© Copyright Ebiointel,SL 2006 NAR Nucelic Acid Research The Molecular Biology Database Collection 2006 update.

copy Copyright EbiointelSL 2006

Nucelic Acid Research

TheMolecularBiologyDatabaseCollection2006update

copy Copyright EbiointelSL 2006

copy Copyright EbiointelSL 2006

copy Copyright EbiointelSL 2006

httpwwwebiacukservices

httpwwwncbinlmnihgov httpwwwddbjnigacjpWelcome-ehtmlhttpwwwddbjnigacjpWelcome-ehtml

copy Copyright EbiointelSL 2006

Tool BoxTool Box

copy Copyright EbiointelSL 2006

copy Copyright EbiointelSL 2006

copy Copyright EbiointelSL 2006

copy Copyright EbiointelSL 2006

bullPreparacioacuten y edicioacutenbull Sumisioacuten

bullViacutea Web en BankIt bullSequin (software)

bull Asignacioacuten de coacutedigos de accesobull Revisiones y actualizacionesbull Colaboracioacuten internacional intercambio de entre EMBL GenBank i DDBJ

Almacenamiento y formato de las

secuencias

copy Copyright EbiointelSL 2006

Identificadores

bull Identificadores comunes en bioinformaacuteticandash Locus Namendash Accession Numbersndash GenInfo ID (gi)ndash Pubmed IDndash hellip

copy Copyright EbiointelSL 2006

LOCUS IDsbull Letras identificativas del organismo + coacutedigo del

genndash ECRECA Escherichia coli recA gene

bull Actualmente NO se utiliza esta identificacioacuten por el crecimiento de la base de datos

bull Accesion numberndash AC

1 letra + 5 nuacutemeros (X00123) 2 letras + 6 nuacutemeros (AJ000123)3 letras + 8 nuacutemeros

copy Copyright EbiointelSL 2006

Registros

gi Accession version date Genbank Division taxid organims Number of Chromosomes6226959 NM_000014 3 06012000 PRI 9606 homo sapiens 22 diploid + X+Y6226762 NM_000014 2 10121999 PRI 9606 homo sapiens 22 diploid + X+Y4557224 NM_000014 1 02041999 PRI 9606 homo sapiens 22 diploid + X+Y

41 X63129 1 06061996 MAM 9913 bos taurus 29+X+Y

bull Una coleccioacuten de registros (records)bull Cada registro tiene varios camposbull Cada campo contiene informacioacuten

especiacuteficabull Cada campo contiene datos de un tipo

determinadondash Ej texto nuacutemeros enteros fechas

bull Cada registro tiene una clave primaria Un identificador uacutenico que define al registro sin ambiguumledad

copy Copyright EbiointelSL 2006

Registrosgi Accession version date Genbank Division taxid organims Number of Chromosomes6226959 NM_000014 3 01062000 PRI 9606 homo sapiens 22 diploid + X+Y6226762 NM_000014 2 12101999 PRI 9606 homo sapiens 22 diploid + X+Y4557224 NM_000014 1 04021999 PRI 9606 homo sapiens 22 diploid + X+Y

41 X63129 1 06061996 MAM 9913 bos taurus 29+X+Y

gi = Genbank Identifier Clave uacutenica Clave primariabullCambia con cada actualizacioacuten del registro correspondiente a la secuenciabullCada entrada en la bd tiene un uacutenico IDbullNo sujetos a versionesbullLa entrada se mantiene a lo largo del tiempobullLas diferentes versiones de una misma secuencia se administran mediante los coacutedigos de acceso (AC)

Accession Number Clave secundaria

Refiere al mismo locus y secuencia a pesar de los cambios en la secuencia

Accession + Version es equivalente al gi (representa un identificador uacutenico)

Ejemplo AF4053212 Accession AF405321 Version 2

copy Copyright EbiointelSL 2006

bull Ficheros ASCIISenzillo Muacuteltiple MixtoFASTA Clustal RSFEMBL PhylipGenBank MSFGCG Stadem

FASTA senzillo

Formatos secuencias

gtsp|P03017|RECA_ECOLI RecA protein (Recombinase A) - Escherichia coliAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS

gtsp|P03017|RECA_ECOLI RecA protein (Recombinase A) - Escherichia coliAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS

Seq1 Descripcioacutentiacutetulo de la secuenciaAGTACGTAGTAGCTGCTGCTACGTGCGCTAGCTAGTACGTCACGACGTAGATGCTAGCTGACTCGATGC

Seq1 Descripcioacutentiacutetulo de la secuenciaAGTACGTAGTAGCTGCTGCTACGTGCGCTAGCTAGTACGTCACGACGTAGATGCTAGCTGACTCGATGC

copy Copyright EbiointelSL 2006

Feature key examplesKey Description conflict Separate determinations of the same sequence differrep_origin Origin of replicationprotein_bind Protein binding site on DNACDS Protein-coding sequence misc_RNA Generic label for an undefined RNAD-loop Mitochondrial or other D-loop structure

bullQualifiers auxiliary information

bullLocationinstructions for finding the feature

Key LocationQualifiersCDS 86742 product=hypoxanthine phosphoribosyltransferase label=hprt note=hprt catalyzes vital steps in the reutilization pathway for purine biosynthesis and its deficiency leads to forms of gouty arthritisrep_origin 234243 direction=leftCDS 109564 usedin=X10009catalase

Location Description 467 Points to a single base in the presented sequence 340565 Points to a continuous range of bases bounded by and including the starting and ending baseslt345500 Indicates that the exact lower boundary point of a feature is unknown The location begins at some base previous to the first base specified (which need not be contained in the presented sequence) and con-

tinues to and includes the ending base (102110) Indicates that the exact location is unknown but that it is one of the bases between bases 102 and 110 in- clusive

bullFeature key a keyword indicating functional group

Features amp QualifiersEMBL

Features amp QualifiersEMBL

Feature Table Definition

Feature Table Definition

Anotaciones

copy Copyright EbiointelSL 2006

Ejemplo anotacioacutenEukaryotic gene

source 11509 organism=Mus musculus strain=CD1promoter lt19 gene=ubc42mRNA join(105677891320) gene=ubc42CDS join(545677891254) gene=ubc42 product=ubiquitin conjugating enzyme function=cell division control translation=MVSSFLLAEYKNLIVNPSEHFKISVNEDNLTEGPPDTLY QKIDTVLLSVISLLNEPNPDSPANVDAAKSYRKYLYKEDLESYPMEKSLDECS AEDIEYFKNVPVNVLPVPSDDYEDEEMEDGTYILTYDDEDEEEDEEMDDEexon 10567 gene=ubc42 number=1intron 568788 gene=ubc42 number=1exon 7891320 gene=ubc42 number=2polyA_signal 13101317 gene=ubc42

copy Copyright EbiointelSL 2006

Ejemplo anotacioacutenBacterial Operonsource 19430 organism=Lactococcus sp strain=MG1234-35_signal 160165 gene=galA evidence=EXPERIMENTAL-10_signal 179184 gene=galA evidence=EXPERIMENTALCDS 4051934 gene=galA product=galactose permease function=galactose transporter evidence=EXPERIMENTALCDS 20033001 gene=galM product=aldose 1-epimerase EC_number=5133 function=mutarotaseCDS 32354537 gene=galK product=galactokinase EC_number=2716 evidence=EXPERIMENTALmisc_RNA 1896865 gene=galAMK evidence=EXPERIMENTAL

copy Copyright EbiointelSL 2006

copy Copyright EbiointelSL 2006

GenBank Overview

Bases de secuencia nucleotidicasBases de secuencia nucleotidicas

copy Copyright EbiointelSL 2006

copy Copyright EbiointelSL 2006

bullSwiss-Prot

bullPIRProtein International Resource

Bases de secuencia de proteiacutenas

copy Copyright EbiointelSL 2006

Entrada PIR

copy Copyright EbiointelSL 2006

Exemples Formats

Ejemplo de una secuencia en los diferentes bancos de

datos (reconbinasa A)

copy Copyright EbiointelSL 2006

bullProsite (Patrones)bullinterpro iproclass (dominiosclasificacioacuten)bullProtein Data Bank PDB Protein Data Bank (estructura)bullDIP (base de datos de interacciones entre proteiacutenas)bullSwiss 2D-page (mapas bidimensionales)bullBRENDA (enzimas)bullPharmGKB (dianas terapeuticas)bullTherapeutic Target Database (dianas terapeuticas)

Bases de datos especializados de proteiacutenas

copy Copyright EbiointelSL 2006

httpusexpasyorgprosite

Bancos especializados de proteiacutenas

copy Copyright EbiointelSL 2006

wwwebiacukinterpro

Bancos especializados de proteiacutenas

copy Copyright EbiointelSL 2006

Bancos especializados de proteiacutenas

copy Copyright EbiointelSL 2006

httpdipdoe-mbiuclaedudipSearchcgi

Identificar interacciones entre proteiacutenas

copy Copyright EbiointelSL 2006

Bancos especializados de proteiacutenas

httpusexpasyorghttpusexpasyorg

copy Copyright EbiointelSL 2006

Bancos especializados de proteiacutenas

copy Copyright EbiointelSL 2006

Bancos especializados de proteiacutenas

copy Copyright EbiointelSL 2006

Bancos especializados de proteiacutenas

copy Copyright EbiointelSL 2006

Bancos especializados de proteiacutenas

copy Copyright EbiointelSL 2006

Bancos especializados de proteiacutenas

copy Copyright EbiointelSL 2006

BasesGenoacutemicas

Genomes OnLine DatabaseGenomes OnLine Database

copy Copyright EbiointelSL 2006

Otras Basesgenoacutemicas

copy Copyright EbiointelSL 2006

1-La estructura del domino globular de la histona H5 (1Hst) se ha resuelto por cristalografiacutea Quieres estudiar la estabilidad de la primera heacutelice utilizando un peacuteptido que incluya dicha heacutelice iquestcual es la secuencia de dicho peacuteptido

2- Quieres realizar un estudio de los niveles de histona mediante geles bidimensionales iquestQue tejidos podraacutes usar como referencia de su nivel

3- iquestCuales de estas proteinas se pueden usar como diana terapeutica

de la diabetes (Diabetes mellitus)

a) Acyl-CoA desaturase 1

b) 3-phosphoinositide dependent protein kinase-1 c) Endothelin receptor d) Todas ellas

4- iquestCuaacuteles de las anteriores coresponden a un enzima y cual es su EC-number

Exemples

copy Copyright EbiointelSL 2006

5- Estas realizando un estudio comparativo de extractos proteicos de rintildeoacuten mediante geles bidimensionales entre ratas control y ratas con insuficiencia renal Ves modificaciones en la intensidad del spot marcado con una flecha iquestde que proteiacutena se trata

6-busca los posibles lugares de fosforilacioacuten de la histona h10 humana por la ck2