

directory.biomassmagazine.com

Page 70: 2016 Biomass Industry Directory

Notes

directory.biomassmagazine.com

Page 71: 2016 Biomass Industry Directory
Page 72: 2016 Biomass Industry Directory

A S T E C

FINAL PELLET MILL MAG BKCOV.indd 1 4/25/14 11:40 AM