Dynamic Programming Part III: Global sequence alignment …€¦ · Dynamic Programming Part III: Global sequence alignment & Scoring matrices Bioinfo I (Institut Pasteur de Montevideo)
Post on 23-Jul-2020
29 Views
Preview:
Transcript
Dynamic ProgrammingPart III:
Global sequence alignment&
Scoring matrices
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 1 / 69
Outline
Global Sequence alignmentScoring matricesLocal Sequence alignment
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 2 / 69
From LCS to Alignment: Change up the Scoring
The Longest Common Subsequence (LCS) problem-the simplest formof sequence alignment - allows only insertions and deletions (nomismatches).In the LCS Problem, we scored 1 for matches and 0 for indelsConsider penalizing indels and mismatches with negative scoresSimplest scoring schema:
I +1 : match premiumI -µ : mismatch penaltyI -σ : indel penalty
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 3 / 69
Simple Scoring
When mismatches are penalized by -µ, indels are penalized by -σ, andmatches are rewarded with +1, the resulting score is:
#matches− µ(#mismatches)− σ(#indels)
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 4 / 69
The Global Alignment Problem
Goal: Find the best alignment between two sequences (strings) under agiven scoring schemaInput : Sequences (strings) v and w and a scoring schemaOutput : Alignment of maximum score
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 5 / 69
Global alignment: Needleman-Wunsch algorithm
The Needleman-Wunsch algorithm1 is a dynamic program that solves theproblem of obtaining the best global alignment of two sequences.Idea: Build up an optimal alignment using previous solutions for optimalalignments of smaller substrings.Given two sequences X = (x1, x2, . . . , xn) and Y = (y1, y2, . . . , ym). Wewill compute a matrix
F : {1, 2, . . . , n} × {1, 2, . . . ,m} → R
in which F (i , j) equals the best score of the alignment of the two prefixes(x1, x2, . . . , xi ) and (y1, y2, . . . , yj).
1Saul Needleman and Christian Wunsch (1970), improved by Peter Sellers(1974).
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 6 / 69
Needleman-Wunsch algorithmThis will be done recursively by setting F (0, 0) = 0 and then computingF (i , j) from F (i − 1, j − 1), F (i − 1, j) and F (i , j − 1):
0 x1 x2 . . . xi−1 xi . . . xn
0 F (0, 0) |y1 |y2 |
|. . . |yj−1 F (i − 1, j − 1) F (i , j − 1)
↘ ↓yj − − − − F (i − 1, j) → F (i , j)
. . .
ym
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 7 / 69
The Global Alignment Problem
We obtain F (i , j) as the largest score arising from these three options:
F (i , j) := max
F (i − 1, j − 1) + s(xi , yj)F (i − 1, j − 1)− µF (i − 1, j)− σF (i , j − 1)− σ.
This is applied repeatedly until the whole matrix F (i , j) is filled with values.
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 8 / 69
The recursion
To complete the description of the recursion, we need to set the values ofF (i , 0) and F (0, j) for i 6= 0 and j 6= 0:
We set F (i , 0) = for i = 0, 1, . . . , n andwe set F (0, j) = for j = 0, 1, . . . ,m.
The final value F (n,m) contains the score of the best global alignmentbetween X and Y .To obtain an alignment corresponding to this score, we must find the pathof choices that the recursion made to obtain the score using traceback.
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 9 / 69
Example of a global alignment matrix
Needleman-Wunsch matrix of the sequences GATTAG and ATTAC, scoringvalues s(a, a) = 1, s(a, b) = −1 and a linear gap cost of σ = −2:
F 0 G A T T A G0 0ATTAC
Score: ; Alignment:
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 10 / 69
Example of a global alignment matrix
Needleman-Wunsch matrix of the sequences GATTAG and ATTAC, scoringvalues s(a, a) = 1, s(a, b) = −1 and a linear gap cost of σ = −2:
D 0 G A T T A G0 0 -2 -4 -6 -8 -10 -12A -2 -1 -1 -3 -5 -7 -9T -4 -3 -2 0 -2 -4 -6T -6 -5 -4 -1 1 -1 -3A -8 -7 -4 -3 0 2 0C -10 -9 -6 -5 -2 0 1
Score:1; AlignmentG A T T A G- A T T A C
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 11 / 69
Pseudo code of Needleman-Wunsch algorithm
Input: two sequences X and YOutput: optimal alignment and score αInitialization: Set F (i , 0) := −i · σ for all i = 0, 1, 2, . . . , nSet F (0, j) := −j · σ for all j = 0, 1, 2, . . . ,mFor i = 1, 2, . . . , n do:
For j = 1, 2, . . . ,m do:
Set F (i , j) := max
F (i − 1, j − 1) + s(xi , yj )F (i − 1, j)− σF (i , j − 1)− σ
Set backtrace T (i , j) to the maximizing pair (i ′, j ′)The best score is α := F (n,m)Set (i , j) := (n,m)
repeatif T (i , j) = (i − 1, j − 1) print
(xi−1yj−1
)else if T (i , j) = (i − 1, j) print
(xi−1−
)else print
( −yj−1
)Set (i , j) := T (i , j)
until (i , j) = (0, 0).
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 12 / 69
Complexity
Complexity of the Needleman-Wunsch algorithm:We need to store (n + 1)× (m + 1) numbers. Each number takes aconstant number of calculations to compute: three sums and a max.Hence, the algorithm requires O(nm) time and memory.
Something to think about: if we are only interested in the best score, but not theactual alignment, then it is easy to reduce the space requirement to linear.
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 13 / 69
Scoring Matrices
To generalize scoring, consider a (4 + 1)× (4 + 1) scoring matrix δIn the case of an amino acid sequence alignment, the scoring matrix wouldbe a (20 + 1)× (20 + 1) size.The addition of 1 is to include the score for comparison of a gap character“-".This will simplify the algorithm as follows:
si ,j = max
si−1,j−1 + δ(vi ,wi )si−1,j + δ(vi ,−)si ,j−1 + δ(−,wj)
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 14 / 69
Scoring Matrices
To generalize scoring, consider a (4 + 1)× (4 + 1) scoring matrix δIn the case of an amino acid sequence alignment, the scoring matrix wouldbe a (20 + 1)× (20 + 1) size.The addition of 1 is to include the score for comparison of a gap character“-".This will simplify the algorithm as follows:
si ,j = max
si−1,j−1 + δ(vi ,wi )si−1,j + δ(vi ,−)si ,j−1 + δ(−,wj)
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 14 / 69
Measuring Similarity
Measuring the extent of similarity between two sequences
Based on percent sequence identityBased on conservation
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 15 / 69
Percent Sequence Identity
The extent to which two nucleotide or amino acid sequences are invariant
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 16 / 69
Conservation
Amino acid changes that tend to preserve the physico-chemical propertiesof the original residue
Polar to polar:aspartate → glutamate
Nonpolar to nonpolar:alanine → valine
Similarly behaving residues:leucine to isoleucine
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 17 / 69
The scoring model
The algorithms that compute an alignment critically depend on thechoice of the parameters for substitutions, deletions and insertions.Generally no existing scoring model can be applied to all situations. Herethe underlying question and/or application always needs to be considered.Generally pairwise alignments are conducted when
Evolutionary relationships between the sequences are reconstructed.Here scoring matrices based on mutation rates are usually applied.Protein domains are compared. Then the scoring matrices should bebased on composition of domains and their substitution frequency.
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 18 / 69
Substitution matrices
To be able to score an alignment, we need to determine score terms foreach aligned residue pair.
DefinitionA substitution matrix S over an alphabet Σ = {a1, . . . , aκ} has κ× κentries, where each entry (i , j) assigns a score for a substitution of theletter ai by the letter aj in an alignment.
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 19 / 69
Making a Scoring Matrix
Scoring matrices are created based on biological evidence.Alignments can be thought of as two sequences that differ due tomutations.Some of these mutations have little effect on the protein’s function,therefore some penalties, δ(vi ,wj), will be less harsh than others.
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 20 / 69
Scoring matrix example
Notice that although R and Kare different amino acids, theyhave a positive score.Why? They are both positivelycharged amino acids → will notgreatly change function ofprotein.
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 21 / 69
Similarity of AA residues
AA have different properties → substitution probabilities are different foreach AA
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 22 / 69
Scoring matrices
Amino acid substitution matrices
PAMBLOSUM
DNA substitution matrices
DNA is less conserved than protein sequencesLess effective to compare coding regions at nucleotide level
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 23 / 69
Substitution matrices
Consider non-gapped alignments
X = x1x2 . . . xn
Y = y1y2 . . . yn
Null hypothesis: the two sequences are unrelated (not homologous). Thealignment is then random with a probability described by the model R :each letter a occurs independently with some probability pa, and hence theprobability of the two sequences is the product:
P(X ,Y | R) =∏i
pxi
∏j
pyj .
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 24 / 69
Substitution matrices
Alternative hypothesis, match model M: the two sequences are related(homologous). In the aligned pairs of residues occur with a joint probabilitypab, which is the probability that a and b have each evolved from someunknown original residue c as their common ancestor. Thus, the probabilityfor the whole alignment is:
P(X ,Y | M) =∏i
pxiyi .
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 25 / 69
Substitution matrices
The ratio of the two gives a measure of the relative likelihood that thesequences are related (model M) as opposed to being unrelated (model R).This ratio is called odds ratio:
P(X ,Y | M)
P(X ,Y | R)=
∏i pxiyi∏
i pxi
∏i pyi
=∏i
pxiyi
pxipyi
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 26 / 69
Substitution matrices
To obtain an additive scoring scheme, we take the logarithm (base 2 isusually chosen) to get the log-odds ratio:
S = log(P(X ,Y | M)
P(X ,Y | R)) = log(
∏i
pxiyi
pxipyi
) =∑
i
s(xi , yi ),
with
s(a, b) := log(
pab
papb
).
We thus obtain a matrix S = s(a, b) that determines a score for eachaligned residue pair, known as a score or substitution matrix.For amino-acid alignments, commonly used matrices are the PAM andBLOSUM matrices.
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 27 / 69
Two major scoring matrices for AA sequence comparisons
PAM-derived from sequences known to be closely related (Eg.Chimpanzee and human). Ranges from PAM1 to PAM500BLOSUM-derived from sequences not closely related (Eg. E. coli andhuman). Ranges from BLOSUM 10-BLOSUM 100
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 28 / 69
PAM
Point Accepted Mutation (M. Dayhoff et al., 1978)A series of matrices describing the extent to which two amino acidshave been interchanged in evolutionPAM-1 scoring matrix was obtained by aligning very similar sequences.Other PAMs were obtained by mathematical extrapolation
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 29 / 69
PAM
1PAM = PAM1 = 1% average change of all amino acid positions (onepoint mutation every 100 AA)
After 100 PAMs of evolution, not every residue will have changedI some residues may have mutated several timesI some residues may have returned to their original stateI some residues may not changed at all
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 30 / 69
PAM
Other PAM matrices are calculated fromPAM1 → PAM1 ∗ ... ∗ PAM1 = PAMx
xThis asumes, that mutations keep the same pattern as in the PAM1matrix and that multiple substitutions can occur at the same time.These matrices PAMx are appropriate to evaluate evolutionarydistanced sequences
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 31 / 69
PAMMultiply PAM1 by itself 250 timesEquivalent to 250 susbtitution every 100 AAMore substitutions than AA → multiple substitutions!Valid, for long periods of timePAM100:
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 32 / 69
BLOSUM
Blocks Substitution MatrixScores derived from observations of the frequencies of substitutions inblocks of local alignments in related proteinsMatrix name indicates evolutionary distanceBLOSUM62 was created using sequences sharing no more than 62%identity
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 33 / 69
BLOSUM
BLOSUM are built from distantly related sequences within conservedblocks whereas PAM is built from closely related sequencesBLOSUM are built from conserved blocks of aligned protein segmentsfound in the BLOCKS database (the BLOCKS database is a secondarydatabase that derives information from the PROSITE Familydatabase)
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 34 / 69
The Blosum50 Scoring Matrix
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 35 / 69
BLOSUM
Version 8.0 of the Blocks Database consists of 2884 blocks based on 770protein families documented in PROSITE.
Hypothetical entry in red box in BLOCK record:
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 36 / 69
Building BLOSUM Matrices
1 To build the BLOSUM62 matrix one must eliminate sequences thatare identical in more than 62% of their AA sequences.
2 This is done by either removing sequences from the BLOCK or byfinding a cluster of similar sequences and replacing it with a singlerepresentative sequence.
3 Next, the probability for a pair of amino acids to be placed in thesame column is calculated. In the previous page this would be theprobability of replacement of A with A, A with B, A with C, and Bwith C. This gives the value pab
4 Next, one calculates the probability that the replacement amino acidfrequency exists in nature, pa ∗ pb.
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 37 / 69
Building BLOSUM Matrices
5 Finally, we calculate the log odds ratio sa,b = log2(pab/pa ∗ pb). Thisvalue is entered into the matrix.Which BLOSUM to use?
If you are comparing sequences that are very similar, use BLOSUM 80.Sequence comparisons that are more divergent (dissimilar) than 20% aregiven very low scores in this matrix.
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 38 / 69
Dynamic ProgrammingPart IV: Local Alignment
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 39 / 69
Local vs. Global Alignment
The Global Alignment Problem tries to find the longest path betweenvertices (0, 0) and (n,m) in the edit graph.The Local Alignment Problem tries to find the longest path amongpaths between arbitrary vertices (i , j) and (i ′, j ′) in the edit graph.In the edit graph with negatively-scored edges, Local Alignment mayscore higher than Global Alignment
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 40 / 69
Local Alignment
Two genes in different species may be similar over short conservedregions and dissimilar over remaining regions.Example:
I Homeobox genes have a short region called the homeodomain that ishighly conserved between species.
I A global alignment would not find the homeodomain because it wouldtry to align the ENTIRE sequence
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 41 / 69
The Local Alignment Problem
Goal: Find the best local alignment between two strings
Input: Strings v, w and scoring matrix δ
Output: Alignment of substrings of v and w whose alignment score ismaximum among all possible alignment of all possible substrings
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 42 / 69
The Problem with this Problem
Long run time O(n4):I In the grid of size n × n there are n2 vertices (i , j) that may serve as a
source.I For each such vertex computing alignments from (i , j) to (i ′, j ′) takes
O(n2) time.
This can be remedied by giving free rides
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 43 / 69
Local Alignment: Example
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 44 / 69
Local Alignment: Example
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 45 / 69
Local Alignment: Example
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 46 / 69
Local Alignment: Example
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 47 / 69
Local Alignment: Example
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 48 / 69
Local Alignment: Example
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 49 / 69
Local Alignment: Example
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 50 / 69
Local Alignment: Example
Long run time O(n4):
In the grid of size n × n thereare n2 vertices (i , j) that mayserve as a source.For each such vertex computingalignments from (i , j) to (i ′, j ′)takes O(n2) time.
This can be remedied by giving freerides
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 51 / 69
Local Alignment: Free Rides
The dashed edges represent the free rides from (0, 0) to every other node.
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 52 / 69
The Local Alignment Recurrence
Smith-Waterman Algorithm:
The largest value of si ,j over the whole edit graph is the score of thebest local alignment.The recurrence:
si .j = max
0
→ There is only this change from the originalrecurrence of the Global Alignment
si−1,j−1 + δ(vi ,wi )si−1,j + δ(vi ,−)si ,j−1 + δ(−,wi )
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 53 / 69
The Local Alignment Recurrence
Smith-Waterman Algorithm:
The largest value of si ,j over the whole edit graph is the score of thebest local alignment.The recurrence:
si .j = max
0 → There is only this change from the original
recurrence of the Global Alignmentsi−1,j−1 + δ(vi ,wi )si−1,j + δ(vi ,−)si ,j−1 + δ(−,wi )
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 53 / 69
The Local Alignment Recurrence
Smith-Waterman Algorithm:
The largest value of si ,j over the whole edit graph is the score of thebest local alignment.The recurrence:
si .j = max
0 → Power of ZERO: there is only this change,
since there is only one “free ride" edgesi−1,j−1 + δ(vi ,wi ) entering into every vertexsi−1,j + δ(vi ,−)si ,j−1 + δ(−,wi )
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 54 / 69
Scoring:indel −2match +2subst. −1
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 55 / 69
Scoring:indel −2match +2subst. −1
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 56 / 69
Scoring:indel −2match +2subst. −1
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 57 / 69
Scoring:indel −2match +2subst. −1
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 58 / 69
Scoring Indels: Naive Approach
A fixed penalty σ is given to every indel:−σ for 1 indel−2σ for 2 consecutive indels−3σ for 3 consecutive indels, etc.γ(g) = −gσ
That is a linear gap penalty. Can be too severe penalty for a series of 100consecutive indels.
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 59 / 69
Affine Gap Penalties
In nature, a series of k indels often come as a single event rather than aseries of k single nucleotide events:
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 60 / 69
Accounting for Gaps
Gaps: contiguous sequence of spaces in one of the rows.Instead of a linear score, an affine score is biologically more plausible.The score for a gap of length g is given by:
γ(g) = −σ − (g − 1)e,
where σ is the gap open penalty and e is the gap extension penalty.Usually, e < σ, with the result that less isolated gaps are produced, asshown in the following comparison:
Linear gap penalty: GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLGSAQVKGHGKK––––VA–D––A-SALSDLHAHKL
Affine gap penalty: GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLGSAQVKGHGKKVADA–––––––-SALSDLHAHKL
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 61 / 69
Accounting for Gaps
Gaps: contiguous sequence of spaces in one of the rows.Instead of a linear score, an affine score is biologically more plausible.The score for a gap of length g is given by:
γ(g) = −σ − (g − 1)e,
where σ is the gap open penalty and e is the gap extension penalty.Usually, e < σ, with the result that less isolated gaps are produced, asshown in the following comparison:
Linear gap penalty: GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLGSAQVKGHGKK––––VA–D––A-SALSDLHAHKL
Affine gap penalty: GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLGSAQVKGHGKKVADA–––––––-SALSDLHAHKL
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 61 / 69
Affine Gap Penalties
Gap penalties: γ(g) = −σ − (g − 1)e
−σ when there is 1 indel−σ − e when there are 2 indels−σ − 2e when there is 3 indels
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 62 / 69
Adding “Affine Penalty" Edges to the Edit Graph
To reflect affine gappenalties we have to add“long" horizontal andvertical edges to the editgraph. Each such edge oflength g should haveweight
−σ − (g − 1)e
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 63 / 69
Adding “Affine Penalty" Edges to the Edit Graph
There are many suchedges!Adding them to the graphincreases the running timeof the alignmentalgorithm by a factor of n(where n is the number ofvertices)So the complexityincreases from O(n2) toO(n3)
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 64 / 69
Manhattan in 3 Layers
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 65 / 69
Affine Gap Penalties and 3 Layer Manhattan Grid
The three recurrences for the scoring algorithm creates a 3-layeredgraphThe top level creates/extends gaps in the sequence wThe bottom level creates/extends gaps in sequence vThe middle level extends matches and mismatches
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 66 / 69
Switching between 3 Layers
Levels:I The main level is for diagonal edgesI The lower level is for horizontal edgesI The upper level is for vertical edges
A jumping penalty is assigned to moving from the main level to eitherthe upper level or the lower level (−σ)There is a gap extension penalty for each continuation on a level otherthan the main level (−e)
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 67 / 69
The 3-leveled Manhattan Grid
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 68 / 69
Affine Gap Penalty Recurrences
Bioinfo I (Institut Pasteur de Montevideo) Dyn. Programming -class 5- July 26th, 2011 69 / 69
top related