fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,
Post on 04-Aug-2021
2 Views
Preview:
Transcript
crea
ting.
tech
nica
l. flu
ids.
ADDITIVES & SYSTEM CLEANERmade in Germany
2
oil system. Engine Purifier Engine Care & Protect Engine Flush CeraGAT 500 TÜV approved Oil Booster Engine Oil Stop Leak NanoEngineSuperProtection Hydraulic Lifer Care & Protect
petrol system. Petrol System Clean & Protect TÜV approved Petrol System Cleaner PLUS TÜV approved Octane Booster S Octane Booster TÜV approved Air Intake Cleaner Petrol Valve&InjectionPurifier Petrol Applicator Spray
petrol & diesel. CAT Clean
diesel system. Diesel System Clean & Protect TÜV approved Diesel System Cleaner PLUS TÜV approved Air Intake Cleaner Diesel Diesel Applicator Spray Diesel Bactericide 1:1000 Diesel Winter Care 1:1000 Cetane Booster DieselAntiSmoke DPFPurifier DPF Cleaning Liquid DPF Air Jet Fluid DPF Air Jet compressed-air pistole DPF & Catalyst Cleaning Foam
LPG system. LPG Petrol System Cleaner LPG System Clean & Protect LPG Valve Protect
cooling system. RadiatorPurifier Radiator Sealant
air condition. AirCon Cleaner AirCon Refresher Spring AirCon Refresher Summer Fresh´nAIR Fluid Fresh´nAIR Device
sealant. Nano Car Glass Sealant
gear box & power steering. AutomaticTransmission Cleaner AutomaticTransmissionClean&Protect AutomaticTransmissionCleaningDevice Power Steering Care & Protect
service products. Brake Cleaner Spray Brake Cleaner Liquid ThrottleBodyCleaner MultiLube Penetrate Spray Silicone Spray MoS2 Rust Remover Electrical Contact Cleaner Silicone Sealing Compound
99
101011111212
15151616171718
21
23232424252526262727282829
313132
3535
3737383839
41
43434444
494948484949505051
Fromtheinitialcontactto the sample order up to thefirstdeliveryofgoodsyouwillbecounselledandsupportedbyourexperienced team.
We increase your success with a proven training concept,marketingsupportand of course with our wide product range.
Ourdifferentbusinessmodels assure the highest possiblesuccesstailoredtoyourbusinessstrategyand your individual requirements.
4
review. Created by passion, experience and visionoftheManagingDirectorDr.GabyUrban,thecompanyGATmbH&Co.KG(CorporationforFuel andAutomotiveTechnology)has started
theirbusinessactivitiesinMay2014.15 years of professional experience in this branch, a highly motivated teamand the trust in a successful businessestablishmenthavebeen theGeneralManger’smotivationtotakethisstep.
However, the beginners’ level has beenoversteppedlongtimeago.Withthefoundationof GAT we perfectly combine sales of well-establishedproductswiththedevelopmentofnewproductsandconceptsbecausedifferenteconomical and local conditions requireindividual customer solutions. If a businessis clearly focused on customer benefit, themarketpotentialisendless.Satisfiedcustomersaroundtheworldandfaircompetitionshallbethe mission statement of GAT.
5
facts. Our focus is set on the development and sales of premium service and maintenance products for the automotive branch as wellas for industrial applications. Our aim is thedevelopment of next-generation-products inourownResearch&Developmentfacilities.Wecooperate with universities, industry-relatedresearch institutes and with GovernmentControlledStandardsInstitutes(e.g.TÜV).
GAT’s innovative project has already receivedapproval for governmental support by the“ThuringianMinistryforEconomy,LabourandTechnology”. Since2016wearelocatedinournewproductionandR&Dsiteandwith thatareable to realizeourvisionsquicklyandefficiently.
6 inhalt.
Specificallytargetedtotherequirementsof industrial facilities,fleets,mining,etc. - invariablepackingsizesandconsumption-basedmixingratios.
OnrequestthecompleteGATproductrangecanbeofferedinthefollowingpackagesizes:
• Tin cans: 100 / 300 / 400 / 500 / 1000 ml• Canisters: 5 / 10 / 20 / 30 / 60 Liter• Barrel: 200 Liter• IBC: 1000 Liter
G AT i n d u s t r y .
10W40Engine Oil
5000 ml
creating. technical. fluids.
7unternehmen.
Scan the codeand see the catalogue
Onlycleansystemsguaranteeanefficient,safeandlong-term performance of engines and aggregates.
GATHigh-performancefluids•considerablyreducerepairandmaintenanceworks•reducedowntimes• extend service intervals•increasethelifespanandfunctionalityofsystemfluids• ensure long-term maintenance of value of machines and aggregates•significantreductionofharmfulexhaustemissions(HCandCOlevels)
8 oil system.
CAUSE OF FAILURE+++mechanicalabrasion+++ +++ oil aging +++ oxidation +++ fuel contamination ++++++carbonization+++lubricitydegradation+++ +++ sludge +++ harmful water in fuel +++ resin formation +++
oil s
yste
m.
GAT oil system products have a “CLEAN UP” and “KEEP CLEAN” effect. Contaminations aredissolvedandwiththatlong-termstabilityoftheengineoilsisassured.Formationofdepositsand re-contamination are avoided and wear and tear are reduced.
GAT SOLUTIONS:EnginePurifier 9Engine Care & Protect 9Engine Flush 10CeraGAT 500 TÜV approved 10Oil Booster 11 Engine Oil Stop Leak 11 NanoEngineSuperProtection 12Hydraulic Lifer Care & Protect 12
9oil system.
• approx. 15 minutes•beforeeveryoilchange
• 300 ml for 5 l oil • 60 ml for 1 l
all petrol and diesel engines
24 x 300 ml
Engine Purifier. Art. 62000
• dissolvesoperationallycausedcontaminationandresinformations in the complete oil system• neutralizesaggressiveresiduesfromthecombustionprocess• containshighlyeffectiveanti-frictionlubricants• considerablyimprovedandstablecompression• fuelandoilconsumptionaswellaswearand tear are reduced• less harmful exhaust emissions extend thelifespanofthecatalyticconverter
before
after
•worksduringoperation•aftereveryoilchange•easyapplicationwithoutanyextrawork
• 300 ml for 6 l oil• 50 ml for 1 l
all petrol and diesel engines
24 x 300 ml
Engine Care & Protect. Art. 62001
•highlyeffectiveadditivepackage•forincreasedwearandtearprotectionpropertiesofalltypesofengineoils•optimallubricationguaranteesminimumwearandtear• long life span of the engine and aggregates• reducesfrictionandpreventsfromwearandtear• increasestheoperationalreliabilityathightemperatures• protectsagainstoildilutioncausedbyfuelespeciallyincaseof frequent short distance travels
ECO-friendly
Product m
ovie on YouTube
10 oil system.
• approx. 15 minutes•beforeeveryoilchange
• 300 ml for 5 l oil• 60 ml for 1 l
all petrol and diesel engines
24 x 300 ml
Engine Flush. Art. 62054
•reliablydissolvesoperationallycausedcontaminationandresinformations inthecompleteoilsystemwhichcantheneasilyberemovedwiththe used oil during the oil change•neutralizesaggressiveresiduesfromthecombustionprocess•containspowerfulanti-frictionlubricantsthatreliablyprotectthe engine during the cleaning process•removeslastinglydepositsandresiduesintheuppercylinderareae.g. frompistonrings,annulargaps,hydraulicvalvelifterandvalvetrain•considerablyimprovedandstablecompressioninallcylinders•fuelandoilconsumptionaswellaswearandteararereduced• less harmful exhaust emissions •extendsthelifespanofthecatalyticconverter
•worksduringoperation•aftereveryoilchange•easyapplicationwithoutanyextrawork
• 300 ml for 6 l oil • 50 ml for 1 l
all petrol and diesel engines
24 x 300 ml
CeraGAT 500 - Engine oil additive. Art. 62002
•highperformanceadditive•reducedwearandtearduetothecreationofastablewearprotectionlayer• wear and tear resistant ceramic•improvedwearprotection•compatiblewithallmineralandsyntheticengineoils• less running noise and reduced exhaust gas emissions• increasedengineperformanceandoptimizedfuelconsumption
certificate. TÜVapprovedeffectiveness
Product m
ovie on YouTube
Product m
ovie on YouTube
11
•worksduringoperation•aftereveryoilchange•easyapplicationwithoutanyextrawork
• 300 ml for 5 l oil• 60 ml for 1 l
all petrol and diesel engines
24 x 300 ml
Oil Booster. Art. 62021
•highlyeffectiveadditivepackageforincreasedwearandtearprotection propertiesofalltypesofengineoils• reduces wear and tear• protects against corrosion• preventsfromdepositsintheoilandlubricationsystem• combatsharmfulengineacids• increasesreliabilityofoperationandprolongedlifespanofallcomponents• decreasedoilconsumptionandemissions• improved motor performance
•worksduringoperation• on demand
• 300 ml for 5 l oil• 50 ml for 1 l
all petrol and diesel engines
24 x 300 ml
Engine Oil Stop Leak. Art. 62077
• containsahighlyeffectiveadditivepackagetostoplossofengineoilcausedbyleakage• helpstoregenerateenginegasketsandkeepsthemsoftandsupple• reductionofoilloss• improvedreliabilityofoperation• increased engine performance• less wear and tear
12
•worksduringoperation•aftereveryoilchangeorwhenrequired
• 300 ml for 5 l oil • 60 ml for 1 l
all petrol and diesel engines
24 x 300 ml
Hydraulic Lifter Care & Protect. Art. 62042
•containsahighperformancepackageofeffectiveadditives• improvedhighpressurepropertiesaswellaswearandtearprotection• for all types of engine oils• disturbingrattlesoundswillbeeliminated• reductionofwearandtear• optimizedlubrication
•worksduringoperation•aftereveryoilchange•easyapplicationwithoutanyextrawork
• 300 ml for 5 l oil• 60 ml for 1 l
all petrol and diesel engines
24 x 300 ml
Nano Engine Super Protection. Art. 62103
• formsahighlyefficientNanoanti-frictionbarrierintheoil• isrecommendedforusewithturbos,catalyticconvertersandparticulatefilter• protects all the internal surfaces of engine and equipment e.g. oil systems, automaticandmanualgearboxes,differentials,transferboxes•keepstheo-ringsandshaftsealssoftandsupple• reduces wear and tear• protects against corrosion• preventsfromdepositsintheoilandlubricationsystem• combatsharmfulengineacids,increasesreliabilityofoperationand prolongedlifespanofallcomponents,decreasedoilconsumptionandemissions, improved motor performance
oil system.
Sludge and carbon depositsblock the U-rings. Oil controlrings stick together and cannotoperate reliably anymore.As a result oil enters into the combustion chamber and fuelinto the engine oil.
G AT o i l sy s t e m c l e a n i n g .
Afterthecleaningtheoilcontrolringsaresoftandsuppleandthecylinder wall is sealed again. An optimalcompressionisrestored.
14 petrol system.
CAUSE OF FAILURE +++oxidation+++aging+++resindeposits++++++carbonresidues+++waterinfuel+++alcohols++++++contamination+++combustionresidues+++fuelquality++++++operatingconditions+++varnishresidues+++
petr
ol sy
stem
.
GATpetrol systemproductsworkon the“CLEANUP”and“KEEPCLEAN”effect.Theyensurecleancombustion,absorbharmfulmoistureandtakecareofoptimalserviceperformanceduetohighlyefficientprotectionandlubricationcomponents.
GAT SOLUTIONS:
Petrol System Clean & Protect TÜV approved 15Petrol System Cleaner PLUS TÜV approved 15Octane Booster S 16Octane Booster TÜV approved 16Air Intake Cleaner Petrol 17Valve & Injector Purifier 17Petrol Applicator Spray 18
15
•worksduringoperation• add every 6 months or every 10.000 km•easyapplicationwithoutanyextrawork
• 300 ml for 60 l petrol •0,5%ofthefillingcontent
all petrol engines
24 x 300 ml
petrol system.
•worksduringoperation• every 6 months•easyapplicationwithoutanyextrawork
• 300 ml for 60 l petrol •0,5%ofthefillingcontent
all petrol engines
24 x 300 ml
Petrol System Clean & Protect. Art. 62003
•effectivecleaningoftheentirefuelsystemfromthetanktothecombustionchamber•displacesmoisture,removesoperationallycausedcontaminationandprevents formationofnewdeposits• reducesthefuelconsumption• optimizestheexhaustgasemissionvalues•protectsfromcorrosionandincreasestheoperationalreliability
certificate. TÜVapprovedeffectiveness
Petrol System Cleaner PLUS. Art. 62018
• removesoperationallycausedcontaminationintheentirefuelsystem fromthetanktothecombustionchamber• bindsmoistureandcondensedwater• dissolvesresinsandgumsinthecarburetorandinjection systemandremovescokingandunburnedcarbonresidues in the upper cylinder area• reducedfuelconsumption• improved engine performance and reduced exhaust emissions• considerablyprolongsthelifespanofthefuelsystem andcatalyticconvertercertificate. TÜVapprovedeffectiveness
with
out P
SC+
with
PSC
+
Product m
ovie on YouTube
16 petrol system.
•worksduringoperation•witheveryfilling•easyapplicationwithoutanyextrawork
• 300 ml for 45 l petrol • 100 ml for 15 l petrol
all petrol engines
24 x 300 ml
Octane Booster. Art. 62005
•toincreasetheoctanenumberoflowoctanefuelsorforusein engines with higher octane requirements up to 3-8 points• dissolves and disperses deposits and residues in petrol system• protects valve seats when running on unleaded petrol• improves start and full-load performance• provides smoother idling•ensuresstablecombustionprocessandanimprovedCO-value
certificate. TÜVapprovedeffectiveness
•worksduringoperation•witheveryfilling•easyapplicationwithoutanyextrawork
• 300 ml for 60 l petrol • 50 ml for 10 l petrol
all petrol engines
24 x 300 ml
Octane Booster S. Art. 62037
•toincreasetheoctanenumberoflowoctanefuelsorforuseinengines with higher octane requirements up to 3 points•removesdepositsonvalvesandinthecombustionchamber andavoidsrecontamination• protects valve seats when running on unleaded petrol• improves start and full-load performance• provides smoother idling•ensuresstablecombustionprocessandanimprovedCO-value•improvesengineperformanceandoperationalreliability
17petrol system.
• approx. 30 minutes• every 6 months
300mlfor1application
all petrol engines
24 x 300 ml
Air Intake Cleaner Petrol. Art. 62022
•forthecleaningoftheentireairintakesystemofpetrolengines•removesdepositsintheairintakesystem,combustionchamber,throttlevalves, inlet and outlet valves and valve seats•especiallyrecommendedforinsufficientthrottleresponseandcompression as well as engine knocking and dieseling•reducesfuelconsumptionandtheexhaustgasemissionvalues• ensures smooth idling
technical device. Only for use with the air intake cleaning device “GAT Stream“ and the appropriate adapters.
Product m
ovie on YouTube
•worksduringoperation• every 6 months•easyapplicationwithoutanyextrawork
• 300 ml for 60 l petrol •0,5%ofthefillingcontent
all petrol engines
24 x 300 ml
Valve & Injector Purifier. Art. 62004
•effectivecleaningofvalves,injectornozzlesandtheinletareawithoutdismantling•removesoperationallycausedcontaminationintheentirepetrolinjectionsystem• improves the engine performance•providesapowerfulandstablecombustionprocess•reducesthefuelconsumptionandoptimizes the exhaust gas emission values•considerablyprolongsthelifespanoftheengine• ensures smooth engine running
Product m
ovie on YouTube
18
• approx. 15 minutes• recommended for each service interval or as needed
dependingonapplication
all petrol engines
24 x 400 ml
Petrol Applicator Spray. Art. 62036
•forcleaningandprotectionoftheentireairintakesystemofpetrolengines•removescontaminationandresindepositsintheairintakesystem, combustionchamber,Venturitubethrottlevalves,inletand outlet valves and valve seats• without dismantling of any system parts•reducesfuelconsumptionandtheexhaustgasemissionvalues• ensures smooth idling and powerful and even motor running
G AT f u e l sy s t e m c l e a n i n g .
19
with
out P
LUS
prod
uct
with
PLU
S pr
oduc
t
Engine knockingCorrosionandcontaminationofvalves which do not seal properly
Spark plug burnedpoorfuelquality,combustionresiduesinthecombustionchamber
Removes deposits in the entire fuel system
binds water in the fuel tank
before after before after
20 petrol. & diesel.
Only a clean fuel system guarantees clean and powerful combustion and efficient engineperformance! Easy application without any extra effort. Reduces the fuel consumption and optimizestheexhaustgasemissionvalues.
GAT SOLUTION:
CAT Clean 21
dies
el.
petr
ol. &
21petrol. & diesel.
•worksduringoperation•addevery3monthstothefueltankbeforefillingup•easyapplicationwithoutanyextrawork
• 300 ml for 60 - 80 l fuel •0,5%ofthefillingcontent
• petrol,dieselandhybridengines• ideal for 4-stroke engines
24 x 300 ml
CAT Clean - Catalytic Converter & Oxygen Sensor Cleaner. Art. 62073
•newdecarbonizingtechnology• specially developed to exceed the latest environmental standards•dissolvesresin,gumandcarbondepositsintheentirefuelsystem oxygensensor/lambdaprobeandcatalyticconverter•regularusehelpstopreventheavycontamination•increasesfuelefficiency•optimizedengineperformance•ensurestheproperfunctionofthecatalyticconverter/oxygensensor
Emission measurementHyundai Accent 2007
beforeapplication afterapplication
22 diesel system.
CAUSE OF FAILURE +++aging+++oxidation+++carbonresidues++++++resindeposits+++contamination+++microorganisms++++++bacteria+++temperaturedifferences+++varnishresidues++++++combustionresidues+++fuelquality+++
dies
el sy
stem
.
GATdieselsystemproductscleantheentirefuelsystemfromthetankuptothecombustionchambersandrestorefullengineperformancebyprovidingforacleancombustionprocess.Highlyefficientlubricatingagentsprotectvalvesandothersystemparts.
GAT SOLUTIONS:
Diesel System Clean & Protect TÜV approved 23Diesel System Cleaner PLUS TÜV approved 23Air Intake Cleaner Diesel 24Diesel Applicator Spray 24Diesel Bactericide 1:1000 25Diesel Winter Care 1:1000 25 Cetane Booster 26Diesel Anti Smoke 26DPF Purifier 27 DPF Cleaning Liquid 27DPF Air Jet Fluid 28DPF Air Jet compressed-air pistole 28DPF & Catalyst Cleaning Foam 29
23diesel system.
•worksduringoperation•addevery6monthstothefueltankbeforefillingup•easyapplicationwithoutanyextrawork
• 300 ml for 60 l diesel •0,5%ofthefillingcontent
all diesel engines (e.g.commonrailorpumpinjectors)
24 x 300 ml
Diesel System Clean & Protect. Art. 62006
•improvedengineperformanceandfuelconsumption•increasedoperationalreliability•depositsandresiduesofcarbonoilandsootareproperlydissolvedanddispersed•ensureslastinglubricationespeciallyforlow-sulphurdieselfuels•reliablyremovesoperationallycausedcontaminationinthe wholefuelsystemfromthetanktothecombustionchamber•avoidsformationofdepositsintheinjectionsystem
certificate. TÜVapprovedeffectiveness
•worksduringoperation•addevery6monthstothefueltankbeforefillingup•easyapplicationwithoutanyextrawork
• 300 ml for 80 l diesel• 70ml per 10 l
all diesel engines (e.g.commonrailorpumpinjectors)
24 x 300 ml
Diesel System Cleaner PLUS. Art. 62019
• reliablyremovesoperationallycausedcontaminationinthewholefuelsystem fromthetanktothecombustionchamber• absorbsandefficientlyremovesmoisturefromthedieselsystem•ensureseffectiveprotectionofthehighpressurepump•providesanoptimalfuelatomization•lubricationandprotectionofallfuelcarryingparts• increased compression• improved engine performance•reducedfuelconsumptionandlessexhaustemissions• especially recommended for extended service intervalscertificate. TÜVapprovedeffectiveness
with
out D
SC+
with
DSC
+
Product m
ovie on YouTube
24
dependingonapplication
all diesel engines(alsowithDPFfilters)
24 x 400 ml
Air Intake Cleaner Diesel. Art. 62034
• cleaningandprotectionoftheentireairintakesystem• removesdepositsintheairintakesystem,combustionchamber, throttlevalves,inletandoutletvalvesandvalveseats• reducesthefuelconsumptionandtheexhaustgasemissionvalues• ensures smooth, powerful and even motor running
technical device. Only for use with the air intake cleaning device “GAT Stream“ and the appropriate adapters.
Diesel Applicator Spray. Art. 62035
• cleaningandprotectionoftheentireairintakesystem• removesdepositsintheairintakesystem,combustionchamber, throttlevalves,inletandoutletvalvesandvalveseats• reducesthefuelconsumptionandtheexhaustgasemissionvalues• ensures smooth, powerful and even motor running
diesel system.
• approx. 30 minutes• every 6 months
300mlfor1application
all diesel engines (e.g.commonrailorpumpinjectors)
24 x 300 ml
• approx. 15 minutes• recommended for each service interval or as needed
25diesel system.
•worksduringoperation• every 4 - 6 months•easyapplicationwithoutanyextrawork
• 150 ml for 150 L diesel• concentrate 1:1000
all diesel engines
24 x 150 ml
Diesel Bactericide 1:1000. Art. 62007
• high-performanceconcentratewithawideactionspectrum• forpreventiveuseagainstbacteria,fungiandyeasts• supportsoptimaloperationofallsystemcomponents• forcleanandpowerfulcombustionandefficientengineperformance• preventivelydisinfectsthecompletedieselsystem• existinggermsarequicklyeliminated• regularusehelpstopreventnewbacterialgrowth
•worksduringoperation• apply on demand•easyapplicationwithoutanyextrawork
• 150 ml for 150 L diesel• concentrate 1:1000
all diesel systems and diesel storage tanks
24 x 150 ml
Diesel Winter Care 1:1000. Art. 62008
• ensuresimprovedflowpropertiesofalldieselfuels• winter safe down to -28°C• reliablypreventsfromformationofparaffincrystalsatlowtemperatures• ensuresoptimaloperationofallsystemcomponentsandsafedrivingconditions• improvesthefilterabilityofthedieselfuel• preventsblockingofthefuelfilter• ensuresimprovedcoldstartpropertiesinthewinterperiod
•worksduringoperation• use on demand•easyapplicationwithoutanyextrawork
• 150 ml for 80 l Diesel• 50 ml for 25 l
all diesel engines (e.g.commonrailorpumpinjectors)
24 x 150 ml
Cetane Booster. Art. 62033
• forimprovedcombustibilityofthefuel•increasesthecetanenumberofthedieselfuelbyupto5points• especially recommended for lower quality fuels•forpowerfulandcleancombustionandimprovedengineperformance• less exhaust gas and soot emissions•improvedcoldstartingpropertiesandsmootherenginerunning•reducesfuelconsumption
•worksduringoperation•addbeforeeveryfillingofthefueltank
• 150 ml for 80 l Diesel• 50 ml for 25 l
all diesel engines (e.g.commonrailorpumpinjectors)
24 x 150 ml
Diesel Anti Smoke. Art. 62094
•eliminatesdisturbingnoisesindieselenginesandreducescarbonformation• ensurescleancombustion• providesoptimumlubricationofallmovingpartsinthedieselsystem• protectsreliablyagainstcorrosion• reducedformationofsoot
26 diesel system.
27diesel system.
•worksduringoperation•addtothefueltankbeforefillingupapprox.every5000km•easyapplicationwithoutanyextrawork
• 300 ml for 60 L diesel•0,5%ofthefillingcontent
alldieselparticulatefilters
24 x 300 ml
DPF Purifier. Art. 62009
• high-performanceadditivetoreducesootformation• reductionofexhaustgasemissions• increased engine performance• compatiblewithalldieselengines• foroptimaloperationofallsystemcomponentsandefficientengineperformance• supportstheregenerationofthedieselparticulatefilter• improvesthestoragestabilityofthedieselfuel• increasedcoldstartproperties
•reactiontimeapprox.8-10hours• on demand
•dependingonfiltersize 3-5 L
alldieselparticulatefilters
12 x 1000 ml
DPF Cleaning Liquid. Art. 62010
• highlyefficientcleaningcombination• forcleaningofdismantleddieselparticulatefilters• dissolvescontaminationinthedieselparticulatefilterand regeneratesitsfullfunctionality• forcleancombustionandefficientengineperformance• minimizesexhaustemissions• clearcostbenefitcomparedtoinstallationofanewdieselparticulatefilter
Product m
ovie on YouTube
28
•worksduringoperation•recommendedforpreventiveuse
min. 500 ml
alldieselparticulatefilters
1 Piece
DPF Air Jet Fluid. Art. 62030
• for use with compressed-air pistole• dissolvescontaminationintheDPFandregeneratesitsfunctionality• highlyefficientcleaningfluid• dissolvesalloperationallycausedresiduesandcontamination• readilybiodegradable• providesaclearcostbenefitcomparedtoinstallationofanewdieselparticulatefilter
technical device. bestresultswithGATAir-Jetcompressed-airpistole
DPF Air Jet compressed-air pistole. Art. 62901
•Noneedtodismantlethedieselparticulatefilter• easy to use•quickandeffectiveapplicationwithoutlongexposuretime • gentle cleaning process•incl.detailedinstructionmanual
diesel system.
• for use with compressed-air pistole
• approx. 500 ml per cleaning• depending on the degree ofcontamination
alldieselparticulatefilters
12 x 1000 ml
Product m
ovie on YouTube
Product m
ovie on YouTube
G AT DPF S ta r te r-K i t .
content.1 x GAT DPF Air Jet - compressed air gun2 x GAT DPF Air Jet Fluid2xGATDPFPurifier
Art. 62950
Product m
ovie on YouTube
• approx. 15 minutes•ondemandorwitheachserviceaspreventiveuse
400mlfor1application
alldieselparticulatefilters
12 x 400 ml
DPF & Catalyst Cleaning Foam. Art. 62099
• effectivecleanerforfastandefficientcleaningofthedieselparticulatefilterand catalyst of passenger cars without dismantling• impuritiesinthedieselparticulatefilteraredissolvedquicklyespeciallyvehiclesdriving shortdistancesareoftenconcernedbycloggedparticulatefilters(citydriving)• preventiveuseoftheproductwitheachservicecanhelptoavoidfutureproblemswiththe particulatefilterandwillthereforesignificantlyreduceoperatingcost• dissolvessootindieselparticulatefilter,catalystandEGR-valves• reducesoperatingcostsandensuresoptimumengineperformanceandlowerfuelconsumption
30 LPG system.
LPG
syst
em.
Only a clean fuel system guarantees clean and powerful combustion and efficient engineperformance!Optimizesthefuelconsumptionandexhaustgasemissionvalues.Improvestheoperationalliabilityandincreasesthelifespanoftheengine.Protectsagainstvalveimpact.
GAT SOLUTIONS:
LPG Petrol System Cleaner 31LPG System Clean & Protect 31LPG Valve Protect 32
CAUSE OF FAILURE +++oxidation+++aging+++resindeposits++++++carbonresidues+++waterinfuel+++alcohols++++++contamination+++combustionresidues+++fuelquality++++++operatingconditions+++varnishresidues+++
31
•worksduringoperation•addwiththesuitableadapterevery3-4monthsorevery10.000km tothegastankbeforefillingup
• 120 ml for 50 L fuel• 60 ml per 25 L
allbivalent(LPG/petrol)systems
24 x 120 ml
LPG system.
•worksduringoperation•addevery3monthstothefueltankbeforefillingup•easyapplicationwithoutanyextrawork
• 300 ml for 60 L petrol•0,5%ofthefillingcontent
allbivalent(LPG/petrol)systems
24 x 300 ml
LPG Petrol System Cleaner. Art. 62038
• high-performanceproductforliquefiedpetroleumgas(LPG)poweredengines• removesalloperationallycausedcontaminationintheentirecombustionsystem• highlyeffectivelubricatingcomponents• protects valves against wear, tear and corrosion• optimizesthefuelconsumptionandexhaustgasemissionvalues• improvestheoperationalliability• increases the life span of the engine• protects against valve impact
LPG System Clean & Protect. Art. 62040
• high-performance product• protects the complete gas system against corrosion• ensuresoptimalprotectionagainstvalveimpact• absorbsharmfulmoisture• effectivelypreventstheformationofcombustionresidues• long-termprotectionofvalvesandvaleseats• optimizedfuelconsumptionandreducedexhaustgasemission• extends the life span of the engine
32
•worksduringoperation•Attention:strictlyfollowthecorrespondinginstructions of the manufacturer!
• 50 ml for 50 L fuel• 25 ml per 25 L
Foruseincommerciallyavailableautomaticdispensersforbivalentvehicles(gas/petrolpowered).
12 x 1000 ml
LPG Valve Protect. Art. 62039
• highlyefficientfueladditive• considerablyreduceswearandtearofvalvesandvalveseats• reliablyandlastinglyremovesevensmallestparticlesof contaminationintheentirecombustionsystem• long-termprotection• permanentlubricationofvalves• optimizedfuelconsumptionandreducedexhaustgasemission• protects against valve impact• extends the life span of the engine
3333
G AT v e r t i s i n g .
Weoffertoourcustomersanextensivemarketingsupport.
•multilinguallabelsandadvertisingmaterials• merchandising / POS• giveaways•customizedprintingmaterials
Scan the codeand see the catalogue
34 cooling system.
cool
ing
syst
em.
GAT radiator products provide for clean systems and protect against corrosion. The long-termfunctionality of the system fluids is ensured.
GAT SOLUTIONS:
Radiator Purifier 35Radiator Sealant 35
CAUSE OF FAILURE +++ deposits +++ flow +++ +++ heating performance +++ leakage +++ corrosion +++ +++ cooling performance +++ oil contamination
35cooling system.
• approx. 30 minutes• with every change of the coolant
• 300 ml for up to 10 L• 30 ml for 1 L coolant
all cooling systems
24 x 300 ml
Radiator Purifier. Art. 62012
• containsquick-reactingcomponentsforremovalofoperationally causedcontaminationintheentirecoolingcircuit• dissolves and removes scale• improves the performance of valves, thermostats and water pumps• fortheoperationalliabilityofengines• improvedheatingandcoolingperformance• extends the life span of all aggregates
Radiator Sealant. Art. 62011
• reliablysealscriticalhairlinecracksandsmallleaks• alsoforpreventiveusage• fortheoperationalliabilityofengines• avoids expensive repair works• prevents from loss of cooling liquid• protects against engine damage
• approx. 10 minutes• on demand
• 300 ml for up to 12 L• 25 ml for 1 L coolant
all cooling systems
24 x 300 ml
Product m
ovie on YouTube
Product m
ovie on YouTube
36 air condition.
air c
ondi
tion.
GATairconditioningproductsensureanhealthyroomclimate,eliminatefungus,bacteriaandunpleasant odours and clean the inner and outer A/C system parts.
GAT SOLUTIONS:
AirCon Cleaner 37AirCon Refresher Spring 37AirCon Refresher Summer 38Fresh´nAIR Fluid 38Fresh´nAIR Device 39
CAUSE OF FAILURE +++ microorganisms +++ +++badodours+++healthrisks+++ +++ allergenes +++ corrosion +++
37
CAUSE OF FAILURE +++ microorganisms +++ +++badodours+++healthrisks+++ +++ allergenes +++ corrosion +++
allair-conditioningsystems
• approx. 2 minutes• every 6 months
•150mlfor1application
allair-conditioningsystems
12 x 150 ml
air condition.
• approx. 15 minutes• every 6 months
•400mlfor1-2applications 12 x 400 ml
AirCon Cleaner. Art. 62013
•forprofessionalandefficientcleaninganddisinfectionofair-conditioningsystems•killsmicroorganismssuchasbacteriasandfungiquickly• provides clean and fresh air•simpleapplication• gives a pleasant and fresh odour in the vehicle interior•noneedfordismantlingoftheair-conditioningsystem
AirCon Refresher Spring. Art. 62014
• cleans and disinfects A/C systems and the interior of the vehicle• eliminates unpleasant odours• killseffectivelybacteriaandothermicroorganisms• provides clean and fresh air• gives a pleasant “Spring“ odour to the vehicle interior
Product m
ovie on YouTube
38 air condition.
• approx. 15 minutes• every 6 months
•125mlfor1application
allair-conditioningsystems
24 x 250 ml
Fresh´nAIR Fluid. Art. 62032
• freshens the air of the complete vehicle interior• eliminates malodors• provideslong-lastingfreshandhealthycarcabinclimate• disinfictsthevehicleinterior• applicationinallcommerciallyavailablenebulizerdevices
technical devices. bestresultswithGATFresh´nAIRmachine(Art.62900)
• approx. 2 minutes• every 6 months
•150mlfor1application
allair-conditioningsystems
12 x 150 ml
AirCon Refresher Summer. Art. 62085
• cleansanddisinfectsairconditionandtheinteriorofthevehicle• eliminates unpleasant odours• killseffectivelybacteriaandothermicroorganisms• provides clean and fresh air• gives a pleasant “Summer“ odour to the vehicle interior
39
• approx. 15 minutes• every 6 months
-
allair-conditioningsystems
1 Piece
Fresh´nAIR Device. Art. 62900
• electronicultrasonicdeviceforatomizing• liquidisdistributedoverthecirculationsystemoftheA/C-sytem• dropletsdonotsticktothesurfaceandwiththatarecompletely spreadintheentireA/Candtheventilationsystemofthevehicle •incl.detailedinstructionmanual
Scan the code and go directly to the manual
40 sealant.
seal
ant.
The GAT Nano Sealants protect surfaces from contamination, are water-repellent and UV-resistant.Dirtandresiduescanberemovedquicklyandeasily.GATNanoSealantsareresistantto mechanical or chemical influences and have a long-term effect.
GAT PRODUCTS:
Nano Car Glass Sealant 41
41
all glass surfaces
sealant.
• approx. 30 minutes• every 12 months or 10.000 km
•suitablefor1car(wind-screen,headlights,mirrors) 1 Set
Nano Car Glass Sealant. Art. 62951
• 1 set contains: 75 ml cleaning milk 2 x 15 ml sealant components 3 polishing clothes•easyapplicationforbestresults•withlong-termprotectionagainstdirtandinsects•water-repellentwithlotuseffect•increasedsafetythroughoptimizedvisibility at night and in the rain
Smoothens the surface andsealsfinestpores
Reducesreflectionandimprovesvisibilityduringrainandatnight.
Watersimplyrunsoff,dirtandinsectresiduesdonotsticktothesurfaceandicecanberemovedeasily.
42 gear box & power steering.
gear
box
&
p
ower
stee
ring.
GAT gear products reduce friction, actively protect against foaming and oxidation and protect all system parts with the help of high-performance additives.
GAT SOLUTIONS:
Automatic Transmission Cleaner 43Automatic Transmission Care & Protect 43Automatic Transmission Cleaning Device 44Power Steering Care & Protect 44
CAUSE OF FAILURE +++abrasion+++ +++ aging +++ oxidation +++ wear and tear +++ +++ noise generation +++
CAUSE OF FAILURE +++abrasion+++ +++ aging +++ oxidation +++ wear and tear +++ +++ noise generation +++
43gear box & power steering.
• approx. 15 minutes•beforeeveryexchangingofthetransmissionfluid
• 300 ml for up to 8 L•40mlfor1Ltransmissionfluid
allautomaticgearboxes
24 x 300 ml
Automatic Transmission Cleaner. Art. 62023
• highperformancecleanerforautomaticgearboxes• removesoperationallycausedcontaminationanddeposits• protects from corrosion and early wear• ensuressoftshiftingwithdirectresponse• for smooth engine running
technical device. Forbestresultswerecommendapplicationwiththe “AutomaticTransmissionCleaningDevice“(page44)
Automatic Transmission Care & Protect. Art. 62024
• maintains the performance of transmission gear systems• ensuressoftshifting• fordirectresponseandpromptacceleration• supportsthecleaningeffectofthetransmissionfluid• protects from corrosion and early wear• ensures smooth engine running
technical device. Forbestresultswerecommendapplicationwiththe “AutomaticTransmissionCleaningDevice“(page44)
•worksduringoperation•aftereveryexchangingofthetransmissionfluid
• 300 ml for up to 5 L•60mlfor1Ltransmissionfluid
allautomaticgearboxes
24 x 300 ml
44
Power Steering Care & Protect. Art. 62031
• protects all parts of the power steering system from wear, tear and rust• protectsfromoxidationandfoamformation• noise-reducingeffect• guaranteessafeandsmoothoperation
•worksduringoperation•aftereverychangeofpowersteeringoil
• 100 ml for 2 L• 50 ml for 1 L
powersteeringanddifferentialgearboxes
24 x 100 ml
Automatic Transmission Cleaning Device. • cleaningoftheentireautomatictransmissionsystem• easy, quick and complete change of the gear oil• manyautomaticfunctions• LCD display and individual design for easy use• multilingual• fillingandcleaningofautomatictransmissions• oil temperature gauge and monitoring of the oil pressure • intelligentregulationandcontrolofoilchange• special adapters for cars from: Europe, America and AsiaExclusivedistributionbyGATItalias.r.l.
Products. WerecommenduseofGAT“ATFproducts“(page43)
•exchangeintervalaccordingtomanufacturerspecifications•applicationifnecessary
-
allautomaticgearboxes
1 Piece
gear box & power steering.
ü Cleaning and maintenance of the entire transmission system: easily and quickly with just one deviceü Oil exchange and level adjustmentü Print out the procedure and the vehicle dataü Monitoring of oil temperatureü Monitoring of oil pressureü Emptyfluidtankwithoutdisassembling
GAT ITALIA S.R.L. offerstheofferstheLAUNCHAutomaticTransmissionCleaningDeviceexclusively for the Italian Market
AT F c l e a n i n g .
45
TheonlyofficialLAUNCHdistributorthatguaranteestechnical assistance for CAT-501+ providing spare parts when needed.
service products.
serv
ice
prod
ucts
.
Effective combination of active substances for quick and easy application. The GAT serviceproductsareparticularlysuitableforrepairs,installationandmaintenanceworksforvehiclesand industrial applications.
GAT SOLUTIONS:
Brake Cleaner Spray 47Brake Cleaner Liquid 47Throttle Body Cleaner 48MultiLube 48Penetrate Spray 49Silicone Spray 49MoS2 Rust Remover 50Electrical Contact Cleaner 50Silicone Sealing Compound 51
46
CAUSE OF FAILURE +++ aging +++ oxidation +++ corrosion ++++++deposits+++abrasion+++residues+++
47service products.
-
dependingonapplication
universal
12 x 500 ml
Brake Cleaner. Art. 62015
• acetone-free• basedonaspecialtypeofwhitespirits• forquickandeasycleaningofdrumandwheeldiscbrakes, clutchparts,brakeliningsandblocks• removes oil, dirt and greasy deposits• for cleaning of heavily contaminated machine parts• freeofCFC,HFCaswellasofanycorrosivesubstances• evaporates residue-free
-
dependingonapplication
universal
1 x 5000 ml
Brake Cleaner. Art. 62027
• acetone-free• basedonaspecialtypeofwhitespirits•forquickandeasycleaningofdrumandwheeldiscbrakes, clutchparts,brakeliningsandblocks • removes oil, dirt and greasy deposits • for cleaning of heavily contaminated machine parts•freeofCFC,HFCaswellasofanycorrosivesubstances • evaporates residue-free
-
dependingonapplication
universal
12 x 500 ml
Throttle Body Cleaner. Art. 62016
• specialcompositionofcleaningagents• alsosuitableforexternalandinternalcleaningofcarburetors• forrepair,assemblyandroutinemaintenanceworks• quickremovalofoperationallycauseddeposits(fuel,oil,grease)intheinletarea, atthethrottlebodyandidlingcontrolvalveswithoutdismantling• lubricationofthecleanedparts• regularcleaningimprovestheenginestartingpropertiesandreduces thefuelconsumption
service products.48
-
dependingonapplication
universal
12 x 400 ml
Multi Lube. Art. 62017
• highlyactivecomponentsforreductionoffriction,wearandtear• water-repellent and displaces moisture• helps to loosen corroded metal parts• lubricatesandeliminatessqueakingnoises• protects against rust and corrosion• reducedtimeandeffortformounting/demounting• perfectlysuitableforlong-termuse• extends the life span of the system components
-
dependingonapplication
universal
12 x 400 ml
Penetrate Spray. Art. 62086
•throughhigh-intensitycomponentsaquickeffectisachievedparticularly for corroded metal compounds•eventhesmallestcracksandgapsarereachedduetoahighcapillaryeffectandexcellent creepingproperties• lubricatesandpreventsfromrenewedrustingbycorrosion-repellentcomponents• excellent removal support for rusted metal compounds• protectsagainstcorrosionandoxidation,therebypreventingseizureofthreadedconnections• suitabletofacilitateasanaidintheassemblyofpartstothesubsequentdismantling• treats squeaking and creaking sounds
-
dependingonapplication
universal
12 x 400 ml
Silicone Spray. Art. 62087
• especially developed product, oil and fat free• protective,lubricating,partingandcareagentforplastic,wood, rubberaswellasmetalparts• spotfreeandinvisiblelubrication• offersexcellentheatresistance• verygoodadhesionproperties• water-repellent• anti-static• protectsagainstoxidationandcorrosion
49service products.
-
dependingonapplication
universal
12 x 500 ml
MoS2 Rust Remover. Art. 62095
• containsselectedrawmaterialsforfastandeffectiveresultsatcorrodedmetalcompounds• highcapillaryeffectandgoodcreepingpropertiesensurethateventhesmallest crackscanbereached• anti-corrosionadditivesprovidelong-termprotectionofthemetalparts• perfectlysuitableaslubricant• disassemblyaidforrustedmetalcompounds• loosenscorrodedconnectionssuchasnutsandbolts• infiltratesandpenetratesrust• permanentlubricationofscrewconnections,guidesandalltypesofslidingsurfaces
-
dependingonapplication
universal
12 x 400 ml
Electrical Contact Cleaner. Art. 62088
• specially developed product for cleaning of electrical terminals, switching and plugcontactsandotherelectricalconnections• takes care of thorough cleaning of terminals • controlsoxidationatthevariouscontactpoints• improved contactness• reductionofreoxidationandpollution• reduces the voltage drop and removes oil and grease permanently• removeheavydirtfromthepartstobetreated• stronglyoxidizedcontactsshouldbecleanedmechanically
service products.50
-
dependingonapplication
engineandbodyconstruction,heatingandplumbing,airconditioningetc.
12 x 200 ml
Silicone Sealing Compound. black Art. 62096 grey Art. 62097
• one component• permanentlyelasticsiliconesealbasedonpolysiloxaneforuseinareasofhightemperature• readytousealternativetoconventionalsolidgasket.• sealsmetalparts(aluminum,castiron,steel,etc.),plastics,glass,ceramicsandwood, oilpans,valvecovers,waterandoilpumps,timingcoverandgear,differentialseals, batteryboxes,headlights,taillights,casings,thermostat,transmissionoilpans,gearbox, driveshaftandaxlecovers,etc.• seals permanently even large gaps• no loss of clamping• UV-resistant• climate resistant• resistanttowater,saltwater,oil,grease,detergent,hydrocarbons,etc.
• theoreticalbasictraining• productpresentation• sales training• practicaltrainingatthevehicle
Ourcustomersandprospectbusinesspartnerscanbenefitfromtheknow-howoftheGATAcadamyin our training centers in Germany and Sweden. Experiencedtrainersteachimportantbasicsforthe successful sale and are ready to assistforanyquestions.
52
“made in germany“. We have pointedly taken the decision to establish our R&D and production sitein Germany. In the automotive branch aswell as in the chemical industry Germany is worldwide leading. Excellent know-how, strict government controlled rules and regulations as well as highly motivated employees ensure our products’ quality.
world wide web. Within the scope of globalization we arepresent at international exhibitions andsymposiums. We source raw materials and know-howworld-wideviaourtransnationalnetwork.
business concepts. Threedifferentbusinessconceptsofferourpartnerstheirindividualchancetobecomepartof the internationalGATcommunityandwiththattoactivelycreateourcommonprospectivebusinesscooperation.
MADE IN GERMANY
53
area distributors. Our self-employed Area Distributors areresponsible for distribution of our GATpremium products in their individual sales area.This business concept is the perfect solutionto integrateourGATproducts intoanexistingsales structure.
general importers. Thisbusinessconceptgives theopportunitytoexclusivelydistributeourGATpremiumbrandin a defined sales area. The resulting UniqueSelling Proposition (USP) allows the exclusiveand independent development of the market with our proven GAT premium products.
joint venture. The establishment of a Joint Venture offersour partners to profit from the completeknowhowoftheGATcorporationandwiththattobenefitfromdifferentlevelsoftheGATvaluechain. Our JV partners have the clear advantage oftheircloseconnectiontotheGATGermany.
own brand. Our complete company structure - from the in-housemarketing department through to themanufacturing - ensures premium service also forestablishedbrands.Asabottlingpartnerweproduceyourproductandoffersupportfromthedesignofthelabelstotheready-to-sellproducts.
54
contract research. Our team of scientists and technicians develops products according to our customers’ individually desired properties and parameters. We support our customers intheprocesstogettheproductscertifiedbyrecognized institutions like TÜV or researchprojects. Our core competences are system cleaners and additives for the automotive branch.We are also contact partner for chemical and technical development of products
beyond these matters, as we appreciateany challenge. We support our customers in developing solutions from the initial product idea up to individual marketing strategies.
55
product development. With our longtimemarket experience andscientific know-how we ensure a continuousproduct development process. Our focus is set on the improvement in fossil fuel efficiencyby innovative high-performance additives.Reduced fuel consumption, lower exhaustemissions and an increased endurance of the system components are the result of these developments.
research projects. We are participating in research projectsand profit from a network of universities,industry-related research institutes andGovernment Controlled Standards Institutes.We are fully aware that the development of innovationsrequiresnewandunconventionalthinking. We are also enthusiastic aboutcompletelynew ideasbeyondourusualfieldofactivities.
www.facebook.com/gat.germany
GAT - GesellschaftforKraftstoff-und AutomobiltechnologiembH&Co.KGAlt Saale 2 l D-07407Uhlstädt-KirchhaselPhone:+49(0)3672-8244666Fax: +49(0)3672-8244622eMail: info@gat-international.deweb: www.gat-international.de
top related