Cybersecurity 6 Ophthalmic Assistant 18 Composites ... Course Schedule Catalog.pdf · Penetration Testing – NEW! This course provides a hands-on approach and techniques associated
Post on 21-May-2020
7 Views
Preview:
Transcript
Cybersecurity 6
Ophthalmic Assistant 18
Composites Technician 27
2
Table of Contents
n
ENHANCE YOUR CAREER
Computer and Information Technology• Computer Software ..............................................................................................4• Cybersecurity and Information Assurance .........................................6• Digital Photography ............................................................................................. 7• Engineering Graphic Design .........................................................................8• Graphic Design ........................................................................................................9• Social Media and Digital Marketing ...................................................... 10• Systems and Network Engineering ....................................................... 11• Website Design and Coding .......................................................................12
Creative Careers• Cosmetology ...........................................................................................................14• CulinaryArtsCertificate ..................................................................................14• Floral Design ...........................................................................................................15• Food Truck Operations ....................................................................................15• Interior Design ........................................................................................................15
Health Care• CPR and First Aid .................................................................................................17• Health Care Professionals Skills Enhancement ...........................17• Health Information Management Careers .......................................20• Massage Therapy ............................................................................................... 22• Non-Patient Care Careers ............................................................................ 23• Patient Care Careers .........................................................................................17
Manufacturing, Industrial and Construction Trades• Construction and Engineering .................................................................. 24• Environmental ....................................................................................................... 25• Industrial Safety ...................................................................................................26• Production, Equipment and Machinery Training ......................... 27• Supply Chain .......................................................................................................... 24
Professional Development• A RiverDogs Experience ................................................................................30• Accounting for Non-Accountants ..........................................................30• Administrative Professionals Day Conference .............................30• Business and Interpersonal Skills ..........................................................30• Executive Skills ......................................................................................................31• Fitness Professionals ....................................................................................... 33• Human Resources .............................................................................................30• Law Enforcement/Security ........................................................................ 34• Law School for Non-Lawyers ....................................................................30• Lean Six Sigma .....................................................................................................30• Real Estate and Property Management ............................................ 35• Safety Leadership ...............................................................................................31• SC Business, Law and Project Management ..................................31• Supervisory Skills ................................................................................................31• TeacherRecertification ....................................................................................31
EQUIP YOUR WORKFORCE
• BenefitsofWorkforceTraining ................................................................. 37• Our Top Training Programs .......................................................................... 37• Qualifying for a Tax Credit ............................................................................38
EXPLORE NEW INTERESTS
Personal Enrichment• Arts, Hobbies and DIY .....................................................................................40• Culinary, Baking and Pastry .........................................................................41• Defensive Driving ................................................................................................ 44• Fitness ......................................................................................................................... 45• Health and Wellness ........................................................................................49• Languages ...............................................................................................................46• Motorcycle Safety .............................................................................................. 47• Outdoor Living ......................................................................................................48• Personal Finance ................................................................................................49• Personal Skills .......................................................................................................49• Pets and Animals ................................................................................................50
Youth Programs (Kids’ College and Teen University)• Computer Technology .....................................................................................51• Creative Arts ........................................................................................................... 52• Culinary, Baking and Pastry ........................................................................ 53• Leadership Skills ................................................................................................. 52• Nature and Outdoors ........................................................................................51• Spring Break Camps......................................................................................... 55• Summer Camps ................................................................................................... 55
Information and ServicesOnline Courses Help Desk… ...................................................... 843.574.6689Registration Information ................................................................843.574.6152Website and e-newsletter sign up ..........www.tridenttech.edu/ce
Additional InformationCampuses and Community Sites ...................................................................56Registration Information ........................................................................................58
Courses with these symbols...
are currently approved for veterans education benefits
qualify for enrollment in a payment plan
qualify for the Senior Scholars discount; see pg. 58 for more information
ON THE COVER: Dish Up Charleston Classics in the Charleston ClassicsDemystifiedclass,seepg.41.
3
LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus; SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available4
COMPUTER AND INFORMATION TECHNOLOGY
Computer Software
Microsoft and QuickBooks Career Certif icatesTTCofferscertificateswhichallowyoutodemonstrateyourproficiencyinusingMicrosoftOfficesoftwareandQuickBooks:MicrosoftOfficeSpecialistCertificate($1,369);MicrosoftExcelSpecialistCertificate($459);andQuickBooksBookkeepingCertificate($359).
AccessCreate a database from scratch and format tables. Then query the database and design a form to view it in a more visually pleasing way. Move on to work with advanced tables and relationships, as well as intermediate-level queries, forms and reports. Integrate Access data with other applications such as Microsoft Word or Excel. Book included
ExcelLearn simple formulas, ranges, page setup and printing options.Workwithtables;sortandfilteroptions;andlinkworksheets and workbooks. Then move on to audit and analyze worksheet data; create macros; work with data validation options; consolidate data; share and protect workbooks; and import and export data. Book included
PowerPointCreate a PowerPoint presentation or manipulate an existing presentation; format text slides; add tables; chart data; modify objects on slides; add images; and prepare to deliver a presentation. Take your knowledge to the next level and learn how to customize templates; add SmartArt and equations; and work with media and animations. Books included
QuickBooksSet up a chart of accounts; reconcile a checking account; create invoices, receipts and statements; track payables, inventory and receivables; create estimates; and generate reports. Then customize forms; create reports and graphs; track and pay sales tax; do payroll; and make estimates, track time and job costs. Book included
WordTake the basic class to learn essential commands like saving files;cut,copyandpaste;spellcheck;printing;andpagesetup options. Then go to the next level and learn how to work with bullets and numbers; indents and tabs; character and paragraph formatting; and borders and shading as well as simple tables. Book included
Continuing Education Call Center – 843.574.6152 5Continuing Education Call Center – 843.574.6152
Course Dates
XCPT-74213415 AccessLevel1–AccessfortheBeginner March24-26 TuTh 6-9:15p.m. $169 TC
XCPT-74213416 AccessLevel1–AccessfortheBeginner April29 W 9a.m.-4:30p.m. $169 TC
XCPT-74213417 AccessLevel1–AccessfortheBeginner July20-22 MW 6-9:15p.m. $169 TC
XCPT-74313418 AccessLevel2–Access:TheNextLevel March31-April2 TuTh 6-9:15p.m. $169 TC
XCPT-74313419 AccessLevel2–Access:TheNextLevel May6 W 9a.m.-4:30p.m. $169 TC
XCPT-74313420 AccessLevel2–Access:TheNextLevel July27-29 MW 6-9:15p.m. $169 TC
XCPT-52313400 ExcelLevel1–ExcelDemystified Feb.3-5 MW 6-9:15p.m. $169 TC
XCPT-52313401 ExcelLevel1–ExcelDemystified March4 W 9a.m.-4:30p.m. $169 TC
XCPT-52313402 ExcelLevel1–ExcelDemystified May18-20 MW 6-9:15p.m. $169 TC
XCPT-52413403 ExcelLevel2–DiveDeeperintoExcel Feb.18-20 TuTh 6-9:15p.m. $169 TC
XCPT-52413404 ExcelLevel2–DiveDeeperintoExcel March18 W 9a.m.-4:30p.m. $169 TC
XCPT-52413405 ExcelLevel2–DiveDeeperintoExcel June1-3 MW 6-9:15p.m. $169 TC
XCPT-75213406 ExcelLevel3–ExcelforPowerUsers Feb.25-27 TuTh 6-9:15p.m. $169 TC
XCPT-75213407 ExcelLevel3–ExcelforPowerUsers April1 W 9a.m.-4:30p.m. $169 TC
XCPT-75213408 ExcelLevel3–ExcelforPowerUsers June15-17 MW 6-9:15p.m. $169 TC
XCPT-51313409 PowerPointLevel1 March10-12 TuTh 6-9:15p.m. $169 TC
XCPT-51313410 PowerPointLevel1 April14 Tu 9a.m.-4:30p.m. $169 TC
XCPT-51313411 PowerPointLevel1 July6-8 MW 6-9:15p.m. $169 TC
XCPT-51413412 PowerPointLevel2 March17-19 TuTh 6-9:15p.m. $169 TC
XCPT-51413413 PowerPointLevel2 April21 Tu 9a.m.-4:30p.m. $169 TC
XCPT-51413414 PowerPointLevel2 July13-15 MW 9a.m.-4:30p.m. $169 TC
XACC-50113421 QuickBooksLevel1 Jan.18 Sa 8:30a.m.-4:30p.m. $199 TC
XACC-50113422 QuickBooksLevel1 Feb.18-20 TuTh 6-9:30p.m. $199 TC
XACC-50113423 QuickBooksLevel1 March31 Tu 8:30a.m.-4:30p.m. $199 TC
XACC-50113424 QuickBooksLevel1 May4-6 MW 6-9:30p.m. $199 TC
XACC-50213425 QuickBooksLevel2 Feb.1 Sa 9a.m.-4:30p.m. $199 TC
XACC-50213426 QuickBooksLevel2 March3-5 TuTh 6-9:15p.m. $199 TC
XACC-50213427 QuickBooksLevel2 April7 Tu 9a.m.-4:30p.m. $199 TC
XACC-50213429 QuickBooksLevel2 May18-20 MW 6-9:15p.m. $199 TC
XCPT-50913394 WordLevel1–WordinaDay Jan.14-16 TuTh 6-9:15p.m. $169 TC
XCPT-50913395 WordLevel1–WordinaDay Feb.19 W 9a.m.-4:30p.m. $169 TC
XCPT-50913396 WordLevel1–WordinaDay April28-30 TuTh 6-9:15p.m. $169 TC
XCPT-51013397 WordLevel2–BeyondtheBasics Jan.21-23 TuTh 6-9:15p.m. $169 TC
XCPT-51013398 WordLevel2–BeyondtheBasics Feb.26 W 9a.m.-4:30p.m. $169 TC
XCPT-51013399 WordLevel2–BeyondtheBasics May12-14 TuTh 6-9:15p.m. $169 TC
COMPUTER AND INFORMATION TECHNOLOGY
Computer Software
LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus; SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available6
COMPUTER AND INFORMATION TECHNOLOGY
Cybersecurity/Information Assurance
Amazon Web Services (AWS) – NEW! This course introduces learners to Amazon Web Services (AWS).WorkwiththeAWSbuildingblocks,gainhands-on experience with core services such as EC2, and study differencesinthecloudservicesincludingsecurity,rolesand responsibilities. Technology enthusiasts working in IT or anyone interested in core cloud services provided by AWS are encouraged to take this class to learn how to quickly implement AWS storage and database services, use AWS management tools, and secure an AWS deployment. No books required
XIST-517 $1,399
ID#13454 March 23-April 22 MW 8 a.m.-noon TC
Artif icial Intelligence and Machine Learning Introduction – NEW! Thiscourseprovideslearnerswithanintroductiontoartificialintelligence(AI)andmachinelearning(ML)withanemphasison its use to solve real-world problems across industries. Learn how to solve a variety of problems using AI and Python. Discuss the impact of AI technology in society and itsimplicationsasthefastest-growingsubfieldofcomputerscience. Related Course: Database Management Systems. Prerequisites: none; No books required
XCPT-771 $1,199
ID#13450 Feb. 18-March 12 TuTh 8 a.m.-noon TC
Certif ied Ethical Hacker (CEH) and Penetration Testing – NEW! This course provides a hands-on approach and techniques associated with the cybersecurity practice known as penetration testing or ethical hacking. The course content covers planning, reconnaissance, scanning, exploitation, post-exploitation and result reporting. The learner discovers how system vulnerabilities can be exploited and how to avoid such problems. This lab-based experience provides an understanding of the fundamental threat vectors and exploitation techniques used to penetrate systems and networks. Prerequisites: Linux+, Linux/Unix System Administration and Security+ Certification; No books required
XIST-519 $2,499
ID#13456 April 28-May 28 TuTh 6-10 p.m. TC
Database Management Systems – NEW! Get hands-on experience with traditional relational database managementsystems(RDBMS).Writestructuredquerylanguage(SQL)usedtocreate,read,updateanddelete(CRUD)recordsandoperatedatabases.Curriculumincludesdata normalization and the creation of entity relationship diagrams(ERD)forreal-worldproblems.Related course: PHP and MySQL Programming. Prerequisites: none; No books required
XCPT-772 $1,099
ID#13452 Jan. 22-Feb. 17 MW 8 a.m.-noon TC
Security+ Certif ication, Cyber and Network Security n This course provides the fundamentals of computer and network security, and prepares you for the CompTIA Security+ exam. We review material related to computer security concepts, network communications security, infrastructure security, cryptography and operational/organizational security. Learners gain hands-on skills and knowledge in capturing, analyzingandgeneratingIPtraffic,howtoexploitprotocolweaknessesandexaminedefensivesolutions.Packetfiltering,passwordpoliciesandfileintegritycheckingarealsocovered.No books required
XIST-604 $1,999
ID#13445 June 2-July 2 TuTh 6-10 p.m. TC
7
COMPUTER AND INFORMATION TECHNOLOGY
Digital Photography
Digital Photography Next StepsMake your photos say, “WOW!” Learn easy-to-apply techniques including framing the picture for good composition; adjusting for lighting; and choosing resolution, compression andfile-formssettingsonyourcamera.Explorespecialtycamera features and how to retouch photos. No books required
XARV-502 $159
ID#13264 Jan.27-29 MW 6-9:30p.m. TCID#13266 March23-25 MW 6-9:30p.m. TC
Digital Photography OutdoorsHave a photo adventure in the park! Bring your camera and your best eye. Follow the light and see the detail of what you pass every day without noticing. Locations are selected by students while in class. No books required; location entrance fee may be required
XARV-503 $139
ID#13267 Feb. 9 Su 1-4 p.m. OSID#13268 April 5 Su 1-4 p.m. OS
LightroomTransform your photo from an image on your camera to your true vision! Learn how to manipulate raw data, set your metadata, control exposure, and work with shadows and highlights. Plus, practice how to prepare your images for social networking with your personal watermark. No books required
XARV-507 $279
ID#13269 Feb.10-19 MW 6-9:30p.m. TCID#13270 April6-15 MW 6-9:30p.m. TC
Photoshop for PhotographersDiscover how to manipulate your image with the basic photo tools available in Photoshop. Learn how to set up your workspace, make straightforward edits, understand each tool in the toolbox, discover layers, switch out parts from one photo to another and more! No books required
XARV-508 $279
ID#13271 Feb.24-March4 MW 6-9:30p.m. TCID#13272 April20-29 MW 6-9:30p.m. TC
Food Photography 101 – NEW!Love taking food pictures? Use your camera to artfully capture images that tell the story of your dish’s taste, seasonings and aroma through your photos. Learn how to utilize lighting, strategies, and simple techniques for food styling to make your pictures seem real and authentic. Give your viewers the ability to taste your delicious food through your pictures. No books required
XARV-509 $159
ID#13439 Feb.25 Tu 9a.m.-4:30p.m. TCID#13440 March28 Sa 9a.m.-4:30p.m. TCID#13441 May5-7 TuTh 6-9:15p.m. TC
Digital Photography Career Certif icate Obtainacertificateasadigitalphotographerbycompletingthefollowingcourses:DigitalPhotographyDemystified;DigitalPhotography Next Steps; Digital Photography Outdoors; Lightroom; and Photoshop for Photographers. SAVE! Enroll in the certificate for only $915.
Digital Photography DemystifiedLearnthebasicfeaturesofyourdigitalcamera,plusfilestructure, resolution, printing and more. Bring your camera, instruction book, cables and 10 photos for sharing. No books required
XARV-501 $159
ID#13262 Jan.13-15 MW 6-9:30p.m. TCID#13263 March16-18 MW 6-9:30p.m. TC
Continuing Education Call Center – 843.574.6152
LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus; SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available8
COMPUTER AND INFORMATION TECHNOLOGY
Engineering Graphic Design
linetypes; object snap modes; grip editing; crosshatching; the AutoCAD design center; dimensioning commands and styles; plotting; utility commands; and prototype drawings. Then take AutoCAD to the next level and practice productivity toolsincludingcreatingnamedviews;effectiveuseofgrips;enhanced tools for better layer management; object selection andgrouping;workingacrossdrawings;fieldsandtables;advanced features of blocks; creating attributes and dynamic blocks; advanced plotting techniques; managing sheet sets; and customization techniques that include creating custom userprofiles,workspacesandtoolpalettes.Books not included
Inventor This course introduces parametric 3D modeling using Inventor by Autodesk. Topics include getting acquainted with Inventor; part modeling techniques; working with sketches; creating features; using work features; and adding placed features to parts. Also covered are creating loft, sweep and split features; creating part drawings and assembly models; working with adaptive drawings; and managing model data. While prior knowledge of working with 3D is helpful, it is not required. Prerequisite: AutoCAD Level 3 – Advanced; Book included
SolidWorks Increase your AutoCAD knowledge and skills by learning SolidWorks parametric modeling software. This course includes comprehensive coverage of beginning to intermediate tools and techniques using SolidWorks. It covers the creation of parts, assemblies and drawings utilizing proper modeling practices to achieve design intent. Prerequisite: AutoCAD Level 3 – Advanced; Book included
CATIA These hands-on, on-campus courses introduce the fundamental concepts of CATIA for mechanical design. Learn to create, constrain and add intelligent dimensions to sketches. Fromsketches,featuressuchaspads,fillets,chamfersandholes are created to form a 3D part. Generative drafting also is covered, which allows you to generate 2D drawing views from a 3D part. Dimensions are added to the views as a means of documenting the drafting. Other topics include the management of parts through the creation of an assembly model and how to assemble, move, constrain and analyze the assembly model. Bill-of-material list generation also is covered. Then move on to more advanced design options in CATIA. Topics cover managing the catalog browser, inserting parts and subassemblies, using the assembly features and constraint creation toolbars and much more. No books required
Engineering Graphic Design Career Certif icate Obtainacertificateincomputer-aideddesignbycompletingthefollowingcourses:AutoCADLevel1– Fundamentals; AutoCAD Level 2 – Production Environment; AutoCAD Level 3 – Advanced; Inventor; and SolidWorks. Enroll in the certificate track for only $3,999.
AutoCAD n Jump-start your engineering career with basic drawing commands and editing concepts in Level 1. Learn polar tracking; object properties; layers, colors, lineweights and
Course Dates
XEGT-50113241 AutoCADLevel1–Fundamentals Jan.13-Feb.17 MW 5:30-9:30p.m. $899 TC
XEGT-50113243 AutoCADLevel1–Fundamentals April27-June1 MW 5:30-9:30p.m. $899 TC
XEGT-50213244 AutoCADLevel2–ProductionEnvironment Feb.24-March18 MW 5:30-9:30p.m. $849 TC
XEGT-50213245 AutoCADLevel2–ProductionEnvironment June8-July1 MW 5:30-9:30p.m. $849 TC
XEGT-50813247 AutoCADLevel3–Advanced March23-April15 MW 5:30-9:30p.m. $849 TC
XEGT-50813248 AutoCADLevel3–Advanced July6-29 MW 5:30-9:30p.m. $849 TC
XEGT-60813253 CATIALevel1–BootCamp Jan.24-26 FSaSu 8a.m.-5p.m. $3,500 TC
XEGT-60813254 CATIALevel1–BootCamp March6-8 FSaSu 8a.m.-5p.m. $3,500 TC
XEGT-60813255 CATIALevel1–BootCamp May15-17 FSaSu 8a.m.-5p.m. $3,500 TC
XEGT-60813256 CATIALevel1–BootCamp June26-28 FSaSu 8a.m.-5p.m. $3,500 TC
XEGT-60713257 CATIALevel2–AdvancedDesign Jan.27 M 8a.m.-5p.m. $1,169 TC
XEGT-60713258 CATIALevel2–AdvancedDesign March9 M 8a.m.-5p.m. $1,169 TC
XEGT-60713260 CATIALevel2–AdvancedDesign May18 M 8a.m.-5p.m. $1,169 TC
XEGT-60713261 CATIALevel2–AdvancedDesign June29 M 8a.m.-5p.m. $1,169 TC
XEGT-50413249 Inventor Jan.14-Feb.13 TuTh 5:30-9:30p.m. $899 TC
XEGT-50513252 SolidWorks Feb.18-March19 TuTh 5:30-9:30p.m. $899 TC
Continuing Education Call Center – 843.574.6152 9
COMPUTER AND INFORMATION TECHNOLOGY
Graphic Design
PhotoshopExplore palettes and layers; paths, masks and channels; and color correction. Then learn advanced layer techniques; specialeffects;combiningIllustratorgraphicswithPhotoshop;preparing images for web and print publications; and ensuring accurate color. Book included
Graphic Artist Career Certif icate Obtainacertificateasagraphicartistbycompletingthefollowingcourses:PhotoshopLevels1and2;IllustratorLevels1 and 2; InDesign Levels 1 and 2; and Graphic Design Lab. SAVE! Enroll in the certificate for only $2,455.
Graphic Design LabOnce you have learned how to use Photoshop, Illustrator and InDesign, put your skills to work creating your own layouts. You are given the opportunity to create a layout of your choosing usingtheskillsyouhavelearned.Cometothefirstclasswithaplan of your goal and any photos and copy to be included. No book required
IllustratorLearn the basics and more advanced concepts of Adobe Illustrator. Expand your skills to create more complex illustrations, providing you with a better understanding of printing documents without errors or color mismatches as well as preparing illustrations for the web. Book included
InDesignLearnthebasicsofcreatingsingle-pageadsandflyerstocomplex multipage color publications. Build upon skills and use techniques to manipulate text, pictures and pages; control type formatting; create and edit graphics; and generate layouts withefficiencyandaccuracy.Book included
Course Dates
XCGC-50713289 GraphicDesignLab April13-22 MW 6-9:30p.m. $399 TC
XCGC-50713290 GraphicDesignLab June23-25 TuTh 9a.m.-4:30p.m. $399 TC
XCGC-50313277 IllustratorLevel1–Introduction Feb.17-26 MW 6-9:30p.m. $399 TC
XCGC-50313278 IllustratorLevel1–Introduction May19-21 TuTh 9a.m.-4:30p.m. $399 TC
XCGC-50413279 IllustratorLevel2–Intermediate March2-11 MW 6-9:30p.m. $399 TC
XCGC-50413283 IllustratorLevel2–Intermediate June2-4 TuTh 9a.m.-4:30p.m. $399 TC
XCGC-50513285 InDesignLevel1–Introduction March16-25 MW 6-9:30p.m. $399 TC
XCGC-50513286 InDesignLevel1–Introduction June9-11 TuTh 9a.m.-4:30p.m. $399 TC
XCGC-50613287 InDesignLevel2–Intermediate March30-April8 MW 6-9:30p.m. $399 TC
XCGC-50613288 InDesignLevel2–Intermediate June16-18 TuTh 9a.m.-4:30p.m. $399 TBA
XCGC-50113273 PhotoshopLevel1–Introduction Jan.13-27 MW 6-9:30p.m. $399 TC
XCGC-50113274 PhotoshopLevel1–Introduction May5-7 TuTh 9a.m.-4:30p.m. $399 TC
XCGC-50213275 PhotoshopLevel2–Intermediate Feb.3-12 MW 6-9:30p.m. $399 TC
XCGC-50213276 PhotoshopLevel2–Intermediate May12-14 TuTh 9a.m.-4:30p.m. $399 TC
LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus; SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available10
COMPUTER AND INFORMATION TECHNOLOGY
Social Media and Digital Marketing
Digital/Social Media Marketing for Business Boot Camp Set up your campaigns the right way to maximize conversions. Learn how to set up social media accounts for your business and email marketing campaigns as well as how to advertise ondifferentsocialmediaplatformsandmonetizeyoursiteformaximumprofits.No books required
XMKT-512 $679
ID#13388 Jan.14-16 TuTh 9a.m.-4:30p.m. TCID#13389 March14-21 Sa 9a.m.-4:30p.m. TCID#13390 May12-21 TuTh 6-9:30p.m. TC
Making Money from Your Home ComputerDid you know that there are many legitimate work-from-home sites? Find, register and get started making money. Learn aboutotherwaystomakemoneythroughflippingwebsites,socialmediaandaffiliatemarketing.No book required
XCPT-556 $99
ID#13391 Feb. 15 Sa 10 a.m.-noon TCID#13392 April 21 Tu 6-8 p.m. TCID#13393 June 13 Sa 10 a.m.-noon TC
Social Media and Digital Marketing Career Certif icate ObtainacertificateinSocialMediaandDigitalMarketingbycompletingthefollowingfivecourses:Digital/SocialMediaMarketing Introduction; SEO and Google Analytics; Email Marketing; Social Media Marketing Platforms; and Monetizing Your Site – Make Money While You Sleep. SAVE! Enroll in the entire certificate for only $679.
Digital/Social Media Marketing IntroductionGetthetoolsyouneedtostartmarketingondifferentsocialmedia platforms. Create a social media marketing plan that attracts more visitors to your website and social media pages and increase conversions. No book required
XMKT-507 $99
ID#13297 Jan. 29 W 6-8 p.m. TC
Email MarketingEmail marketing is still the #1 way to increase revenue from your website. Select an email marketing service and set up forms to capture visitor information. Set up an email template, create and run email campaigns, and segment a list. Push notificationsarealsocovered.No book required
XMKT-514 $129
ID#13300 Feb.6 Th 6-8:30p.m. TC
Monetizing Your Site – Make Money While You SleepTransform your website into a money making machine. Learn how to use SEO tactics, landing pages, email newsletters, socialmediaandaffiliatemarketingtodrivealargevolumeoftraffictoyoursite.No book required
XMKT-614 $129
ID#13387 Feb.27 Th 6-8:30p.m. TC
SEO and Google AnalyticsDo you know how to optimize your social media posts so they rank in search engines? Learn the basics of search engine optimization(SEO)andsocialmediaadvertising–organicvs.paid advertising. No book required
XMKT-509 $99
ID#13296 Feb. 4 Tu 6-8 p.m. TC
Social Media Marketing PlatformsSet up accounts for your business and learn how to post text, pictures and videos. Discover free and paid ways to advertise on Facebook, YouTube, Pinterest, Instagram and Snapchat. No book required
XMKT-518 $199
ID#13302 Feb. 11-13 TuTh 6-9 p.m. TC
Continuing Education Call Center – 843.574.6152 11
COMPUTER AND INFORMATION TECHNOLOGY
Systems and Network Engineering
A+ Essentials n Prepare for the CompTIA A+ exam by learning about diagnosing, upgrading, troubleshooting and repairing microcomputer hardware. Prerequisite: Understanding of Windows and working knowledge of computers; Book not included
XIST-600 $1,299
ID#13233 Jan. 13-Feb. 24 MW 6-10 p.m. TCID#13235 June 22-July 29 MW 6-10 p.m. TC
A+ Practical Application n Prepare for the CompTIA A+ exam in this hands-on course covering skills essential to competency in areas such as installation, preventative maintenance, networking, security and troubleshooting. Also explore hardware security, networkingoperatingsystems,modesandflow-through.Prerequisite: A+ Essentials; Book not included
XIST-601 $1,299
ID#13237 Feb. 26-April 6 MW 1-5 p.m. TCID#13238 Aug. 3-Sept. 14 MW 6-10 p.m. TC
Linux+, Linux/Unix System Administration – NEW! Learn the basics and practical skills of installing and operating a Linux system. Linux is increasingly used in many environments as their choice of operating system, and people with the skills to navigate a Linux system are in high demand. Learn basic administrative tasks, troubleshooting, and how to installandconfigureacustomLinuxsystem.Bytheendofthiscourse, you have the resources needed to pass the CompTIA Linux+ exam. No books required
XIST-518 $1,399
ID#13455 March 24-April 23 TuTh 8 a.m.-noon TC
Network+ Certif ication n PreparefortheNetwork+CertificationCompTIAexam.Thiscourse covers network fundamentals, building a network with OSI, hardware concepts, Ethernet basics, modern Ethernet, non-Ethernet networks, network interface cards, structured cabling, protocols, TCP/IP and network operating systems. Book not included
XIST-602 $1,299
ID#13240 April 8-May 27 MW 6-10 p.m. TC
LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus; SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available12
COMPUTER AND INFORMATION TECHNOLOGY
Website Design and Coding
Java Object Oriented Programming This course provides an introduction to the Java language and object-oriented programming. You explore Java syntax well enough to write simple Java programs and be able to reverse engineer more complex programs by the end of the course. We also explore the basic features of the more commonly used Java class libraries. Concepts covered include object interaction, behavior of objects, designing classes, inheritance, data structures such as arrays and strings, the Collections API, and exception handling. No books required
XCPT-608 $999
ID#13443 Jan. 14-Feb. 6 TuTh 6-10 p.m. TC
PHP and MySQL Programming – NEW! In this course, learners create interactive websites using the PHP programming language and the MySQL database server. LearnhowtoinstallandconfigureexistingPHPandMySQL-basedcontentmanagementsystems(CMS)likeWordPress.Discover how to add new information to an online database, search through posted data, and create meaningful printed reports. No books required
XIST-516 $995
ID#13453 Feb. 19-March 16 MW 8 a.m.-noon TC
Python Software Development – NEW! This course is an introduction to Python, a high-level, interpreted-based object-oriented programming language. We utilize Python’s dynamic data typing and built-in data structures to solve real-world problems such as website development, database access, text processing, graphical-userinterface(GUI)development,andsystemadministration.Prerequisites: none; No books required
XCPT-770 $1,099
ID#13447 Jan. 21-Feb. 13 TuTh 8 a.m.-noon TC
WordPress IntroductionGot ideas, pictures, audio or other items you would like to share? WordPress makes it all so easy. Learn how to create a blog or start a website. Learn the right way to install, administer, customize and market your blog. Book included
XMKT-510 $199
ID#13293 April4 Sa 9a.m.-4:30p.m. TCID#13295 June22-24 MW 6-9:15p.m. TC
Continuing Education Call Center – 843.574.6152 13
COMPUTER AND INFORMATION TECHNOLOGY
Website Design and Coding
Web Design Introduction Certif icate ObtainthecertificatebycompletingPhotoshopfortheWeband HTML and CSS. SAVE! Enroll in the entire career certificate for only $1,529.
Web Design – Beyond HTML and CSS Certif icate ObtainthecertificatebycompletingJavaScriptandWebDesign – Lab as well as all courses required to qualify for a WebDesignIntroductionCareerCertificate.SAVE! Enroll in the entire career certificate for only $3,059.
Front-End Web Developer Certif icate ObtainthecertificatebycompletingDigital/SocialMediaMarketingforBusinessBootCamp(seepg.8)andallcoursesrequired to qualify for a Web Design – Beyond HTML and CSS Career Certificate. SAVE! Enroll in the entire career certificate for only $3,675.
HTML and CSS Need a new website? This hands-on course teaches you how to code your own site using hypertext markup language(HTML)andcascadingstylesheets(CSS).Getagood foundation on the use of HTML tags and CSS and their relationship to the visual layout of webpages in the browser window. Write solid HTML that works in all browsers. Students use the appropriate tools to make hand-coding an enjoyable task while learning the tips and concepts of good webpage design and construction. Build upon a basic understanding ofHTMLandcreateamulti-levelwebsite.CreateefficientHTMLtemplatesthatcanbereusedandmodifiedasameansof reducing costs. Then dive deeper into CSS to learn how powerful styles can be. Prerequisite: Students are encouraged to take Photoshop for the Web before enrolling in this course; Book included
XIST-514 $1,299
ID#13436 Jan.28-March5 TuTh 6-9:30p.m. TC
JavaScript JavaScript is an ideal programming language to use for your firststepsinprogramming.JavaScriptallowsprogrammersthe capability of enhancing HTML and CSS webpages by adding interactivity and other various concepts. Learn how to create functions, objects, variables and scripts that allow for basic interactivity. A good grasp of HTML and CSS is required. Continue on to learn the document object model, creating and responding to custom events as well as exploring JavaScript
and cookies. Then move on to explore Ajax, the creation of JavaScript libraries and integrating JavaScript with other technologies. Prerequisite: Students are encouraged to take HTML and CSS before enrolling in this course; Book included
XIST-515 $1,299
ID#13437 March10-April16 TuTh 6-9:30p.m. TC
Photoshop for the WebPhotoshop is capable of more than simply optimizing an image for the web. This course provides tricks and tips for making a visually cohesive web design as well as planning a web layout and creating elements needed for the implementation of your vision. This is a primer for making your website as visually appealing as possible. Book included
XIST-504 $399
ID#13291 Jan.14-23 TuTh 6-9:30p.m. TC
Web Design – LabCome to TTC’s Thornley Campus Bldg. 910 to build your own website. Web design instructor will be on hand to answer questions during each session. Note: This lab is only open to students in the Web Design Certificate program.
XIST-511 $399
ID#13292 April21-23 TuTh 6-9:30p.m. TC
14LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
COSMETOLOGY
Cosmetologist CEUCosmetologists can receive six hours of accredited continuing education for completing this session. Angie Ravenel and other instructors cover the latest hairstyles, haircuts, makeup artistry, sanitary guidelines, marketing and branding of your cosmetology business, and more. Early bird discount rate is $65; regular price is $69; price at the door is $79.
Licensed Cosmetology Instructer CEU – NEW!Receive 12 hours of accredited continuing education for licensed instructors of cosmetologists, nail technicians and estheticians. Angie Ravenel and other instructors cover the latest industry trends. Early bird discount rate is $165; regular price is $175; price at the door is $185.
Nail Tech and Esthetician CEU – NEW!Nail technicians, estheticians and cosmetologists can receive six hours of accredited continuing education for completing this session. Angie Ravenel and other instructors cover the latest industry trends. Early bird discount rate is $65; regular price is $69; price at the door is $79.
CULINARY CAREERS
Culinary Arts Certif icateTrainwithcelebratedCulinaryInstituteofCharleston(CIC)chefs in a convenient, evening program with successful completion leading to career opportunities, educational advancement and personal growth. To earn a Culinary Arts Certificate,studentscompleteFundamentalsofCulinaryArtsandthenenterthebakingtrack(FundamentalsofBakingIandII)orcookingtrack(FundamentalsofCookingIandII)for the remaining two courses. Students may then apply the CEUcertificatetowardsfurthereducationatCIC.Iffurtheringstudies, the student must pass the Online ServSafe® Manager exam. Note: Some classes may be available in future terms.
Fundamentals of Baking I Basic baking techniques are covered including mixing methods,scaling,proofingandfinishing.Bakedgoodsproduced in the class include quick breads, artisan breads, breakfast pastries and assorted yeast dough products. Students learn baker’s percentage, costing and product yield. Prerequisite: Fundamentals of Culinary Arts
Fundamentals of Baking II Advanced baking techniques are explored including rolling, baggingandfinishing.Bakedgoodsproducedintheclassincludepies,tarts,cookies,cakes,frostingsandfillingsandbasic decorating techniques are covered. Students also have the opportunity to demonstrate basic plating and packaging techniques. Prerequisite: Fundamentals of Baking I
Fundamentals of Cooking I This course continues with the basics of cooking and includes moist, dry and combination cooking methods with beef, poultry, pork, lamb, game and seafood. Students gain experience with basic meat fabrication and safe and sanitary storage implementation. Prerequisite: Fundamentals of Culinary Arts
Fundamentals of Cooking II This course is a study of the cuisines of the world, including Asia, Europe, the Mediterranean and Africa. Students are exposedtohistory,culturalinfluencesandcommonrecipes.Students are given the opportunity to work in various cooking stations that represent cold and hot food preparation. Prerequisite: Fundamentals of Cooking I
Online ServSafe® ManagerThis independent study, online course helps you prepare fortheServSafeManagercertificationexam.Whenyou’rereadytotakethecertificationexam,youwillgotoaTridentTechnical College campus or site location and the exam will beproctoredbyaCulinaryInstituteofCharlestoncertifiedinstructor.
CREATIVE CAREERS
Cosmetology and Culinary Careers
Continuing Education Call Center – 843.574.6152 15
CREATIVE CAREERS
Culinary Careers, Floral Design and Interior Design
INTERIOR DESIGN
Interior Design Certif icateAppropriate for career-minded individuals, as well as home enthusiasts, this six-course program prepares students to work inthecommercialorresidentialinteriordesignfield.Learnhow to incorporate various design elements to create rooms that are functional, safe and beautiful. Gain experience using industry techniques and tools. Hear from working professionals howtolandthatfirstjoborstartanewbusiness.Coursescanbetakenindividuallyoraspartofthecertificatetrack.To earn a certificate, students are required to complete in the following order: Drafting Fundamentals; Interior Design Studio I; AutoCAD/Revit; Interior Design Studio II; Interior Design Studio III; and Interior Design Special Topics. Note: Some classes may be available in future terms.
Food Truck Operations Certif icate – NEW!Join us for a comprehensive training program for entrepreneurs looking to start a food truck or other mobile food/beverage business. This multi-disciplinary program providesowner/operatortrainingonavarietyoftopics:foodtruck operations and ownership considerations, ServSafe® Managercertification,QuickBooksforsmallbusiness,socialmedia promotion, and digital photography of food. While you can pick and choose the individual courses you need, students whoregisterforthisfive-coursecertificateprogramreceiveadiscountontheirregistrationfees.Thecertificateincludesthefollowingcourseswhichcanbecompletedinanyorder:Starting a Food Truck Business, Online ServSafe®Manager(seepg.14),QuickBooksLevel1andLevel2(seepg.9),Digital/SocialMediaMarketingforBusinessBootCamp(seepg.8),andFoodPhotography101(seepg.5).SAVE! Enroll in the certificate for only $1,799.
Starting a Food Truck Business This one-week boot camp guides you through the critical steps for starting and operating a mobile food and beverage business. Learn about equipment, safety, maintenance, licensingandpermitting,staffing,financialplanning,marketingand scaling up.
FLORAL DESIGN
Floral Design Certif icateThis three-course program is appropriate for those who aim toworkasprofessionalfloraldesignersorwhowishtonurturetheir creativity. With an emphasis on practical, hands-on training,thiscertificateprogramhelpsstudentsunderstandhowtoworkwithflowers,thefundamentalsofdesign,andhowdesignmethodsareappliedinavarietyoffloralstylesandarrangement formats. Courses can be taken individually or as apartofthecertificatetrack.To earn a certificate, students are required to complete in the following order: Floral Design I; Floral Design II; and Floral Design III. Required books and floral supplies are included in registration fees.
Floral Design I Learnthefundamentalsoffloraldesignincludingline,space, texture, form, color, composition, scale and balance. For those who wish to enter the industry or simply nurture their creative side, this class helps you recognize commonflowervarieties,createeverydayarrangements,andunderstandhowtohandleandcareforfreshflowers. Prerequisite: none; Location: Tiger Lily Florist, James Island; Materials included
Floral Design II Gethands-onexperiencecreatingfloralarrangementsin several popular advanced styles, including landscape, waterfall, Flemish, and English Garden. Color theory, permanents and accessories are also covered. Prerequisite: Floral Design I or permission; Location: Tiger Lily Florist, James Island; Materials included
Floral Design III Learntocreatethebouquets,personalflowers,spraysandarrangements, and other popular decorations associated with weddings, funerals, and other special events. Prerequisite: Floral Design II or permission; Location: Tiger Lily Florist, James Island; Materials included
LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus; SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available16
CREATIVE CAREERS
Interior Design
AutoCAD/Revit for Interior DesignApply fundamental concepts and techniques to computer-aided modeling software. Using your project from Design Studio I, learn computer drafting techniques and increase your understanding of computer-aided design programs such as AutoCAD and Revit.
AutoCAD/Revit for Interior DesignApply fundamental concepts and techniques to computer-aided modeling software. Using your project from Design Studio I, learn computer drafting techniques and increase your understanding of computer-aided design programs such as AutoCAD and Revit.
Interior Design Special TopicsExplore an array of advanced, interrelated design subjects. Topicsvaryandareselectedwithinputfromcurrentcertificateprogram students. Potential topics may include lighting
Course Dates
CosmetologyXCOS-50212970 CosmetologistCEU Jan.5 Su 8:30a.m.-4p.m. $69 TC
XCOS-50212971 CosmetologistCEU Feb.2 Su 8:30a.m.-4p.m. $69 TC
XCOS-50212972 CosmetologistCEU May18 M 8:30a.m.-4p.m. $69 TC
XCOS-50313183 LicensedCosmetologyInstructorCEU April26-27 SuM 8:30a.m.-4p.m. $175 TC
XCOS-50413185 NailTechandEstheticianCEU March15 Su 8:30a.m.-4p.m. $69 TC
Culinary ArtsXBKP-65012589 FundamentalsofBakingI Jan.13-March2 MTu 6-10p.m. $599 TC
XBKP-65112590 FundamentalsofBakingII March9-April21 MTu 6-10p.m. $599 TC
XCUL-65212591 FundamentalsofCookingI Jan.13-March2 MTu 5:30-9:30p.m. $599 TC
XCUL-65312592 FundamentalsofCookingII March9-April21 MTu 5:30-9:30p.m. $599 TC
XCUL-550 11274 Online ServSafe®Manager flexible flexible flexible $99 TBA
Floral DesignXARV-60112915 FloralDesignI March11-April15 W 6-8:30p.m. $495 OS
XARV-60212916 FloralDesignII May13-June17 W 6-8:30p.m. $480 OS
XARV-60812855 FloralDesignIII Jan.14-Feb.25 Tu 6-8:30p.m. $540 OS
XARV-60811271 FloralDesignIII Jan.15-Feb.26 W 6-8:30p.m. $540 OS
XARV-60812917 FloralDesignIII July1-Aug.5 W 6-8:30p.m. $540 OS
Food Truck OperationsXBUS-66112908 StartingaFoodTruckBusiness Feb.10-14 M-F 5-9p.m. $699 TC
XBUS-66112910 StartingaFoodTruckBusiness March9-13 M-F 5-9p.m. $699 BC
XBUS-66112911 StartingaFoodTruckBusiness April13-17 M-F 5-9p.m. $699 MP
XBUS-66112909 StartingaFoodTruckBusiness May11-15 M-F 8a.m.-noon $699 TC
XBUS-66112912 StartingaFoodTruckBusiness June8-12 M-F 5-9p.m. $699 PC
Interior DesignXARV-52912410 AutoCAD/RevitforInteriorDesign Jan.8-Feb.26 W 6:30-9:30p.m. $239 MP
XARV-70912472 InteriorDesignSpecialTopics April22-May11 MW 6:30-9:30p.m. $219 MP
XARV-70212411 InteriorDesignStudioII March2-April20 M 6:30-9:30p.m. $239 MP
XARV-70312585 InteriorDesignStudioIII May13-July1 W 6:30-9:30p.m. $239 MP
LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus; SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
design, utilization of color and texture, design of transitional spaces(indoor-to-outdoor),andincorporatingmaterialsandfurnishings.
Interior Design Studio IIExpand your creative and technical skills by designing a series of interior spaces for a hypothetical residential developer client. Learn to adapt to challenges in scale and layout, as well as how to design for future, unknown occupants.
Interior Design Studio IIIInthisprogramcapstonecourse,youcreateafinalprofessionalproject. Using the spaces you created in Interior Design Studio II, design a multi-story live/work complex with residential and commercial spaces. The overall design should be conceptual, with two spaces that are more fully realized. Also, students create a full materials board.
Continuing Education Call Center – 843.574.6152 17
BLS Healthcare ProviderThis eight-hour American Heart Association Basic Life Support Healthcare Provider Course teaches the skills of CPR for victimsofallages(includingventilationwithabarrierdevice,abag-maskdeviceandoxygen);useofanautomatedexternaldefibrillator(AED);andreliefofforeign-bodyairwayobstruction(FBAO).Books and face mask included
Certif ied Health Care Interpreter (Spanish) Effectiveinterpretationinthehealth,mentalhealthandhumanservices settings extends beyond bilingualism. To ensure accurate and complete communication between Hispanic patientsandproviders,thecertifiedmedicalinterpreter(Spanish)mustrecognizeandapplytherole,ethicsandskills of interpretation. This onsite program enables bilingual individuals to provide linguistically and culturally appropriate interpretation services in the medical, behavioral health and human services settings. Certification: Students who successfully complete the training are eligible to sit for the national certification exams administered by The Certification Commission for Healthcare Interpreters (CCHI) and The National Board of Certification for Medical Interpreter (NBCMI). Books included
Certif ied Nurse Aide (CNA) n Certifiednurseaides(CNAs)monitorandrecordvitalsignsandperform personal care skills including bathing, dressing and toileting; assisting with meals; transfers and ambulation; linen changes and room organization; and preventing safety issues by following facility policies and procedures. Certification: Students who successfully complete the training are eligible to sit for the SC Nurse Aide Certification exam approved by the National Council of State Boards of Nursing (NNAAP).Externship included
Dialysis Technician Dialysis technicians, also called hemodialysis technicians, work to cleanse the kidneys and blood of impurities for those experiencing acute or chronic renal failure. Certification: Graduates of this program may be eligible to take the Certified Clinical Hemodialysis Technician (CCHT) exam offered by the Nephrology Nursing Certification Commission (NNCC). Externship included; Books and materials not included
Electrocardiography (ECG) Mastery – NEW! This course focuses on the knowledge, skills and abilities needed to perform and interpret ECG monitoring of the heart in non-emergent and emergent settings. Learn the background information that includes understanding anatomy and physiology of the heart, cardiac rhythms, basics of ECG, and how to use ECG equipment. Call 843.574.6024 for course dates and to register.
Emergency Medical Technician (EMT) n Emergencymedicaltechnicians(EMTs)determinethenatureand extent of the patient’s condition while trying to ascertain whether the patient has preexisting medical problems. They give appropriate emergency care and, when necessary, transport the patient. Certification: TTC’s EMT courses are regulated by the SC Emergency Medical Services Department of the Division of Health and Environmental Control. Graduates of the courses are eligible to take the National Registry Examination. Externship included; Books and materials not included
First Aid, CPR and AED for IndustryLearnvaluablefirstaid,CPRandAEDskillsthatcanhelpyousave a life when every second counts. This course makes it easy to gain the skills you need to respond during cardiac or breathing emergencies. Students learn critical skills needed to respond to and manage an emergency until emergency medical services arrive. Skills covered in this course include firstaid,chokingrelief,andwhattodoforsuddencardiacarrest.
HEALTH CARE
Careers in Patient Care, CPR and Skills Enhancement
LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus; SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available18
LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus; SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
Careers in Patient Care, CPR and Skills Enhancement
,IV Catheter InsertionLearn the correct technique of peripheral IV catheter insertion. Topics include vein location and IV placement, equipment and supplies, insertion, anchoring techniques and connecting to IV tubing. Students perform lab skills on IV therapy mannequin arms. Students are awarded a certificate upon completion. Lab supplies included.
Medical Assistant (MA) Medical assistants perform routine administrative and clinicaltaskstokeeptheofficesofphysicians,chiropractorsand other health practitioners running smoothly. Clinical duties may include taking medical histories; recording vital signs; taking electrocardiograms; collecting and preparing laboratory specimens or performing basic laboratory tests on the premises; and more. Administrative duties may include updatingandfilingpatients’medicalrecordsandinsuranceforms; arranging for hospital admission and laboratory services; handling billing; and submitting prescriptions to a pharmacy. Certification: Students completing the program are eligible to sit for the Registered Medical Assistant exam given by the American Medical Technologists Association. Externship included; Books and materials not included
HEALTH CARE
Ophthalmic Assistant – NEW! Ophthalmic medical assistants are the stability of any ophthalmologyofficeorinstitution.Theygreetpatientsandestablish and evaluate their medical and optical problems. Ophthalmic assistants then do necessary testing, all while making the patient feel at ease before presenting them to the ophthalmologist. Certification: After completing the program and 500 hours of clinical experience, the graduate can take the exam for certified medical assistant. After 2,000 hours of clinical experience the individual can complete the written and practical exam to be certified as an ophthalmic technician with the International Joint Commission on Allied Health Personnel in Ophthalmology (IJCAHPO).
Patient Care Technician (PCT) n Thepatientcaretechnician(PCT)courseisdesignedtoexpand the skill set of a CNA with advanced knowledge necessary for transition into a hospital setting. The course consists of introduction to hospital equipment and supplies, aswellasadvancedskillsinthefollowingareas:12-leadEKG, basic phlebotomy, performing urinary catheterization, infection control, glucometer use, sterile technique, specimen collectionandhandling,measuringoutputofbodilyfluidsincluding chest tubes and surgical site drains, tracheotomy andsupplementaloxygencare,andBLScertificationandtraining. Certification: A certificate of completion and BLS card are awarded upon successful completion of the program. Strict attendance is required and first day of orientation is mandatory. Prerequisites: Successful completion of TTC CNA Training Program; Materials not included
Phlebotomist n Phlebotomists are specialized clinical support workers who collect blood from patients for laboratory testing. Phlebotomists work in hospitals, commercial laboratories, privatephysicianoffices,publichealthdepartments,clinicsand blood banks. Certification: Students must complete 72 hours of classroom training in addition to 120 hours of clinical training. Once you have completed both portions successfully, you are eligible to sit for the ASCP Certification exam. ACCUPLACER placement test and current SC SLED background check are required to enroll. Externship included
Continuing Education Call Center – 843.574.6152 19
HEALTH CARE
Careers in Patient Care, CPR and Skills Enhancement
Course DatesXAHS-50413223 BLSHealthcareProvider Jan.20 M 6-10p.m. $65 TC
XAHS-50413224 BLSHealthcareProvider March23 M 6-10p.m. $65 TC
XAHS-50413225 BLSHealthcareProvider May18 M 6-10p.m. $65 TC
XAHS-50413226 BLSHealthcareProvider July27 M 6-10p.m. $65 TC
XITP-50113351 CertifiedHealthCareInterpreterTraining(Spanish) Feb.28-April3 F 6-9p.m. $885 TC
CertifiedHealthCareInterpreterTraining(Spanish) Feb.29-April4 Sa 9a.m.-5p.m. TC
XITP-50113352 CertifiedHealthCareInterpreterTraining(Spanish) June19-July24 F 6-9p.m. $885 TC
CertifiedHealthCareInterpreterTraining(Spanish) June20-July25 Sa 9a.m.-5p.m. TC
XNUR-50113281 CertifiedNurseAideTraining(Classroom) Jan.6-Feb.3 M-Th 8a.m.-1p.m. $949 TC
CertifiedNurseAideTraining(Clinical) Feb.4-20 M-Th 6:45a.m.-noon OS
XNUR-50113282 CertifiedNurseAideTraining(Classroom) Jan.21-Feb.25 M-Th 5-9p.m. $949 TC
CertifiedNurseAideTraining(Clinical) Feb.26-March12 M-Th 4-9p.m. OS
XNUR-50113284 CertifiedNurseAideTraining(Classroom) Feb.4-March5 TuTh 8a.m.-4p.m. $949 TC
CertifiedNurseAideTrainingProgram(Clinical) March9-17 M-Th 6:45a.m.-3p.m. OS
XNUR-50113298 CertifiedNurseAideTraining(Classroom) March9-April9 M-Th 8a.m.-1p.m. $949 TC
CertifiedNurseAideTraining(Clinical) April13-28 M-Th 6:45a.m.-noon OS
XNUR-50113355 CertifiedNurseAideTraining(Classroom) April6-May7 M-Th 5-9p.m. $949 TC
CertifiedNurseAideTraining(Clinical) May11-27 M-Th 4-9p.m. OS
XNUR-50113356 CertifiedNurseAideTraining(Classroom) April27-May21 M-Th 8a.m.-1p.m. $949 TC
CertifiedNurseAideTraining(Clinical) May26-June11 M-Th 6:45a.m.-3p.m. OS
XNUR-50113358 CertifiedNurseAideTraining(Classroom) June1-22 MWTh 8a.m.-4p.m. $949 TC
CertifiedNurseAideTraining(Clinical) June23-July2 Tu-Th 6:45a.m.-3p.m. OS
XAHS-50213239 DialysisTechnician(Classroom) Feb.10-April8 MW 5-9p.m. $2,285 TC
DialysisTechnician(Clinical) April13-May8 M-F 6a.m.-3p.m. OS
XAHS-50213251 DialysisTechnician(Classroom) April20-June24 MW 5-9p.m. $2,285 TC
DialysisTechnician(Clinical) June29-July24 M-F 6a.m.-3p.m. OS
XEMS-50113227 EmergencyMedicalTechnician(EMT)Basic Jan.17-May8 F 8a.m.-5p.m. $1,150 TC (meetseveryotherSaturday) Jan.25-May2 Sa 8a.m.-5p.m.
XEMS-50113482 EmergencyMedicalTechnician(EMT)Basic June19-Oct.10 F 8a.m.-5p.m. $1,150 TC (meetseveryotherSaturday) June27-Oct.10 Sa 8a.m.-5p.m.
XEMS-50813229 EMTBasicInternet-BasedwithLab(Lab) Feb.18-Aug.18 Tu 6-10p.m. $1,150 TC
XAHS-55013129 FirstAid,CPRandAEDforIndustry March20 F 8a.m.-4p.m. $279 TC
XAHS-55013196 FirstAid,CPRandAEDforIndustry June4 Th 8a.m.-4p.m. $279 TC
XNUR-50413217 IVCatheterInsertion Feb.1 Sa 9a.m.-3p.m. $139 TC
XNUR-50413218 IVCatheterInsertion March28 Sa 9a.m.-3p.m. $139 TC
XNUR-50413219 IVCatheterInsertion May16 Sa 9a.m.-3p.m. $139 TC
XMED-50113204 MedicalAssistant(MA)Training(Classroom) Jan.20-June10 M-Th 9a.m.-2p.m. $3,695 TC
MedicalAssistant(MA)Training(Clinical) June15-July10 M-F 8a.m.-5p.m. OS
XMED-50113206 MedicalAssistant(MA)Training(Classroom) March2-July21 M-Th 4:30-9:30p.m. $3,695 TC
MedicalAssistant(MA)Training(Clinical) July27-Aug.21 M-F 8a.m.-5p.m. OS
XMED-50113205 MedicalAssistant(MA)Training(Classroom) June22-Nov.12 M-Th 9a.m.-2p.m. $3,695 TC
MedicalAssistant(MA)Training(Clinical) Nov.23-Dec.22 M-F 8a.m.-5p.m. OS
XOPH-50113512 OphthalmicAssistantProgram Jan.20-Feb.20 M-Th 6-9p.m. $949 TC
XOPH-50113513 OphthalmicAssistantProgram April13-May14 M-Th 6-9p.m. $949 TC
XNUR-50313359 PatientCareTechnician Feb.3-March19 M-Th 8a.m.-noon $899 TC
XNUR-50313360 PatientCareTechnician March31-May14 M-Th 8a.m.-noon $899 TC
XNUR-50313361 PatientCareTechnician May27-July2 M-Th 8a.m.-noon $899 TC
XAHS-53013362 PhlebotomyTraining(Classroom) Jan.10-March27 F 9a.m.-3p.m. $1,499 TC
PhlebotomyTraining(Clinical) March31-June4 TuTh 8a.m.-2p.m. OS
XAHS-53013363 PhlebotomyTraining(Classroom) March2-April29 MW 5:30-9:30p.m. $1,499 TC
PhlebotomyTraining(Clinical) May4-July8 MW 8a.m.-2p.m. OS
XAHS-53013364 PhlebotomyTraining(Classroom) May1-July24 F 9a.m.-3p.m. $1,499 TC
PhlebotomyTraining(Clinical) July28-Oct.1 TuTh 8a.m.-2p.m. OS
20LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
Upon successful completion of these programs, students may be eligible to take certification exams through various certifying organizations.
ABBREVIATIONS KEY:AAPC=American Academy of Professional CodersACDIS=Association of Clinical Documentation Improvement
SpecialistsAHIMA=American Health Information Management
AssociationAMT=American Medical TechnologistsCCA=Certified Coding AssociateCCDS=Certified Clinical Documentation SpecialistCDIP=Certified Documentation Improvement PractitionerCMAS=Certified Medical Administrative SpecialistCPC=Certified Professional Coder
Certif ied Professional Coder (CPC) Learn in six months the principles and guidelines for assigning the appropriate medical codes to diagnostic conditions and medicalproceduresasacertifiedprofessionalcoder.Medicalterminology, anatomy, physiology and HIPAA guidelines also are included. The hybrid program prepares students for a careerworkingasacertifiedcoderinanoutpatientmedicaloffice.Certification: CPC exam through AAPC; Books not included
Coding for Health Care Professionals (CHCP) This 12-month online coding for health care professionals (nurses,healthcareadministrators,paramedics)programallows participants to add to their skillsets and move into codingcareers.Thecodingfieldisgrowingfasterthanaveragedue to mandatory electronic health records, health information managementchangesandtheAffordableCareAct.Certification: CCA exam through AHIMA and CPC exam through AAPC; Books not included
Coding Specialist (CS) This 15-month online coding specialist program covers inpatient and outpatient coding of patient’s medical records. The coding specialist is responsible for translating diagnostic and procedural information used by health care providers into coded form for medical reimbursement purposes. The greater the expertise of the coder the greater reimbursement to a health care facility. Certification: CCA exam through AHIMA and CPC exam through AAPC; Books not included
Medical Office Specialist (MOS) Medicalofficespecialistsholdadministrativeandclericalpositions in a health care setting. The MOS may answer telephones,greetpatients,updateandfilepatientmedicalrecords,filloutinsuranceforms,handlecorrespondenceandscheduleappointments.TheMOSworksinphysicianoffices,hospitals and nursing homes. Certification: CMAS exam through AMT; Note: Student must present current SC SLED background report to enroll. Visit www.sled.sc.gov. Students also are required to have internet access outside of the college as training includes online course work. Externship included; Books and materials not included
Medical Scribe Specialist Medical scribes assist physicians during patient interactions byrecordinginformationinelectronichealthrecords(EHR)inrealtime.Medicalscribesincreaseefficiencyformedicalofficeswith the knowledge and experience of medical terminology to record patient information, test results and medications so the physician can spend more time communicating with the patient. This eight-week hybrid program is online and includes two Saturdays on campus. Books and materials not included
HEALTH CARE
Health Information Management Careers
Continuing Education Call Center – 843.574.6152 21
HEALTH CARE
Health Information Management Careers
Course Dates
XHIM-52612894 CertifiedProfessionalCoder(Online) Feb.10-March28 online 24/7access $2,279 OL
CertifiedProfessionalCoder(Classroom) April1-June29 MW 5-9p.m. TC
XCPT-51212885 CHCP1–OnlineLearningIntroduction Jan.20-25 online 24/7access $69 OL
XAHS-50712886 CHCP2–MedicalTerminology Jan.27-March14 online 24/7access $285 OL
XHIM-51312888 CHCP3–HealthCareDataContent March16-May2 online 24/7access $285 OL
XHIM-56412889 CHCP4–ICD-10Coding May4-July25 online 24/7access $339 OL
XHIM-51812890 CHCP5–CPT-4CodingBasicPart1 March2-April25 online 24/7access $319 OL
XHIM-51812891 CHCP5–CPT-4CodingBasicPart1 July27-Sept.19 online 24/7access $319 OL
XHIM-51912892 CHCP6–CPT-4CodingAdvancedPart2 April27-June20 online 24/7access $319 OL
XHIM-52012893 CHCP7–Practicum June22-July11 online 24/7access $285 OL
XCPT-50112870 CSTerm1.1– Jan.13-24 online 24/7access $69 OL
Online Learning Introduction
XAHS-52212871 CSTerm1.2–MedicalTerminology Jan.27-March14 online 24/7access $285 OL
XAHS-58912872 CSTerm1.3–AnatomyandPhysiology Jan.27-March14 online 24/7access $285 OL
XAHS-52312873 CSTerm1.4–Pharmacology March16-May2 online 24/7access $285 OL
XAHS-52412874 CSTerm1.5–HumanDiseases March16-May2 online 24/7access $285 OL
XHIM-50512876 CSTerm2.1–HealthCareDataContent Jan.6-Feb.22 online 24/7access $285 OL
XHIM-50512875 CSTerm2.1–HealthCareDataContent May4-June20 online 24/7access $285 OL
XHIM-51112877 CSTerm2.2–ElectronicHealthRecords Jan.6-Feb.22 online 24/7access $285 OL
XHIM-51112878 CSTerm2.2–ElectronicHealthRecords May4-June6 online 24/7access $285 OL
XHIM-56212879 CSTerm2.3–ICD-10Coding Feb.24-May16 online 24/7access $339 OL
XHIM-56212880 CSTerm2.3–ICD-10Coding June22-Aug.29 online 24/7access $339 OL
XHIM-50912881 CSTerm3.1–CPTCodingPart1 May18-July11 online 24/7access $319 OL
XHIM-51012882 CSTerm3.2– July13-Sept.5 online 24/7access $319 OL
CPT Coding Advanced Part 2
XHIM-50812096 CSTerm3.3– Jan.13-March7 online 24/7access $285 OL
Understanding Health Insurance
XHIM-51212097 CSTerm3.4– March9-May2 online 24/7access $339 OL
Coding Externship – Online
XMED-50612895 MedicalOfficeSpecialist(Classroom) March9-May27 MW 9a.m.-3:30p.m. $2,639 TC
MedicalOfficeSpecialist(Externship) June1-26 M-F 8a.m.-5p.m. OS
XSCR-51712896 MedicalScribeSpecialist(Classroom) Feb.1andFeb.29 Sa 10a.m.-2p.m. $739 TC
MedicalScribeSpecialist.(Online) Feb.1-March21 online 24/7access OL
XSCR-51712897 MedicalScribeSpecialist(Classroom) May9andMay23 Sa 10a.m.-2p.m. $739 TC
MedicalScribeSpecialist.(Online) May9-June27 online 24/7access OL
22LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
Massage Therapy Certif icate n Learn a range of massage techniques, including basic spa and neuromuscular clinical massage, to become a licensed massagetherapist(LMT).The650-hourcurriculumcoversthefundamentals of human anatomy and physiology, massage law and ethics, kinesiology, and practical application of spa and neuromuscular technique. You also practice acquired techniques in a hands-on clinical setting. Certification: Upon completion of this program, candidates are eligible to take the national certification examination, MBLEx (Federation of State Massage Therapy Boards), and apply for state licensure once receiving a passing score. Prerequisites for program admission: proof of high school diploma or GED and 18 years of age or older; Books not included
XMTH-501 $4,399
ID#12714 Jan.13-June19 M-F 8:30a.m.-3p.m. TCID#13208 Feb.3-Nov.10 M-Th 5-9:30p.m. TC Feb.8-Nov.7 Sa 8:30a.m.-3p.m TC
Massage Therapy: Caring for the Mother Prenatal Certif icateThis six-hour course introduces Prenatal Massage in all trimesters. Students learn how to properly position an expectant mother through the end of pregnancy and how toappropriatelyapplyspecificmassagetechniques.Atthe completion of this course, the therapist knows how to accurately and safely administer massage without fear.
Contraindicationsandmodificationsarecoveredforalltrimesters and structural bodywork is demonstrated as well. This course is approved by SCLLR for six CEUs. Prerequisite: must be a SC-licensed massage therapist
XMTH-506 $150
ID#13911 March29 Su 9a.m.-3:30p.m. TC
Massage Therapy: Treating TMJ DysfunctionLearn the anatomy and physiology of the temporomandibular joint(TMJ).UnderstandthecausesofTMJDysfunction,andproperly execute external and intraoral techniques to treat. Use universal precautions as it pertains to intraoral work. Prerequisite: must be a SC-licensed massage therapist
XMTH-505 $99
ID#13280 Feb.23 Su 9a.m.-2:30p.m. TC
Reiki Introduction and Reiki ILearn the ancient healing art of Usui Reiki, a gentle and complementary energy modality. This class incorporates a combination of lecture, discussion, demonstration and hands-on practice. Topics include treatments, origin and history of Reiki, the Reiki ideals and Usui hand positions. Instructor is an Usui/Holy Fire III Reiki Master Teacher and includes student demonstrations. This course is state-approved for massage therapy CEUs. No books required
XMTH-601 $139
ID#12900 Feb.22 Sa 9a.m.-4:30p.m. TC
Reiki Usui/Holy Fire IISecond-degreeReikifocusesandintensifiesReikienergy.Review Reiki I material, receive Usui Reiki II symbols and explanation of their usage, and learn how to perform distant healing.Attunementsandcertificateareincluded.Instructorisan Usui/Holy Fire III Reiki Master Teacher and includes student demonstrations. This course is state-approved for massage therapy CEUs. Prerequisite: Reiki Introduction and Reiki I; Reiki I practitioners who did not complete their initial class with us must bring a copy of their Reiki I certificate to class; No books required
XMTH-602 $235
ID#12901 Feb.29 Sa 9a.m.-4:30p.m. TC
HEALTH CARE
Massage Therapy
Continuing Education Call Center – 843.574.6152 23
Endoscope Reprocessor Endoscopic technicians and sterile processing technicians cannowaddthiscertificationtotheirskillsetandbecomenationallycertifiedinflexibleendoscopereprocessingthrough this interactive online program. To enroll, students mustbecurrentlyworkingintheendoscopyfieldandhave a minimum of three months experience reprocessing andsterilizingflexibleendoscopes.Flexibleendoscope,orGIscopereprocessingcertification,isanadvanced,in-demand skill in local hospitals and is recognized by The Joint Commission. Certification: Flexible Endoscope Reprocessor (GI Scope) Certification exam through Certification Board for Sterile Processing and Distribution, Inc. and/or Certified Endoscope Reprocessor exam through International Association of Healthcare Central Service Material Management
Medical Lab Assistant (MLA) n Themedicallabassistant(MLA)worksinalaboratorysettingassisting in patient registration and specimen collection, specimen preparation and processing, support for clinical testing, waived and point-of-care testing, and laboratory operations. Certification: Medical Laboratory Assistant exam through American Society for Clinical Pathology Externship included
Pharmacy Technician (PhT) Pharmacy technicians assist the pharmacist in packing and distributingmedication.Graduatescanfindemploymentinhospitals, nursing care facilities, private and chain drug stores, drug manufacturers, wholesale drug houses and health maintenance organizations. Certification: Graduates’ names are submitted to the Pharmacy Technician Certification Board to be considered as a candidate to sit for the Certified Pharmacy Technician exam. They are also submitted to the S.C. Department of Labor, Licensing and Regulation and SC Board of Pharmacy for registration as a pharmacy technician. Registration: Program classes can be purchased all at one time (XPHM-510) or on a class-by-class basis. Externship included
Sterile Processing Technician (SPT) n Sterile processing technicians clean, disinfect and sterilize surgical instruments in hospitals and outpatient surgery centers. SPTs also order, inventory and test equipment for reuse. Learn medical terminology, anatomy, infection control, safety, as well as HIPAA and OSHA guidelines. Certifications: Certified Sterile Processing and Distribution Technician exam through Certification Board for Sterile Processing and Distribution, Inc. and Certified Registered Central Service Technician exam through International Association of Healthcare Central Service Material Management; Note: Student must present current SC SLED background report to enroll. Visit www.sled.sc.gov. Externship included
HEALTH CARE
Non-Patient Care Careers
Course Dates
XSUR-50312899 EndoscopeReprocessorCertification Feb.24-March28 online 24/7access $389 OL
XMLT-50113369 MedicalLabAssistant(Classroom) Feb.3-May6 MW 5:30-9:30p.m. $2,285 TC
MedicalLabAssistant(Clinical) May11-July15 MWF 8a.m.-3p.m. OS
XPHM-51013381 PharmacyTechnician(Classroom) Jan.14-April23 TuTh 5:30-9:30p.m. $4,995 TC
PharmacyTechnician(Online) Jan.14-April23 online 24/7access OL
PharmacyTechnician(Clinical) May26-Aug.21 M-F 8a.m.-3p.m. OS
XPHM-51013380 PharmacyTechnician(Classroom) Jan.14-April23 TuTh 9a.m.-1p.m. $4,995 TC
PharmacyTechnician(Online) Jan.14-April23 online 24/7access OL
PharmacyTechnician(Clinical) May26-Aug.21 M-F 8a.m.-3p.m. OS
XSUR-50112898 SterileProcessingTechnician Feb.6-April30 TuTh 4-8p.m. $1,639 MP
(Classroom)
Sterile Processing Technician May 4-15 M-F 7 a.m.-3 p.m. OS
(Externship)
24LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars ; = Payment Plan Available
CONSTRUCTION AND ENGINEERING
Heavy Equipment Operator Program n Learnhowtooperateavarietyofdifferenttypesofheavyequipment used in the construction industry including a bulldozer,backhoeandexcavator.Becomemoreproficientin environmental/soil awareness, compaction operation and safety. All content is based on NCCER assessments. Program includes OSHA Construction Industry Safety 10-hour and Trench Safety.
XBCT-502 $4,500
ID#13123 Feb.3-28 M-F 8a.m.-4:30p.m. TBAID#13136 April20-May15 M-F 8a.m.-4:30p.m. TBA
Licensed Residential Builder Exam Preparation Obtain the knowledge needed to become a licensed residential builder in South Carolina. The course is designed to assist you in your preparation to take the South Carolina Builder exam. Registration deadline is the Friday before class begins. Books not included
XBCT-503 $499
ID#13086 Jan.16-18 Th-Sa 8a.m.-4:30p.m. TCID#13113 Feb.27-29 Th-Sa 8a.m.-4:30p.m. TCID#13117 April9-11 Th-Sa 8a.m.-4:30p.m. TC
Limited General Contractor Exam Preparation Learn what you need to know to become a South Carolina-licensed limited general contractor. This course covers concrete and masonry, types of metals, envelope protection, doors and windows, blueprint reading and safety. Registration deadline is the Friday before class begins. Books not included
XBCT-504 $499
ID#13087 Jan.30-Feb. 1 Th-Sa 8 a.m.-4 p.m. TCID#13116 March 19-21 Th-Sa 8 a.m.-4 p.m. TCID#13118 April 23-25 Th-Sa 8 a.m.-4 p.m. TC
MANUFACTURING, INDUSTRIAL AND CONSTRUCTION TRADES
Construction/Engineering and Supply Chain
Masonry Introduction – NEW! This journeyman-level masonry training covers how to build, maintainandrepairblockandbrickedifices;mixandapplymortar, plaster and grout; safely use hand and power tools in accordance with regulatory and industry standards; utilize construction drawings to build with block and brick as well as estimate costs of materials; relevant building codes as they pertain to masonry construction; principals and applications behind reinforcing materials and techniques; and design and construction and how to build various structural elements and architectural features commonly used in masonry construction.
XMSY-501 $4,999
ID#13976 Jan. 27-April 1 MW 9 a.m.-1 p.m. TC
SUPPLY CHAIN
Certif ied Logistics Associate (CLA) n This course covers the global supply chain logistics life cycle, logistics environment, material handling equipment, safety principles, safe material handling and equipment operation, workplace communications, quality control principles, teamwork, and workplace behavior to solve problems. Forklift training is not included. This course is a prerequisite for CLT. Materials included
XLOG-502 $799
ID#13317 Jan. 15-Feb. 5 W 6-9 p.m. TCID#13319 April 8-29 W 6-9 p.m. TC
Certif ied Logistics Technician (CLT) n ThisisanadvancedclassforobtainingtheCertifiedLogisticsTechnicianCertification.Topicsincludeproductreceiving,product storage, order processing, packaging and shipment, inventory control, safe handling of HAZMAT materials, evaluation of transportation modes, dispatch and tracking, and metric conversion. Forklift training is not included. Prerequisite: successful completion of CLA; Materials included
XLOG-503 $899
ID#13321 Feb. 19-March 25 W 6-9 p.m. TCID#13322 May 13-June 17 W 6-9 p.m. TC
Continuing Education Call Center – 843.574.6152 25
Asbestos AsbestoscoursesofferedthroughTTCmeetallrequirementsfor SCDHEC licensing and EPA AHERA/ASHARA accreditation. Initial courses may be required for workers involved with repair and maintenance activities that may disturb asbestos containing materials or building materials that are presumed to contain asbestos during their normal work activities. Refresher classes also are available for workers to keep their licensing up-to-date. Materials included
HAZWOPER 24-hour and 40-hour initial training courses are available as well as the 8-hour refresher. HAZWOPER training is required for employees visiting an uncontrolled hazardous waste operation mandated by the government. Materials included
MANUFACTURING, INDUSTRIAL AND CONSTRUCTION TRADES
Environmental
Course Dates
XEVT-56413301 AsbestosCementPipeWorker Jan.15 W 8a.m.-4:30p.m. $199 TC
XEVT-56413303 AsbestosCementPipeWorker April7 Tu 8a.m.-4:30p.m. $199 TC
XEVT-50113315 AsbestosInspectorInitial March9-11 M-W 8a.m.-4:30p.m. $650 TC
XEVT-50613875 AsbestosInspectorRefresher March5 Th 8a.m.-noon $149 TC
XEVT-50613876 AsbestosInspectorRefresher April30 Th 8a.m.-noon $149 TC
XEVT-51013313 AsbestosManagement March5 Th 8a.m.-4:30p.m. $249 TC
Planner/Inspector Refresher
XEVT-51013314 AsbestosManagement April30 Th 8a.m.-4:30p.m. $249 TC
Planner/Inspector Refresher
XEVT-50313294 AsbestosOandMWorkerInitial Jan.13-14 MTu 8a.m.-4:30p.m. $299 TC
XEVT-50313299 AsbestosOandMWorkerInitial April14-15 TuW 8a.m.-4:30p.m. $299 TC
XEVT-50813307 AsbestosOandMWorkerRefresher March3 Tu 8a.m.-4:30p.m. $199 TC
XEVT-50813308 AsbestosOandMWorkerRefresher April28 Tu 8a.m.-4:30p.m. $199 TC
XEVT-50413305 AsbestosSupervisorInitial Feb.17-21 M-F 8a.m.-4:30p.m. $799 TC
XEVT-50413306 AsbestosSupervisorInitial June15-19 M-F 8a.m.-4:30p.m. $799 TC
XEVT-50913311 AsbestosSupervisorRefresher March4 W 8a.m.-4:30p.m. $219 TC
XEVT-50913312 AsbestosSupervisorRefresher April29 W 8a.m.-4:30p.m. $219 TC
XEVT-50213304 AsbestosWorkerInitial Feb.4-7 Tu-F 8a.m.-4:30p.m. $499 TC
XEVT-50213316 AsbestosWorkerInitial June2-5 Tu-F 8a.m.-4:30p.m. $499 TC
XEVT-50713309 AsbestosWorkerRefresher March3 Tu 8a.m.-4:30p.m. $199 TC
XEVT-50713310 AsbestosWorkerRefresher April28 Tu 8a.m.-4:30p.m. $199 TC
XEVT-53113124 HAZWOPER24-hour March4-6 W-F 8a.m.-4p.m. $559 TC
XEVT-53213357 HAZWOPER40-hour March9-12 M-Th 8a.m.-6p.m. $799 TC
XEVT-53213137 HAZWOPER40-hour May26-29 Tu-F 8a.m.-6p.m. $799 TC
XEVT-536 11272 HAZWOPER 40-hour –Online Flexible online 24/7access $249 OL
XEVT-53313126 HAZWOPERRefresher8-hour March13 F 8a.m.-4p.m. $259 TC
XEVT-53313193 HAZWOPERRefresher8-hour June1 M 8a.m.-4p.m. $259 TC
XEVT-538 11273 HAZWOPER Refresher 8-hour –Online Flexible online 24/7access $59 OL
26LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars ; = Payment Plan Available
MANUFACTURING, INDUSTRIAL AND CONSTRUCTION TRADES
Industrial Safety
Course Dates
XEVT-54813127 ConfinedSpaceforConstruction March16 M 8a.m.-4p.m. $499 TC
XEVT-54813194 ConfinedSpaceforConstruction June2 Tu 8a.m.-4p.m. $499 TC
XEVT-54713128 ConfinedSpaceforGeneralIndustry March18 W 8a.m.-4p.m. $499 TC
XEVT-54713195 ConfinedSpaceforGeneralIndustry June3 W 8a.m.-4p.m. $499 TC
XEVT-55113120 MSHANewMiner Jan.22 W 8a.m.-4p.m. $279 TC
XEVT-55113133 MSHANewMiner April8 W 8a.m.-4p.m. $279 TC
XEVT-54613131 OSHAConstructionIndustry March26-27 ThF 8a.m.-1p.m. $279 TC
Safety 10-hour
XEVT-54613198 OSHAConstructionIndustry June11-12 ThF 8a.m.-1p.m. $279 TC
Safety 10-hour
XEVT-54513122 OSHAConstructionIndustry Jan.27-30 M-Th 8a.m.-4p.m. $679 TC
Safety 30-hour
XEVT-54513135 OSHAConstructionIndustry April13-16 M-Th 8a.m.-4p.m. $679 TC
Safety 30-hour
XEVT-53413130 OSHAGeneralIndustrySafety10-hour March23-24 MTu 8a.m.-1p.m. $279 TC
XEVT-53413197 OSHAGeneralIndustrySafety10-hour June8-9 MTu 8a.m.-1p.m. $279 TC
XEVT-53513132 OSHAGeneralIndustrySafety30-hour March30-April2 M-Th 8a.m.-4p.m. $679 TC
XEVT-53513199 OSHAGeneralIndustrySafety30-hour June15-18 M-Th 8a.m.-4p.m. $679 TC
XEVT-54913121 TrenchSafety Jan.23 Th 8a.m.-4p.m. $499 TC
XEVT-54913134 TrenchSafety April9 Th 8a.m.-4p.m. $499 TC
Confined Space Training Ifoneofyourco-workerspassedoutinaconfinedspace,would you go in to rescue him? Can you be sure the air in the spaceissafe?Understandtherisksassociatedwithconfinedspaces and the procedures your employer has in place to protect you and those around you. Learners include anyone whoworksinoraroundconfinedspaces.
MSHA New Miner This course provides instruction on MSHA regulations and requirements as they apply to new miners in the industry, including recognizing health and safety hazards, minimizing accidents and injuries and MSHA compliance.
OSHA Construction Industry Safety Most workers in construction, building development and otherrelatedfieldsneedtotakehazardrecognitiontraining.During this course students receive instruction on industry hazards, OSHA’s Focus Four, material handling hazards, OSHA-sanctioned employer responsibilities, hand and power tool hazards, OSHA-supported worker’s rights, PPE, and more pertaining to OSHA Construction Safety.
OSHA General Industry Safety 10-hour training courses for entry-level workers and 30-hourtrainingcoursesforsafetydirectors,foremenandfieldsupervisors are available. Materials included
Trench Safety Excavation and trenching are among the most hazardous construction operations. This course highlights key elements of the OSHA excavation standards and describes safe work practices that can protect workers from cave-ins and other hazards.
Continuing Education Call Center – 843.574.6152 27
CNC Operator n Thebootcampcoverssafety,shopfloorcalculations,measurement and gaging, machining fundamentals, quality assurance, communications, material composition, and CNC(computernumericalcontrol)millandlatheoperations.Then learn advanced hands-on manufacturing skills including inspection, CNC basic and advanced, and basic CAM(computer-aidedmanufacturing).InstructionisalsoprovidedinOSHA’sSafetyandDataSheets(SDS)andgeneralmaintenance of CNC equipment. Students will be well versed in the industry upon successful completion of advanced programs with the ability to compete in a global environment.
Composites Technician Learn the basics of composites safety as well as the processes used to create products from composite materials. The introduction class focuses on material composition, resins, layup, vacuum bagging and curing. Then expand your composites knowledge with the comprehensive intermediate course on proper handling of composite materials, intermediate/advanced vacuum bagging techniques, inspecting and repairing composite parts. Materials included
MANUFACTURING, INDUSTRIAL AND CONSTRUCTION TRADES
Production, Equipment and Machinery Training
Fiber Optics Certif ications TTCoffersthreelevelsofcertificationpreparationclassroomcourses:CertifiedFiberOpticsTechnicianCourse(CFOT);CertifiedFiberOpticsSpecialist:TestingandMaintenance(CFOS/T);andCertifiedFiberOpticsSplicingSpecialist(CFOS/S). Books and supplies included
• The CFOT introductory course is designed for anyone interestedinlearningbasicfiberopticnetworkingandbecomingacertifiedfiberopticstechnician.Learnhowtoidentifyfibertypes;recognizevariousconnectorsusedinfiberinstallation;andinstall,terminate,splice,andproperlytestinstalledfibercabletoexistingstandards.This course is a prerequisite for all other fiber optics advanced courses.
• The CFOS/T course explains the variety of testing standards, equipment and technological approaches used infibernetworktestingandsplicingandhowtochooseamong them. Prerequisite: Certified Fiber Optics Technician Course (CFOT)
• The CFOS/S course explains the importance of high performance splicing and further details the points necessary to achieve these splices. Prerequisite: Certified Fiber Optics Specialist: Testing and Maintenance (CFOS/T)
Forklift Training Learn the correct care and use of forklift trucks including the OSHA Powered Industrial Truck Standard, 29CFR1910.178, which covers forklift design limitations, uses in material handling, pre-operation check, operator skills and accident prevention. Certification: Upon successful completion of the course, you receive a three-year certification in forklift driving/operation skills. Materials included
HVAC Maintenance, Repair and Certif ication nLearn techniques and procedures in troubleshooting, making repairs and performing scheduled preventive maintenance on residential air conditioning and electric heating equipment. Continue on to learn more advanced methods in the Mechanical Systems course. Then get prepared to take the EPAcertificationexamforrefrigeranthandlingandrecoveryforstationary equipment.
28LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars ; = Payment Plan Available
MANUFACTURING, INDUSTRIAL AND CONSTRUCTION TRADES
Production, Equipment and Machinery Training
Course Dates
XTEL-50213215 CertifiedFiberOptics March28-29 SaSu 8a.m.-5p.m. $795 TC
SplicingSpecialist(CFOS/S)
XTEL-50213216 CertifiedFiberOptics July13-14 MTu 8a.m.-5p.m. $795 TC
SplicingSpecialist(CFOS/S)
XTEL-50113209 CertifiedFiberOptics March23-25 M-W 8a.m.-5p.m. $895 TC
TechnicianCourse(CFOT)
XTEL-50113211 CertifiedFiberOptics July8-10 W-F 8a.m.-5p.m. $895 TC
TechnicianCourse(CFOT)
XTEL-50313212 CertifiedFiberOpticsSpecialist: March26-27 ThF 8a.m.-5p.m. $795 TC
TestingandMaintenance(CFOS/T)
XTEL-50313214 CertifiedFiberOpticsSpecialist: July11-12 SaSu 8a.m.-5p.m. $795 TC TestingandMaintenance(CFOS/T)
XMTT-51613076 CNCAdvanced–5Axis Feb.18-March3 TuTh 6-10p.m. $879 TC
Conversational Programming
XMTT-51613085 CNCAdvanced–5Axis June16-30 TuTh 6-10p.m. $879 TC
Conversational Programming
KUKA Kore Learn KORE basics of the robot. Perform hands-on safety, setup, mastering and programming of a KUKA robot. KUKA issuesacertificateuponsuccessfulcompletionofthecourse.
ManuFirst SC (Lean Manufacturing) n Learn the production processes and procedures necessary to qualify for manufacturing jobs throughout S.C. This class discusses essential safety policies, communication best practices, quality standards, production processes and maintenance awareness. Some local manufacturers accept completion of this class as meeting the requirement of one year of manufacturing experience. Materials included
Mechatronics • Electrical Systems Course includes 15 Tooling U Electrical Systems online lessons with 40 hours of lab training. Learn basic principles of electrical systems including safety practices, types of circuits, magnetism, AC/DC power sources, electrical instruments and print reading, and conductor and battery selection. Materials included
• Motor Controls Course includes 20 Tooling U Motor Control online lessons with 40 hours of lab training. Learn the basic principles of motor control including symbols and diagrams for motors, AC/DC motor applications, control devices, distribution systems, electronic and photonic semiconductor devices, and deceleration and acceleration methods. Materials included
Welding n Learn the basic principles of welding for Gas Metal Arc MIG orGasTungstenArcTIGintheflatandhorizontalpositions.Participants must provide their own welding safety equipment and tools. Or take the 200-hour course to learn the necessary skills used in gas metal arc welding in preparation for the D.1.1 WeldingCertification–MIGweldingindifferentpositions,including safety and use of equipment.
Continuing Education Call Center – 843.574.6152 29
MANUFACTURING, INDUSTRIAL AND CONSTRUCTION TRADES
Production, Equipment and Machinery Training
Course Dates
XAMF-51513242 AeronauticalManufacturing(AMF) Feb.4-March5 TuTh 6-10p.m. $799 TC
Specialties – Composites Technician
XMTT-51813084 CNCAdvanced–5Axis April14-28 TuTh 6-10p.m. $879 TC
Lathe and Conversational Programming
XMTT-51713081 CNCAdvanced–5Axis March17-31 TuTh 6-10p.m. $879 TC
Lathe Training
XIMT-60113479 CNCBootCamp Jan.27-April16 MTuTh 8a.m.-4p.m. $5,500 TBA
XIMT-60113480 CNCBootCamp April27-July20 MTuTh 8a.m.-4p.m. $5,500 TBA
XIMT-50813200 ElectricalSystems Jan.28-Feb.27 TuTh 6-10p.m. $829 TC
XIMT-50813201 ElectricalSystems April21-May21 TuTh 6-10p.m. $829 TC
XAMF-50113250 EnhancedCompositesTrainingProgram March11-April8 MW 6-10p.m. $999 TC
XLOG-50113033 ForkliftTraining: March19 Th 8a.m.-4:30p.m. $299 TC
Powered Industrial Truck
XLOG-50113039 ForkliftTraining: March26 Th 8a.m.-4:30p.m. $299 TC
Powered Industrial Truck
XLOG-50113048 ForkliftTraining: June4 Th 8a.m.-4:30p.m. $299 TC
Powered Industrial Truck
XLOG-50113056 ForkliftTraining: June11 Th 8a.m.-4:30p.m. $299 TC
Powered Industrial Truck
XACR-50313030 HVACElectricalandTroubleshooting April11-June13 Sa 8a.m.-noon $599 TC
XACR-50313032 HVACElectricalandTroubleshooting May12-June11 TuTh 8a.m.-noon $599 TC
XACR-50213023 HVACMechanicalSystems Jan.18-March21 Sa 8a.m.-noon $599 TC
XACR-50213024 HVACMechanicalSystems March10-April9 TuTh 8a.m.-noon $599 TC
XACR-50513014 HVACRefrigerantEPACertification Jan.14-21 TuTh 6-9p.m. $299 TC
Exam Preparation and Exam
XACR-50513025 HVACRefrigerantEPACertification March10-17 TuTh 6-9p.m. $299 TC
Exam Preparation and Exam
XACR-50513027 HVACRefrigerantEPACertification May12-19 TuTh 6-9p.m. $299 TC
Exam Preparation and Exam
XACR-50913021 HVACRefrigeration Jan.18-March21 Sa 8a.m.-noon $499 TC
and Maintenance Basic
XACR-50913017 HVACRefrigeration Jan.21-Feb.20 TuTh 8a.m.-noon $499 TC
and Maintenance Basic
XACR-50913020 HVACRefrigeration April11-June13 Sa 8a.m.-noon $499 TC
and Maintenance Basic
XIMT-51513073 KUKAKore Jan.16-Feb.6 TuTh 6-10p.m. $5,000 TC
XIMT-51513074 KUKAKore May12-June4 TuTh 6-10p.m. $5,000 TC
XAMT-55013067 ManuFirstSC(LeanManufacturing) Jan.27-Feb.20 M-Th 6-10p.m. $599 TC
XAMT-55013071 ManuFirstSC(LeanManufacturing) March9-April2 M-Th 6-10p.m. $599 TC
XAMT-55013072 ManuFirstSC(LeanManufacturing) April20-May14 M-Th 6-10p.m. $599 TC
XAMT-55013119 ManuFirstSC(LeanManufacturing) June1-25 M-Th 6-10p.m. $599 TC
XIMT-50913202 MotorControls March10-April9 TuTh 6-10p.m. $829 TC
XIMT-50913203 MotorControls June2-July2 TuTh 6-10p.m. $829 TC
XWLD-50713005 Welding–GasMetalArc200-Hour Feb.3-April9 M-Th 5-10p.m. $5,000 BC
XWLD-50212994 Welding–GasMetalArcMIG Jan.25-Feb.15 Sa 8a.m.-4:30p.m. $599 BC
XWLD-50212997 Welding–GasMetalArcMIG April18-May9 Sa 8a.m.-4:30p.m. $599 BC
XWLD-50313001 Welding–GasTungstenArcTIG March7-28 Sa 8a.m.-4:30p.m. $599 BC
30LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available30
PROFESSIONAL DEVELOPMENT
Business, Management and HR
A RiverDogs Experience – NEW!TTCisofferingthisnewseriesofbusinesstrainingandnetworking classes in partnership with the Charleston RiverDogs. Each class is taught by TTC instructors and conducted at the Joe Riley Ball Park inside The Riley Park Club room from 3-6 p.m. When class ends, students stay inside The Riley Park Club and enjoy all-you-can-eat and drink while networking with peers and watching a Charleston RiverDogs baseballgame.Coursesavailableinclude:HowtoTrainYour Team, Innovation Strategies and Workplace Wellness Workshop. Classes can be taken individually instead of as a series. Location: Joe Riley Ball Park, downtown Charleston
Accounting for Non-AccountantsThiscourseisperfectforthosewhofindthemselvesmanaging a small business, being named as treasurer of an organization or are just math-challenged and want to get a basic understanding of the accounting concept. It’s well placed before our QuickBooks courses or before moving into a bookkeeper position. The six-hour class is taught by an expert in explaining how the books are kept. Book included
Administrative Professionals Day ConferenceHear from community and thought leaders. Enjoy a delicious breakfast and lunch. Win valuable prizes. Make connections with colleagues. This is your day to relax and re-energize! Early bird discount rate is $129 if registered before March 20.
Business and Interpersonal Skills Think you have an entrepreneurial spirit? Anxious to develop the valuable soft skills needed to win that big sale or to land your next job? How about your desire to manage your time betterortodeveloptheartofproblemsolvingandconflictresolution? TTC has you covered with quick classes to teach you the basic skills you need to succeed.
Human Resources The SHRM Learning System includes multiple modules covering the entire SHRM Body of Competency and Knowledge(BoCK)soyou’lllearneverythingyouneedfor the new CP and SCP exam. For new and seasoned HR professionals,wealsooffercoursesinHumanResourcesIntroduction, Train the Trainer and Human Resources Law. All courses(exceptHumanResourcesIntroductionandSHRMLearningSystem)arerecertification-approvedforhumanresources professionals holding SHRM CP and/or SCP credentials. Join us for a free SHRM Information Session Jan. 27, 6-7:30 p.m., TTC Thornley Campus, Bldg. 910/Rm. 122; RSVP to 843.574.6683. Books included
Law School for Non-LawyersThisseriesissponsoredbytheSCBarAssociationofferingclasses taught by pro-bono lawyers in their areas of specialty. The courses are designed to provide basic information to anyone interested for their business or personal life. Topics coveredinclude:overviewofstatecourts;alternativedisputeresolution; juvenile justice; overview of child protection hearings; family law; real estate and landlord/tenant law; wills, estate and probate; health care and elder law; SC Workers’ Compensation; employment law; bankruptcy law; consumer law and debt collection; criminal law; and torts. Materials included
Lean Six Sigma Green Belt Training Designed for professionals with little or no experience with Lean or Six Sigma methodologies, this Green Belt course builds a foundation of critical skills and strategies. Learn how to strengthen your organization via the use of Six Sigma concepts and techniques which are an asset to any industry, including manufacturing,healthcare,financialservicesandinformationtechnology. This course may help prepare you for the Lean Six SigmaGreenBeltASQcertificationexam.Materials included; exam fee not included (approximately $359)
Continuing Education Call Center – 843.574.6152 31Continuing Education Call Center – 843.574.6152 31
PROFESSIONAL DEVELOPMENT
Business, Management and HR
Next-Level Executive Skills Thiscertificateprogramisanadvancedprofessionaldevelopment series for seasoned leaders of area corporations and individuals who wish to upgrade their leadership expertise andcredentialswithacertificate.Thesessionsaretaughtbyan experienced communication researcher and successful business owner using highly interactive delivery, small group and individual exercises designed to maximize retention and adoption of the material. This program is a solid investment in buildinghighlyeffectiveemergingexecutives.Coursesmaybetakenindividuallyorinacertificatetrackandinclude:GrowthMindset, Critical Conversations, Negotiation, and Imaginative Networking.
Safety Leadership Is your safety team performing at its highest possible level offocusandcommitment?Thisnewcertificateseriestaughtby David Lynn provides a roadmap to build or enhance a culture that believes you CAN work injury-free. The program is designed for employees with safety responsibilities who want to increase their leadership skills, but it’s not just for safetyprofessionals.Aneffectivesafetyprogramrequiresinvolvement at every level to be successful. This course provides a means to develop safety champions and a framework for improving existing safety programs. Participants use a gap analysis scorecard to evaluate their existing safety program and move the bar from good to great for their company’s safety initiatives. Book included
SC Business, Law and Project Management – NEW!This review course prepares you to take the SC Business and Law exam. Topics covered include business management, licensing laws and rules, estimating and bidding, contracts and agreements, project management, insurance and bonding, safety recordkeeping and reporting, labor laws and employmentregulations,financialmanagement,taxlaws,leins, and environmental laws and regulations.
Supervisory Skills TheSupervisoryCertificateprogramisaprofessionaldevelopment series for the up-and-coming leaders of area corporations and individuals who wish to improve their leadershipskillsetsandcredentialswithacertificate.Thesessions are taught by an experienced executive and instructor using a highly interactive delivery designed to maximize retention of the materials. This program is a solid investment inbuildinghighlyeffectiveemergingleaders,managersandsupervisorsandincludesthefollowingcourses:LeadershipandInfluence,BuildingaStrongTeam,CommunicatingEffectively,EthicalLeadershipandEmotionalIntelligence.Note: The courses in the Supervisory Certificate program are approved by SHRM as SCP and CP recertification units. SAVE! Take the entire series for a $45 savings.
Teacher Recertif icationThese courses through TTC’s education partner, Ed2Go, areforteacherscurrentlycertifiedandseekingrenewalhoursforrecertification.Forthosecurrentlyemployedwithapublic school district, prior acknowledgement/approval by theprincipalorstaffdevelopmentofficertoassurecourserelevancy is preferred. Option 3 teachers must enroll through TTC Continuing Education Registration and have a TTC transcript accompanying proof of completion for credit to be givenbytheStateofSCTeacherRecertificationoffice.Contact Steve Price at Steve.Price@tridenttech.edu or 843.574.6683 to discuss all options available. Visit www.tridenttech.edu/ce for more information.
Course Dates
A RiverDogs Experience
XBUS-50613446 ARiverDogsExperience– May14 Th 3-6p.m. $199 OS
How to Train Your Team
XBUS-67113444 ARiverDogsExperience– April30 Th 3-6p.m. $199 OS
Innovation Strategies
XBUS-67013442 ARiverDogsExperience– June16 Tu 3-6p.m. $199 OS
Workplace Wellness Workshop
Accounting for Non-Accountants
XBAF-50713104 AccountingforNon-Accountants Feb.18-20 TuTh 6-9p.m. $99 TC
XBAF-50713105 AccountingforNon-Accountants March31-April2 TuTh 6-9p.m. $99 TC
XBAF-50713106 AccountingforNon-Accountants April28-30 TuTh 6-9p.m. $99 TC
32LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
PROFESSIONAL DEVELOPMENT
Business, Management and HR
Course Dates
Administrative Professionals Day Conference
XBUS-57112950 2020AnnualAdministrative April22 W 8:15a.m.-4p.m. $159 TC
Professionals Day Conference
Business and Interpersonal Skills
XBUS-60913013 ConflictResolution May5 Tu 6-9p.m. $129 TC
XBUS-60813012 PrioritizingTime Jan.29 W 6-9p.m. $99 TC
XBUS-66913188 SoftSkillsSuccessfulSelling Feb.13 Th 6-9p.m. $129 TC
XBUS-66913189 SoftSkillsSuccessfulSelling March19 Th 6-9p.m. $129 TC
XBUS-66913190 SoftSkillsSuccessfulSelling April16 Th 6-9p.m. $129 TC
Human Resources XHUS-50213096 HumanResourcesIntroduction June6-13 Sa 8:30a.m.-4:30p.m. $495 TC
(SHRMEssentials)
XHUS-50313089 HumanResourcesLaw Feb.4-6 TuTh 6-9p.m. $169 TC
XHUS-50313090 HumanResourcesLaw April14-16 TuTh 6-9p.m. $169 TC
XHUS-50313091 HumanResourcesLaw June9-11 TuTh 6-9p.m. $169 TC
XHUS-50113088 SHRMLearningSystem:SHRM-CP/SCP Feb.10-May18 M 6-9p.m. $1,149 TC
SHRM Information Session Jan.27 M 6-7:30p.m. FREE TC
XBUS-50613092 TraintheTrainer March24 Tu 6-9p.m. $129 BC
XBUS-50613093 TraintheTrainer May19 Tu 6-9p.m. $129 TC
Law School for Non-LawyersXBUS-59412329 LawSchoolforNon-Lawyers March3-April14 Tu 6-9p.m. $45 TC
Lean Six Sigma Green Belt TrainingXBUS-55013094 LeanSixSigmaGreenBeltTraining March9-12 M-Th 8:30a.m.-4:30p.m. $1,250 TC
XBUS-55013095 LeanSixSigmaGreenBeltTraining May4-7 M-Th 8:30a.m.-4:30p.m. $1,250 TC
Next-Level Executive Skills XBUS-51413015 GrowthMindset Jan.21 Tu 8:30a.m.-noon $295 TC
XBUS-51513016 CriticalConversations Jan.28 Tu 8:30a.m.-noon $295 TC
XBUS-51613018 Negotiation Feb.4 Tu 8:30a.m.-noon $295 TC
XBUS-51713187 ImaginativeNetworking Feb.11 Tu 8:30a.m.-noon $295 TC
Safety LeadershipXBUS-66512689 PrincipletoPracticeSafety Jan.21-May19 Tu 8a.m.-5p.m. $949 TC
LeadershipCertificate(class meets the third Tuesday of each month)
SC Business, Law and Project ManagementXBUS-66713191 SCBusiness,LawandProjectManagement Feb.14-15 FSa 8a.m.-4p.m. $299 TC
XBUS-66713192 SCBusiness,LawandProjectManagement March27-28 FSa 8a.m.-4p.m. $299 TC
XBUS-66713841 SCBusiness,LawandProjectManagement May8-9 FSa 8a.m.-4p.m. $299 TC
Supervisory Skills Supervisory Certificate Bundle Feb.5-March4 W 8:30a.m.-noon $800 TC
XBUS-52913000 LeadershipandInfluence Feb.5 W 8:30a.m.-noon $169 TC
XBUS-53113003 CommunicatingEffectively Feb.12 W 8:30a.m.-noon $169 TC
XBUS-53013006 BuildingaStrongTeam Feb.19 W 8:30a.m.-noon $169 TC
XBUS-53213008 EthicalLeadership Feb.26 W 8:30a.m.-noon $169 TC
XBUS-53313010 EmotionalIntelligence March4 W 8:30a.m.-noon $169 TC
Supervisory Certificate Bundle April15-May13 W 8:30a.m.-noon $800 TC
XBUS-52913002 LeadershipandInfluence April15 W 8:30a.m.-noon $169 TC
XBUS-53113004 CommunicatingEffectively April22 W 8:30a.m.-noon $169 TC
XBUS-53013007 BuildingaStrongTeam April29 W 8:30a.m.-noon $169 TC
XBUS-53213009 EthicalLeadership May6 W 8:30a.m.-noon $169 TC
XBUS-53313011 EmotionalIntelligence May13 W 8:30a.m.-noon $169 TC
Continuing Education Call Center – 843.574.6152 33
PROFESSIONAL DEVELOPMENT
Fitness Professionals
Nutrition Coaching Thiscourseteachesfitnessprofessionalsnutritionalguidelinesfor macro and micronutrients; how to determine body fat percentages, lean body mass and body fat weight; how to calculate protein needs based on lean body mass and read nutrition labels properly; and nutrition timing based on training times. Supplementation and hydration also are covered. Book included
XSFT-522 $99
ID#13078 Feb. 12 W 6-9 p.m. TCID#13079 April 15 W 6-9 p.m. TCID#13080 June 10 W 6-9 p.m. TC
Personal Trainer Certif ication Get all the important information needed to start an exciting, successfulfitnesscareerandbecomeaW.I.T.S.certifiedpersonal trainer, which is NCCA-accredited. Our personal trainer course is a great way to prepare and become successfulinthefieldyoulove.W.I.T.S.hasanoptiontocomplete an employer internship that can walk you into jobs! This challenging course is for candidates wanting live instruction with in-depth, hands-on practical labs to master the career skills and knowledge. The course consists of 15 hours of classroom lecture on key topics like biomechanics, exercise physiology,fitnesstesting,equipmentusageandhealthassessments to game plan a solid program for your client. The best part is the 15 hours of hands-on practical training labs with role playing drills on assessing clients, programming, performing proper exercises, presentation skills and more. This course prepares you to take the exam and get your certification.Thiscoursehasahybridoptionatthesametuitioninwhichthelecturesareonlineandthelabsarestillofferedlive so you can master the skills; ask us for details. Included in this course is a complete 200-page color student workbook, access to online student study tools and free test vouchers to takethecertifiedpersonaltrainerexams.Youcanworkrightafter passing the exams with proof of CPR/AED to obtain your Level1certifiedpersonaltrainercredential.Asaspecialbonus,you can take advantage of our 30-hour employer internship to getouradvancedLevel2certifiedpersonaltrainercredentialat no additional cost. Book not included
XSFT-501 $899
ID#13075 Feb. 8-March 21 Sa 9 a.m.-4 p.m. TCID#13077 May 16-June 27 Sa 9 a.m.-4 p.m. TC
34LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
PROFESSIONAL DEVELOPMENT
Law Enforcement/Security
Church SecurityThisawarenessworkshopbenefitsreligiousleadersinthecommunity.Learnaboutstafftraining,policyandproceduredevelopment,securityassessments,protectingofferings,surveillancetechniquesrecognizingdifferentkindsofthreats,and security team development. Lt. Frank Jackson, licensed officer,conductstheworkshop.Books included
XCRJ-505 $169
ID#13101 Jan. 28-30 Tu-Th 6-10 p.m. TCID#13102 Feb. 25-27 Tu-Th 6-10 p.m. TCID#13103 March 10-12 Tu-Th 6-10 p.m. TC
Constable In-Service TrainingSC constables must take this course each year to renew their constable commission. It consists of three hours of legal update,twohoursofcivilliabilityandfourhoursoffirearmstrainingandqualification.Constablesmustscore75%oraboveon the written examination and qualify with their choice of weapons. Book included
XCRJ-504 $119
ID#13019 April 21-23 TuTh 6-9 p.m. TC April 25 Sa 9 a.m.-1 p.m. TC
Executive Protection SpecialistTheexecutiveprotectionspecialist(EPS),alsoknownasclose personal protection, refers to security measures taken to ensure the safety of VIPs or other individuals who may be exposed to elevated personal risk because of their employment, celebrity status, wealth, associations or geographical location. This 20-hour block of instruction consistsof:themindsetoftheEPS,thesecurityteam,generalprecepts of EP, glossary of protective terms, organization of teams, protective details, recognizing threats and potential attackers, concentric rings of security, security perimeters,attackonprincipleandagentreactions,chaufferresponsibilities and guidelines, terrorist operations, explosive device recognition, sniper detection procedure, motorcade formations, agent duties, vehicle procedures, motorcade operations, and arrivals and departures.
XCRJ-509 $399
ID#13026 May 5-7 Tu-Th 6-10 p.m. TC May 9 Sa 9 a.m.-1 p.m. TC
SLED Safeguard SC • Classroom Instructor Training (40 Hours): All participants
mustbecurrentlyregisteredwithSLEDasasecurityofficerwith a licensed security company to attend this training. Students teach a 20-minute block of instruction on a security topic of their choice. SLED must approve all participants. Book included
XCRJ-501 $499
ID#13028 Jan. 13-17 M-F 8 a.m.-5 p.m. TCID#13029 March 16-20 M-F 8 a.m.-5 p.m. TCID#13031 May 11-15 M-F 8 a.m.-5 p.m. TC
• Classroom Training Annual Recertification: This portion oftheannualrecertificationisforallprivatesecurityfirmtrainingofficers.Itconsistsoffourhoursofrequiredtrainingtopics, Police Academy updates and discussion.
XCRJ-507 $99
ID#13036 Jan. 23 Th 8 a.m.-noon TCID#13037 Feb. 20 Th 8 a.m.-noon TCID#13038 March 26 Th 8 a.m.-noon TCID#13213 April 23 Th 8 a.m.-noon TCID#13040 May 21 Th 8 a.m.-noon TCID#13041 June 25 Th 8 a.m.-noon TC
• Firearms Instructor Certification (40 Hours): All participants mustbecurrentlyregisteredwithSLEDasasecurityofficerwith a licensed security company to attend this training. Prerequisite: SLED Safeguard SC Classroom Instructor Training (40 hours); SLED must approve all participants. Location: TTC Thornley Campus and C&S Shooting Sports & Range; materials (except ammunition) included; student must bring his/her own ammunition
XCRJ-503 $499
ID#13034 Feb. 10 M 8 a.m.-5 p.m. TC Feb. 11-14 Tu-F 8 a.m.-5 p.m. OSID#13035 June 15 M 8 a.m.-5 p.m. TC June 16-19 Tu-F 8 a.m.-5 p.m. OS
• Firearms Training Officer Annual Recertification: This portionoftheannualrecertificationisforofficersemployedby companies requiring handguns. Location: Begins at Cadre Security or TTC Thornley Campus then moves to C&S Shooting Sports & Range; student must bring his/her own ammunition
XCRJ-508 $99
ID#13042 Jan. 23 Th 1-5 p.m. OSID#13043 Feb. 20 Th 1-5 p.m. OSID#13044 March 26 Th 1-5 p.m. OSID#13045 April 23 Th 1-5 p.m. OSID#13046 May 21 Th 1-5 p.m. OSID#13047 June 25 Th 1-5 p.m. OS
Continuing Education Call Center – 843.574.6152 35
PROFESSIONAL DEVELOPMENT
Real Estate and Property Management
TTC is an authorized provider for the pre-license course for real estate and property management. Please check SC’s state requirements at www.llronline.com. Any person wishing to take the SC Real Estate Licensing exam must now pay for and pass a criminal background check BEFORE taking the exam. This form can be downloaded from the SCREC website at http://llr.sc.gov/recheck. Students must pass the background check before taking the state exam.
Property Management To obtain a property management license, the applicant must be at least 18 years old and agree to the submission of a satisfactory credit report, have a high school diploma or GED equivalent, complete all 32 hours of the course, pass the property management examination, and apply for a property managerlicensewithinoneyear.ThiscoursefulfillstheSouthCarolina Real Estate Commission’s requirements for the property management license exam. The fundamentals of property management and applicable state laws are covered. Note: The SC Labor and Licensing Board requires students, by law, to complete the entire Property Management course. You must successfully complete the course to be eligible for the exam. Books not included
Real Estate Level 1 n To obtain a real estate license, the applicant must be at least 18 years old and agree to the submission of a satisfactory credit report; have a high school diploma or GED equivalent; provide proof of completion of 60 hours of pre-license education from an authorized school and the Real Estate – Advanced Principles course; pass the state written examination; submit an application for licensure along with the appropriate fees; and be associated with a broker-in-charge. These two courses meet new requirements, and successful completion enables you to sit for the state examination. Books not included
Real Estate Level 2 – Advanced Principles This course replaces the prior Post-Licensing Education Curriculum approved by the State of SC as of Jan. 1, 2017. An applicant may take the sales exam after completion of the 60-hour Real Estate course but cannot be issued a license until completion of the 30-hour Real Estate – Advanced Principles course. For more information, call 843.574.6707. Prerequisite: Successful completion of the basic Real Estate 60-hour course at TTC or a certificate of completion for the same from an authorized provider.
Course Dates (No Class Feb. 15-16)
XREA-50213111 PropertyManagement Jan.7-Feb.6 TuTh 6:30-9:30p.m. $265 TC
XREA-50213112 PropertyManagement Feb.18-March19 TuTh 6:30-9:30p.m. $265 TC
XREA-50213114 PropertyManagement April7-May7 TuTh 6:30-9:30p.m. $265 TC
XREA-50213115 PropertyManagement May12-June11 TuTh 6:30-9:30p.m. $265 TC
XREA-50113107 RealEstateLevel1–Weekend Jan.25-March8 SaSu 9a.m.-2p.m. $450 TC
XREA-50113108 RealEstateLevel1–Weeknight Jan.6-Feb.24 MTuTh 6:30-9:30p.m. $450 TC
XREA-50513110 RealEstateLevel2–AdvancedPrinciples March2-23 MTuTh 6:30-9:30p.m. $225 TC
XREA-50513109 RealEstateLevel2–AdvancedPrinciples March21-April5 SaSu 9a.m.-2p.m. $225 TC
36LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
Continuing Education Call Center – 843.574.6152 37
Eager to Equip your Workforce?
Continuing Education at Trident Technical College offers enhanced customizable training to meet your business demands.
Letusdesignacustomtrainingprogramforyourcompanyandworkforce.Manyofourcertificatesleadtoanationalcertification.
Training options are available at your company’s location or at one of our six campuses or site locations in downtown Charleston,
Hollywood, Moncks Corner, Mount Pleasant, North Charleston and St. George.
Our Top Training Programs: Safety begins with you!Keepyourselfandyourstaffsafewithourtoptwosafetyprograms:
OSHA - TTC is working to reduce the leading causes of injury and deaths at work, on the road and in our homes and communities. OSHA Safety 10-hour and 30-hour courses are for most workers in construction, manufacturing, building development,andotherrelatedfieldsthatneedtotakehazard recognition training.
Feedback: “Our Field Service Supervisors attended the OSHA General Industry Safety 10-hour course at Trident Technical College in North Charleston, SC. Our instructor took time prior to the class to learn more about our specificindustryandenvironment.Hispreparationhelpedfacilitate discussions on topics relevant to our team’s daily jobs; allowing them to walk out of class with preventative measures they could introduce immediately in their warehouses. I would recommend a group setting for any company interested in enrolling employees in the OSHA 10-hour course. The group dialogue and shared experiences added immediate value to the course content.”
~ Stacey Amidon Ethos Therapy Solutions
HAZWOPER - This training is required for employees visiting uncontrolled hazardous waste operations mandated by the government.TTCoffersHAZWOPER24-hourand40-hourinitial training courses, as well as the 8-hour refresher for yourstaff.
Feedback: The Hazwoper training at TTC served to be an excellent reminder on the response to potential releases. The class had good participation among peers with similar backgrounds and allowed them to discuss real-world events and their Cause, Action and Results.
~ Sherman Jaggers Century Aluminum
Benefits of Workforce Training:
• Create a positive impact on your employees
and your company.
• Increase employee productivity.
• Reduce turnover.
• Improve job satisfaction.
• Aid in the recruiting process.
• Reward long-time employees.
• Reduce the need for employee supervision.
LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus; SP = St. Paui’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
Manufacturing is taking over South Carolina so prepare your staff now with our new certifications!
Welding -TTCoffersaCertifiedWeldingclasstoprovideintroductoryskillsusedingasmetalarcwelding(MIGweldingintheflatandhorizontalpositions)includingsafetyanduseofequipment. Your employee also receives the OSHA 10-hour General Industry credential. D1.1. assessments are available.
CNC Boot Camp - This training is a fast-track program designed for employees to obtain and maintain a high-quality manufacturing job. CNC Boot Camp focuses on the knowledge and skills necessary for employment as an operator on CNC equipment.
Why partner with TTC Continuing Education?• Weareabletoadministernationallycertified,proctoredassessmentswhichcanbeutilizedbyyourcompanytodetermine
training needs and be used as a best practice hiring tool.
• We can develop a plan for your company to utilize the Enterprise Zone Act which will get you money back on your training.
• Ask us about our apprenticeship program development which can also get you money back.
• Customized courses are available in computer and information technology, health care, manufactuiring, industrial and construction trades, professional/organizational development and culinary arts teambuilding.
Does your company qualify for a tax credit?
Apprenticeship Program A registered apprenticeship is an employer-sponsored job-related education program that cultivates highly skilled workers who meet the workforce demands of a competitive global economy. In South Carolina, employers with a registered apprenticeship programareeligibletoreceiveataxcreditof$1,000foreachregisteredapprenticeemployee.
Utilizing the Enterprise Zone ActTheEnterprizeZoneAct(EZA)isoneofthebesttoolsyoucanhaveinyourtrainingdepartmenttohelpmakeyourtrainingbudgetgo even farther by recouping up to two-thirds of the money you spend. EZA is a retraining job credit that can help businesses stay competitive as you work to keep your business growing! EZA provides reimbursement for funds spent for training production lineemployees,first-linesupervisorsandequipment/maintenancetechnicians.Thetrainingcancoverarangeoftopicsfromintroducing new technology, annual safety training, maintenance and repair training as well as supervisor training for front-line supervisors.Thecreditisallowedforupto$1,000reimbursementperqualifiedemployeeperyear.Wehavehelpedclientssavethousands of dollars!
Contact: To schedule a consultation or a free plant walk-through, contact Deseret Scharett at Deseret.Scharett@tridenttech.edu or LaRone Murphy at LaRone.Murphy@tridenttech.edu, or call 843.574.6177.
Do you have a high turnover rate? Need to equip your workforce with the skills they need to become a high-performance team? Time to train your leaders! Supervisory Skills Certificate-TTC’sSupervisoryCertificatetraining is for up-and-coming leaders and seasoned professionals who wish to improve their supervisory skills, business knowledge and communication.
Feedback:TridentTechhasmadeiteasytoprovidecontinuedgrowth opportunities to our leadership team. Through onsite training and focused skill building options, we’ve been able toselectappropriatesessionsspecifictoourteam.And,theknowledgeable instructors share information in an engaging and meaningful manner to ensure connection with all participants. ~ Teresa Davison, Owens Corning
38LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars ; = Payment Plan Available
40LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
PERSONAL ENRICHMENT
Arts, Hobbies and DIY
Fishing Fundamentals Thisclasspreparesyouforfreshwaterorsaltwatersportfishingby teaching you about equipment, bait, regulations, boating safety,fishidentificationandknottying.Classincludeshands-on practice at TTC’s Thornley Campus pond.
XFOR-501 $55
ID#12945 April 11 Sa 9 a.m.-1 p.m. TC
Sewing Fundamentals Brand new to sewing? Need a refresher? Want to do simple repairs or alterations yourself? Learn the basics, including supplies, tools, notions, and hand stitching.
XART-531 $75
ID#12942 March 21 Sa 9 a.m.-noon MPID#12941 April 11 Sa 9 a.m.-noon TCID#12943 June 20 Sa 9 a.m.-noon PC
Welding Basics for Beginners – NEW! MIG welding can help you with simple household/farm repairs and can also be used creatively to design steel art pieces. This introductory, hands-on welding course is for laypeople.
XWLD-508 $549
ID#13140 Feb.8-22 Sa 7a.m.-3:30p.m. BC
Wilderness Survival Training Lowcountry recreation enthusiasts of all ages learn how to work with nature in the event of an emergency. Explore conceptsinbushcraft,firecraft,gear,practicedirectionfinding,andwildernessfirstaid.
XFOR-501 $55
ID#12944 March 28 Sa 9 a.m.-1 p.m. TC
Artisan Soap Making Make-ittake-it:Learntheartandcraftofmakingall-naturalartisan soaps. Discuss how to personalize with custom scents.
XART-502 $59
ID#12961 Feb.7 F 1:30-4p.m. TC
Glass Fusion Art for Beginners Explore the artistic technique of using high heat to fuse together layers of beautiful colored glass. Create two pieces during class.
XART-523 $139
ID#12960 April18 Sa 9-11:30a.m. TC April25 Sa 9-11:30a.m. TC
3D Printing Introduction Make a physical object from a digital three-dimensional model. Discuss home printers, printing processes, materials and the many consumer and commercial applications for this technology.
XART-535 $79
ID#12947 Feb. 1 Sa 9 a.m.-noon TCID#12948 March 14 Sa 9 a.m.-noon TCID#12949 June 6 Sa 9 a.m.-noon TC
Continuing Education Call Center – 843.574.6152 41
PERSONAL ENRICHMENT
Culinary, Baking and Pastry
Cinco de Mayo Party – NEW! Learn to prepare authentic Mexican specialties in time to hostaCincodeMayoparty:classicdipsandsalsa,specialtyquesadillas, unique tacos, Mexican corn, churros, and more. Please register by April 6.
XCUL-575 $119
ID#13180 April 18 Sa 9 a.m.-noon TC
Classic French Macarons – NEW! Paint a virtual rainbow with these dainty, delicate, sweet meringue-based confections. Varieties include pistachio, green tea with chocolate ganache, and bellini champagne buttercream.
XBKP-555 $119
ID#13977 May 9 Sa 9 a.m.-1 p.m. PC
Craft Beer Brewing Love craft beer and want to try brewing your own? Dave Holaday of Oak Road Brewery explains how to get started with this relatively easy, inexpensive hobby. Learn about thedifferentstylesofcraftbeerandwhatinfluencesflavor.Tastings are available.
XCUL-565 $59
ID#12913 Feb.8 Sa 11a.m.-1:30p.m. PC
Culinary Boot Camp This is a comprehensive, hands-on class to learn basic culinary methods and techniques. Learn mise en place, knife skills, soup and stock production, and sauce making. Also study a variety of dry- and moist-heat cooking methods such as roasting, grilling, sautéing, pan-frying, stir-frying, braising, poaching, and steaming. Please register by May 27. Note: Baking and Pastry Boot Camp coming in July
XCUL-501 $399
ID#12968 June6-27 Sa 9a.m.-12:30p.m. TC
A Taste of Mardi Gras CelebrateMardiGraswithBigEasyfavoritessuchasétouffée,gumbo, king cake and more. There’s a good reason it’s called Fat Tuesday! Please register by Feb. 17.
XCUL-560 $119
ID#12967 Feb.25 Tu 5:30-8:30p.m. PC
Charleston Classics Demystified Explore the southern secrets behind Lowcountry favorites such as she-crab soup, red rice and sausage, shrimp and grits, and other Charleston classics. Please register by Feb. 10.
XCUL-570 $119
ID#12966 Feb. 22 Sa 9 a.m.-noon PC
42LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
PERSONAL ENRICHMENT
Culinary, Baking and Pastry
Homebrewing Fundamentals Discover how to brew your own craft beer. You receive a brewing starter kit and watch a demonstration of the home brewing experience. This class is also informative for wine, mead or kombucha producers.
XCUL-565 $129
ID#12914 Feb.8 Sa 11a.m.-1:30p.m. PC
Indian Street Food Indian street food is celebrated for its regional diversity and eachlocalityoffersdistinctflavorsandspecialties.Getasampling of these tasty bites and learn how to make popular favorites at home. Chef also leads a tour of the local Indian grocery. Please register by May 18.
XCUL-541 $119
ID#12969 May 30 Sa 9 a.m.-2 p.m. TC
International Easter Baking – NEW! Experience a variety of traditional holiday cuisine from around the world, such as Italian Easter Pie, Greek Galaktoboureko and even the fruit studded, spiced hot cross buns traditionally eaten in Europe on Good Friday. Please register by March 16.
XBKP-552 $119
ID#13178 March 28 Sa 9 a.m.-1 p.m. PC
Kitchen Secrets – NEW! This class is for the enthusiast dying to know “how do they do that?” While preparing a meal in class, you learn about tools, techniques, time-savers, presentation, and best of all, “dish” with the chef as he shares some juicy trade secrets. Please register by March 2.
XCUL-574 $99
ID#13176 March 14 Sa 9 a.m.-noon TC
Fridays in the Bake Shop SeriesStart your weekend baking delicious artisanal breads with Pastry Chef David Vagasky. Each month in the series, Chef Vogesky guides you through bread-baking basics, explaining the science and demonstrating the artistic techniques that go into making classics such as bagels, baguettes, focaccia, sourdough, ryes and more.
Fridays in the Bake Shop: European Yeast Breads Learn the fundamentals of bread baking. In this hands-on class, you make French bâtards, épis de blé, focaccia, and ciabattawithstiffbiga.Please register by Feb. 3.
XBKP-501 $149
ID#12962 Feb. 14 F 9 a.m.-3 p.m. PC
Fridays in the Bake Shop: Fermentation and Cultures Further enhance your bread-baking skills to include fermentation and cultures. Bake fermented French bread, light and marble rye breads, sourdough and seeded sourdough. Create your own starter so you can continue baking at home. Please register by March 9.
XBKP-501 $149
ID#12963 March 20 F 9 a.m.-3 p.m. PC
Fridays in the Bake Shop: Sweet Breads Experience pastry-chef-led instruction for baking classic sweet breads such as cinnamon rolls, gooey caramel rolls, hot cross buns, monkey bread and braided challah. Please register by March 30.
XBKP-501 $149
ID#12964 April 10 F 9 a.m.-3 p.m. PC
Fridays in the Bake Shop: Baguettes, Bagels and Bialys Acquire the skills to make your own fresh, chewy bagels, bialys and classic French baguettes at home. Gain hands-on experience working with yeast dough as you create pastry magic. Please register by May 4.
XBKP-501 $149
ID#12965 May 15 F 9 a.m.-3 p.m. PC
Continuing Education Call Center – 843.574.6152 43
PERSONAL ENRICHMENT
Culinary, Baking and Pastry
Say It with Sweets – NEW! You’ll love decorating your own conversation heart cut-out cookies and preparing an elegant ganache brownie cake for two. Please register by Jan. 27.
XBKP-551 $99
ID#13174 Feb. 8 Sa 9 a.m.-1 p.m. TC
Sourdough – Beyond Bread – NEW! Use fresh sourdough starter to prepare cookies, pretzels, quick breads and more. You make and take your own sourdough starter. Please register by April 13.
XBKP-553 $119
ID#13181 April 25 Sa 9 a.m.-1 p.m. TC
Sous Vide Cooking – NEW! Timetomeetthelatestgame-changingfoodtrend:sousvidecooking. It’s a fancy French technique that involves sealing your food in a plastic bag, then cooking it slowly in a water bath.Allyouneedisoneaffordablegadget.Please register by May 11.
XCUL-573 $129
ID#13172 May 23 Sa 9 a.m.-noon TC
Spring Eggstravaganza – NEW! Skipthecheapcandy-filledplasticeggsthisyear.Instead,fillyour basket with handmade peeps, crème eggs, and decadent chocolate-covered peanut butter treats. Please register by March 30.
XBKP-554 $119
ID#13182 April 3 F 1 -5 p.m. TC
44LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
PERSONAL ENRICHMENT
Defensive Driving
Defensive Driving (DDC-8) WeekdayXTRL-503 $99
ID#13063 May11 M 8:30a.m.-5p.m. TC
Defensive Driving (DDC-8) WeeknightsXTRL-502 $99
ID#13064 Jan.21-22 TuW 5:30-9:30p.m. TCID#13065 Feb.18-19 TuW 5:30-9:30p.m. TCID#13066 March10-11 TuW 5:30-9:30p.m. TCID#13068 April7-8 TuW 5:30-9:30p.m. TCID#13069 May19-20 TuW 5:30-9:30p.m. TCID#13070 June16-17 TuW 5:30-9:30p.m. TC
Defensive DrivingDrivers who have accumulated penalty points against their records can have up to four points removed upon successful completionofthisNationalSafetyCouncilcertifiedcourse.Depending on your insurance carrier, a discounted insurance rate may be available. You must register in advance and be on time. As a reminder, any person who drives a motor vehicle when his or her license is cancelled, suspended or revoked is in violation of South Carolina Statute 56-1-460 and is subject to arrest; this includes driving to and from TTC campuses. Before enrolling, verify you have points on your driving record by going to www.scdmvonline.com for the credited points to be applied. Note: This is not a course for ADSAP substance violations. Book included
Defensive Driving (DDC-8) SaturdayXTRL-501 $99
ID#13210 Jan.18 Sa 8:30a.m.-5p.m. TCID#13049 Jan.25 Sa 8:30a.m.-5p.m. TCID#13050 Feb.8 Sa 8:30a.m.-5p.m. TCID#13051 Feb.22 Sa 8:30a.m.-5p.m. TCID#13052 Feb.29 Sa 8:30a.m.-5p.m. TCID#13053 March21 Sa 8:30a.m.-5p.m. TCID#13054 March28 Sa 8:30a.m.-5p.m. TCID#13055 April4 Sa 8:30a.m.-5p.m. TCID#13057 April18 Sa 8:30a.m.-5p.m. TCID#13058 April25 Sa 8:30a.m.-5p.m. TCID#13059 May9 Sa 8:30a.m.-5p.m. TCID#13060 May23 Sa 8:30a.m.-5p.m. TCID#13061 June6 Sa 8:30a.m.-5p.m. TCID#13062 June27 Sa 8:30a.m.-5p.m. TC
Continuing Education Call Center – 843.574.6152 45
FitnessPERSONAL ENRICHMENT
Resistance TrainingTone and strengthen your muscles using a variety of equipment.
Total Body ConditioningTrain your entire body through these high intensity interval training drills for strength, power and endurance.
YogaExperience stretching and release of tension while building strength from popular yoga poses.
Yomassage: Restorative Yoga and Massage – NEW!Restorative yoga positions are heavily supported while focusing on mindfulness and breath. Therapeutic massage is provided in each pose by licensed massage therapists.
Aikido – Soft Martial ArtsThis Japanese self-defense training emphasizing relaxation of the mind and body, even under stress, is based on a philosophy of non-resistance. Training is mental as well as physical, so practicing Aikido leads to enhanced self-confidence in various situations.
BarreEnjoy the tone and stretch of this ballet-inspired class!
Beginner FitnessThis introductory fitness class concentrates on low impact exercises, proper technique and form.
Dance FitnessThis fun-filled dance class uses pop, hip hop, salsa and funk while burning calories.
Course Dates
XSFT-53212925 Aikido–SoftMartialArts Jan.13-March4 MW 6:30-8p.m. $40 MP
XSFT-53212926 Aikido–SoftMartialArts March9-April29 MW 6:30-8p.m. $40 MP
XSFT-53212927 Aikido–SoftMartialArts May4-June24 MW 6:30-8p.m. $40 MP
XSFT-52913373 Barre Jan.15-April22 W 12:15-1p.m. $125 TC
XSFT-52913895 Barre May27-July29 W 12:15-1p.m. $80 TC
XSFT-51013379 BeginnerFitness Jan.14-April21 Tu 6:15-7p.m. $125 TC
XSFT-51013896 BeginnerFitness May26-July28 Tu 6:15-7p.m. $80 TC
XSFT-50213376 DanceFitness Jan.15-April22 W 5:30-6:15p.m. $125 TC
XSFT-50213897 DanceFitness May27-July29 W 5:30-6:15p.m. $80 TC
XSFT-52613374 ResistanceTraining Jan.16-April23 Th 6:15-7p.m. $125 TC
XSFT-52613375 ResistanceTraining Jan.15-April22 W 7:15-8a.m. $125 TC
XSFT-52613898 ResistanceTraining May27-July29 W 7:15-8a.m. $80 TC
XSFT-52613899 ResistanceTraining May28-July30 Th 6:15-7p.m. $80 TC
XSFT-52413371 TotalBodyConditioning Jan.14-April21 Tu 12:15-1p.m. $125 TC
XSFT-52413372 TotalBodyConditioning Jan.14-April23 TuTh 5-6p.m. $250 TC
XSFT-52413900 TotalBodyConditioning May26-July28 Tu 12:15-1p.m. $80 TC
XSFT-52413901 TotalBodyConditioning May26-July30 TuTh 5-6p.m. $160 TC
XSFT-50313370 Yoga Jan.13-April20 M 4:45-5:45p.m. $125 TC
XSFT-50313902 Yoga June1-Aug.3 M 4:45-5:45p.m. $80 TC
XSFT-51113382 Yomassage:RestorativeYogaandMassage Jan.13 M 5-6:30p.m. $60 TC
XSFT-51113383 Yomassage:RestorativeYogaandMassage Feb.3 M 5-6:30p.m. $60 TC
XSFT-51113384 Yomassage:RestorativeYogaandMassage March2 M 5-6:30p.m. $60 TC
XSFT-51113385 Yomassage:RestorativeYogaandMassage April6 M 5-6:30p.m. $60 TC
XSFT-51113386 Yomassage:RestorativeYogaandMassage May4 M 5-6:30p.m. $60 TC
46LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
PERSONAL ENRICHMENT
Languages
American Sign Language (ASL) – Level 1 Learn the foundations of ASL communication, gain knowledge and awareness of deaf/signing history and culture, develop comfort and assertiveness as a new signer, and develop a basic portfolio of ASL vocabulary.
XASL-501 $159
ID#12932 Jan. 14-March 3 Tu 6-8 p.m. SPID#12930 Jan. 21-March 10 Tu 6-8 p.m. MPID#12929 March 18-May 6 W 6-8 p.m. TC
American Sign Language (ASL) – Level 2 Increase your vocabulary, understand grammar and syntax and deepen your understanding of deaf/signing communication and culture. Prerequisite: ASL Level I or equivalent experience
XASL-502 $159
ID#12935 Jan. 15-March 4 W 6-8 p.m. BCID#12933 March 17-May 5 Tu 6-8 p.m. MPID#12934 May 20-July 8 W 6-8 p.m. TC
Conversational Spanish IWhether just for fun or to communicate better at work, this course teaches you the basics of everyday conversational Spanish for business and travel. This course focuses on spoken Spanish, the written language is used for reinforcement. Prerequisite: You need little or no background with the Spanish language. Book included
XSPA-501 $169
ID#13099 Jan.13-Feb.10 MW 6:30-9p.m. TCID#13100 May11-June8 MW 6:30-9p.m. TC
Conversational Spanish IIEnhance your ability to converse in the Spanish language. Prerequisite: This course is intended for those who have either taken Conversational Spanish I or have taken multiple years of Spanish in high school or college but are weak with the spoken component and want further practice. Book included
XSPA-502 $169
ID#13098 March2-25 MW 6:30-9p.m. TC
Conversational Spanish III – AdvancedThis course enhances your Spanish by expanding your vocabulary, raising the level of communication, ensuring accuracyofspeakingandwriting,andincreasingconfidence.
Specialist subjects related to work or the interests of the learners are incorporated into the classes – i.e. business, travel, emails and more. More challenging expressions and idioms are included in the curriculum. Prerequisite: Ideally the advanced level of Spanish is an extension of the foundation courses (Level I and II), college Spanish or a refresher for a seasoned traveler
XSPA-503 $129
ID#13097 April13-22 MW 6:30-9p.m. TC
ESL Program Orientation – NEW!Students who wish to enroll in an ESL Workplace Communicationcourseforthefirsttimeshouldattendthisfreeorientation. Please register in advance for this orientation so we have your contact information.
XESL-501 FREE
ID#13142 Jan. 7 Tu 6-7 p.m. TCID#13143 Jan. 13 M 6-7 p.m. TCID#13144 Feb. 25 Tu 6-7 p.m. TCID#13146 March 2 M 6-7 p.m. TCID#13148 April 15 W 6-7 p.m. TCID#13149 April 21 Tu 6-7 p.m. TC
ESL Workplace Communication – Level 1 – NEW! For non-native English speakers, this introductory course helps develop basic language skills for communicating in public and at work. Prerequisite: ESL Program Orientation
XESL-502 $249
ID#13152 Jan.22-March9 MW 6-8:30p.m. TCID#13154 March11-April27 MW 6-8:30p.m. TCID#13156 April29-June15 MW 6-8:30p.m. TC
ESL Workplace Communication – Level 2 – NEW! For non-native English speakers who want to continue developing their English language skills, this course helps studentsbecomemorecomfortableandfluentwhencommunicating in public and in the workplace. Prerequisite: ESL Program Orientation
XESL-503 $249
ID#13159 Jan.23-March10 TuTh 6-8:30p.m. TCID#13166 March12-April28 TuTh 6-8:30p.m. TCID#13167 April30-June16 TuTh 6-8:30p.m. TC
Continuing Education Call Center – 843.574.6152 47
PERSONAL ENRICHMENT
Motorcycle Safety
Motorcycle Basic Rider (BRC)This course is intended for the novice rider interested in properly learning the fundamental skills to safely operate a motorcycle. Riders who are returning from an extended absence from motorcycling are also encouraged to attend this course. The course meets SC law for allowing the motorcyclist to qualify for an insurance discount; please contact your insurance company to verify eligibility. Students mustcompleteanonlinee-course(includedinthecoursefee)and,laterintheclass,aridingassessmenttoreceivetheMotorcycleSafetyFoundation(MSF)card.Afteryouregister,a separate email is sent to you within seven days of the class start containing the link and a personal code to enter. Once you have completed the e-course, print a hard copy of the completioncertificateandpresentittotheridercoachesteaching the classroom portion of your class on Friday from 6 to 10 p.m. Practical application riding is on Satuday and Sundayfrom8a.m.-4:30p.m.;classridingtimemayvaryduetoweather conditions and level of enrollment. Training bikes and helmets are provided; however, riders with some experience may bring their street legal, registered and insured personal bikes for use in the course. For those seeking a motorcycle license endorsement road test waiver, you must currently possess a valid SC state-issued driver’s license. Successful completionoftheMSFcourseandevaluationqualifiesyoufor a road test waiver to receive your motorcycle license endorsement. Prerequisite: Motorcycle Basic Rider (BRC) enrollees must be eligible to apply for a driver’s license if they do not currently hold one and must be able to ride a bicycle. Book and online course fee included
XTRL-601 $299
ID#13145 Jan. 17-19 F-Su see description TCID#13147 Jan. 31-Feb. 2 F-Su see description TCID#13150 Feb. 7-9 F-Su see description TCID#13151 Feb. 21-23 F-Su see description TCID#13153 March 13-15 F-Su see description TCID#13155 March 20-22 F-Su see description TCID#13157 March 27-29 F-Su see description TCID#13158 April 3-5 F-Su see description TCID#13160 April 17-19 F-Su see description TCID#13161 April 24-26 F-Su see description TCID#13162 May 1-3 F-Su see description TCID#13163 May 8-10 F-Su see description TCID#13164 May 15-17 F-Su see description TCID#13165 May 29-31 F-Su see description TCID#13168 June 5-7 F-Su see description TCID#13169 June 12-14 F-Su see description TCID#13170 June 19-21 F-Su see description TCID#13171 June 26-28 F-Su see description TC
48LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
PERSONAL ENRICHMENT
Outdoor Living
Herbal Tea Gardens Herbalteashavemanyhealthbenefitsandgrowingyourownherbs gives you the pleasure of creating custom blends. Learn how to grow, dry and store herbs, as well as how to use them for tea and other soothing delights.
XHRT-550 $49
ID#12938 May 23 Sa 9 a.m.-noon TC
Lowcountry Landscaping Basics Avoid costly mistakes by learning the soil, growing seasons, recommended vegetation and planting techniques associated with Zone 8b.
XHRT-540 $49
ID#12957 March 24 Tu 9 a.m.-noon TCID#12958 April 11 Sa 9 a.m.-noon BC
Window Box Garden Learn design considerations, planting techniques and recommended plant care for growing your own eyecatching containers and window boxes.
XHRT-511 $49
ID#12937 April 18 Sa 9 a.m.-noon TC
Attracting Pollinators Welcome a variety of hardworking pollinators to your garden thisspringandeveryonebenefits.Learnwhatattractsvariouspollinators and create a bee/insect house to take home.
XHRT-551 $49
ID#12939 March 21 Sa 9 a.m.-noon TC
Beekeeping – Introduction Learn what is involved with managing bee hives. Topics include honey bee anatomy and biology; honey and other hive products; common pests and diseases; equipment; and the time and expenses associated with hive management.
XHRT-522 $39
ID#12921 Jan. 29 W 6-8 p.m. MPID#12923 Feb. 8 Sa 10 a.m.-noon PC
Beekeeping – Advanced Join Journeyman Beekeeper Jim Strohm to learn more about tools, feeders, protective equipment, seasonal management of hives, honey extraction and labeling, as well as treatments for hive pests and disease.
XHRT-524 $39
ID#12919 Feb. 11 Tu 6-8 p.m. TC
Birding in the Lowcountry Lead master naturalist instructor Keith McCullough shares recommendations for where, when and how to get started birding. You also learn how to identify birds by sight and sound, and some of the best ways to attract birds to your habitat.
XHRT-542 $39
ID#12956 Feb. 12 W 6-8 p.m. TC
Bonsai for Beginners Explore the history, fundamental design concepts and simple shaping techniques for creating a magical bonsai tree.
XHRT-549 $49
ID#12936 June 13 Sa 9 a.m.-noon TC
Continuing Education Call Center – 843.574.6152 49
PERSONAL ENRICHMENT
Personal Finance, Skills and Health
PERSONAL SKILLS
Drone/UAV Piloting Increase your understanding of drone capabilities and practice piloting with an FAA-licensed UAV pilot. Fee includes a drone you can use in class, but you can also bring your own if you prefer.
XAPT-505 $119
ID#12946 Feb. 15-22 Sa 9 a.m.-noon BC
Nonprofit Fundraising Workshop – NEW! Thisworkshophelpsnonprofitvolunteersincreasetheircomfort level and improve their success rate when asking for charitabledonations.Experiencedcampaigneroffersguidanceto help you raise money and other support for your favorite organization
XBUS-668 $69
ID#13141 Feb. 8-22 Sa 10 a.m.-noon PC
HEALTH AND WELLNESS
CBD Oil Explained Learn what CBD oil is and isn’t, as well as how some use it as a natural herbal remedy to address anxiety, pain and sleep issues.
XHTH-502 $49
ID#12940 Feb. 22 Sa 9-11 a.m. BC
Eat Right, Move MoreThis all-encompassing wellness class places an emphasis on reading labels, mindful food shopping and nutritional recipes.
XSFT-509 $125
ID#13377 Jan.17-April24 F 12:15-1p.m. TC
PERSONAL FINANCE
Passport to RetirementManage investment risks, use new tax laws to your advantage, make informed decisions about your company retirement plan, and adjust your estate plan to function properly under the new laws. Couples may attend together for a single registration fee. Book included
XBAF-502 $69
ID#12996 Jan.23-30 Th 6:30-8:45p.m. MPID#12999 April23-30 Th 6:30-8:45p.m. MPID#12995 Jan.21-28 Tu 6:30-8:45p.m. TCID#12998 April21-28 Tu 6:30-8:45p.m. TC
Savvy Social Security PlanningExplore the smallest details about regulations involving Social Security including recent changes and options.
XBAF-508 $49
ID#13179 March24 Tu 6-8:30p.m. TC
50LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
Pets and AnimalsPERSONAL ENRICHMENT
Dog Grooming Basics for Owners Gain skills to maintain your dog’s skin and coat, and learn how to care for its nails, eyes and ears which is good for your pet’s health, while saving you time and money. Professionals Kristin Kleeman and Amanda Petrocelli of Unleashed Dog Grooming explain tools and techniques for basic home grooming.Participants must provide proof of current vaccinations for canines attending class.
XVET-506 $199
ID#12953 March4-18 W 6-8:30p.m. MP
Pet Emergency CareLearnthebasicsofemergencycareandfirstaidforyourpetandknowwhattodoindifferentcriticalscenariosincludingchoking, CPR, heat stroke, eye injuries, fractures, cuts, and even hypothermia. Note: Emergency treatment and first aid for pets should never be used as a substitute for veterinary care, but it may save your pet’s life in an emergency situation before you can get your pet to a veterinarian.
XVET-501 $49
ID#13220 Feb. 15 Sa 9 a.m.-1 p.m. TCID#13221 April 18 Sa 9 a.m.-1 p.m. MPID#13222 June 20 Sa 9 a.m.-1 p.m. TC
Therapy Dog Introduction Learn what’s involved in becoming a therapy dog team, where you can be of service in the community, and which behaviors and traits are important for both the animal and handler to have. Dogs are invited to attend class, too. Participants must provide proof of current vaccinations for canines attending class.
XVET-504 $39
ID#12951 March25 W 6:30-9:30p.m. MPID#12952 June13 Sa 1:30-4:30p.m. TC
COMPUTER TECHNOLOGY
Alice 3-D and Animation (Ages 7-17)Want to make animated movies and interactive video games? Use Alice 3-D to tell your story by animating objects like people, animals and vehicles in a virtual world. Using block-based programming tools, create your own stories while practicing logical and computational thinking skills.
XDKC-608 $39
ID#13334 March 28 Sa 9 a.m.-noon TC
Code Breakers (Ages 7-17)Whether you’re a beginning or more experienced coder, enjoy practicing coding languages like JavaScript, CSS, HTML and Python to create websites, video games and more.
XDKC-502 $39
ID#13331 March 14 Sa 9 a.m.-noon TC
Gamestar Mechanic (Ages 7-17)Design your own video game while using critical thinking and problem-solving skills to create amazing aesthetics and storylines in Gamestar Mechanic’s collaborative, competitive and socially-interactive environments. Ignite 21st century STEM skills through a fun, entertainment-focused outlet.
XDKC-646 $39
ID#13326 Feb. 15 Sa 9 a.m.-noon TC
Minecraft (Ages 7-17)This class is for Minecraft enthusiasts of all abilities! Find your inner artist as you create 2D and 3D landscapes, architectural structures and art designs. More experienced with the game? Hone your creative invention and mechanical skills to engineer complex works of machinery. This is a play-based, co-learning class facilitated through instructor-guided challenges.
XDKC-565 $39
ID#13323 Feb. 1 Sa 9 a.m.-noon TC
NATURE AND OUTDOORS
Wilderness Survival Training (Ages 12-17)Learn the basics of outdoor survival such as prepping, tools andgear,outdoorcookery,firstaid,howtofindfoodandwater,bushcraft,firestarting,navigationandemergencyweatherpreparedness. This class is perfect for hikers, backpackers, nature enthusiasts and anyone heading for the great outdoors
XDTU-631 $65
ID#13342 April11 Sa 9a.m.-1:30p.m. TC
Continuing Education Call Center – 843.574.6152 51
YOUTH PROGRAMS
Computer Technology and Nature/Outdoors
52LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
YOUTH PROGRAMS
Creative Arts and Leadership Skills
CREATIVE ARTS
Glass Fusion Art (Ages 7-17)Make art that’s a big step up from your paper creations! Create fantastic glass tiles and pieces of jewelry. Make your favorite team’s emblem, light catchers for your window, wall hangings, ornaments, or gifts for family and friends.
XDKC-765 $55
ID#13329 Feb. 29 Sa 9 a.m.-noon TC
Sweetgrass Creations (Kids and Adults)Local artisan Jennifaye Singleton of Geechee Handmade Sweetgrass Baskets teaches you how to make your own sweetgrass creation. Learn how to make a basket, ornament or key to take home. Registration is good for one craft item for an adult and child to create together or one single adult or child may register. Materials provided
XDKC-636 $55
ID#13346 April 25 Sa 10 a.m.-noon TC
3D Printing (Kids and Adults)Using industry-leading design software and 3D printing technology in the new South Carolina Aeronautical Training Center, learn to make a physical object from a digital model. Create a unique piece to take home! Registration is good for one child to be accompanied by an adult.
XART-537 $79
ID#13327 Feb. 22 Sa 9 a.m.-noon TC
LEADERSHIP SKILLS
American Sign Language (Ages 7-17)Do you have a family member or friend who is deaf or hard of hearing? Want to help others in your community? Knowing sign language helps you connect with more people. Learn how to sign by practicing the alphabet, playing games and singing songs.
XDKC-590 $39
ID#13344 April 18 Sa 9 a.m.-noon TC
Safe Sitter (Ages 12-17)Do you want to start a babysitting business? Learn injury prevention,firstaid,chokingrescueandbasicCPR,andmanageproblembehaviorstobecomeaconfidentbabysitter.Alsolearnhowtokeepyourselfsafe,setbabysittingrates,findemployers and promote your business.
XDTU-788 $75
ID#13336 April 4 Sa 9 a.m.-1 p.m. TC
Continuing Education Call Center – 843.574.6152 53
YOUTH PROGRAMS
Culinary, Baking and Pastry
Asian Fusion Favorites (Ages 7-17)Learn simple, healthy Asian cooking by trying your hand at a savory mix of international favorites like Chinese egg rolls, Korean bulgogi, Asian lettuce wraps, garlic fried rice and Filipino jelly rolls.
XDKC-759 $69
ID#13343 April18 Sa 9a.m.-12:30p.m. TC
Best of Breakfast Baking (Ages 7-17)Become your family’s expert at serving brunch or breakfast inbed.Morningglorymuffins,baconcheddarbiscuits,quickcinnamonrolls,andminimuffincupfrittatasarethefancy,funand simple recipes of the day. Learn your new breakfast skills just in time for Mother’s Day and Father’s Day!
XDKC-815 $59
ID#13347 May 2 Sa 9 a.m.-noon TC
Competition in the Kitchen! (Ages 7-17)Using secret ingredients in a light-hearted cooking competition for all ages, be ready to be judged on creativity, presentation and taste with minimal time to plan and execute the best dish.
XDKC-761 $69
ID#13332 March 21 Sa 9 a.m.-noon TC
County Fair Favorites (Ages 7-17) – NEW!Do you love outdoor fairs and festivals? We all know that people attend those events for the food! Learn how to make all-time American fair favorites like corn dogs, fried Oreos, funnel cakes, fries, fried vegetables and other fun dishes and treats.
XDKC-814 $59
ID#13345 April 25 Sa 9 a.m.-noon TC
Culinary Boot Camp (Ages 7-17)Practice basic chef skills by making soup and a salad dressing, cooking a gourmet macaroni and cheese pasta, and sautéing vegetables. Master knife skills, learn sanitation procedures and practice food handling processes used by professional chefs.
XDKC-612 $69
ID#13325 Feb.15 Sa 9a.m.-12:30p.m. TC
Geode Cupcake Wonders (Ages 7-17)Imagine the wonders of the geologic world by creating igneous “rock” magma chocolate bars, metamorphic Snickers, and sedimentary chocolate chip crisped rice treats. Create stunning geode formations by adding edible crystals, colors and metallic accents to freshly baked cupcakes.
XDKC-813 $69
ID#13341 April11 Sa 9a.m.-12:30p.m. TC
54LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars; = Payment Plan Available
YOUTH PROGRAMS
Culinary, Baking and Pastry
Hip Hop Easter Bunny Cake (Ages 7-17)Comebakeupcute-as-a-bunnytreatstokickoffspring.Learnto use frosting, candy and fondant to showcase your hippity-hoppity creativity and take home cupcakes and mini cakes for the whole family.
XDKC-640 $69
ID#13335 April 4 Sa 9 a.m.-noon TC
Italian Country Kitchen (Ages 7-17)Cook like an Italian maestro as you work with recipes from the countryside of Italy’s famous cities and regions. Make homemade pasta, sauces, pizzas, salads and entrees. Viva Italia!
XDKC-767 $59
ID#13333 March 28 Sa 9 a.m.-noon TC
Magical Sweets and Treats (Ages 7-17)Create enchanted desserts that would win the approval of everyone’s favorite teenage wizard. Make a variety of magical sweets featured in the wonderful world of J.K. Rowling including Harry’s favorites like exploding bon bons, butterbeer cupcakes, Weasley’s fever fudge, and better than Hagrid’s rock cakes.
XDKC-610 $69
ID#13330 March14 Sa 9a.m.-12:30p.m. TC
Pastry Boot Camp (Ages 7-17)Learn techniques used in professional pastry kitchens including making the perfect tart dough, the secret to a silky smoothchocolateganache,thedifferencebetweenstovetopand baked custards, and just what is “pâte à choux?”
XDKC-630 $69
ID#13328 Feb.22 Sa 9a.m.-12:30p.m. TC
Valentine Chocolate Extravaganza (Ages 7-17)Share your love for chocolate with family and friends by creating treats like chocolate peppermint hearts, chocolate-dipped strawberries, Nutella panna cotta, and lava cake served right out of the oven.
XDKC-812 $59
ID#13324 Feb. 8 Sa 9 a.m.-noon TC
Continuing Education Call Center – 843.574.6152 55
YOUTH PROGRAMS
Spring Break and Summer Camps
SPRING BREAK CAMPS
Art-rageous! (Ages 7-11) – NEW!Have a blast working with various art media and use techniques to create your own original works of art. Learn about art techniques from all over the world by exploring foundations of painting, fundamentals of sketching and optical illusion art.
XDKC-874 $149
ID#13337 April6-10 M-F 8:30a.m.-noon TC
Be a YouTube Influencer (Ages 7-11)Do you have something important to say or something you’d like to teach others? Want to gain followers on YouTube and othersocialmedia?Learnhowtoinfluencetheworldbymarketing to groups and media outlets. Be the master of your own virtual presence.
XDKC-758 $159
ID#13340 April6-10 M-F 1-4:30p.m. TC
Science of Toys (Ages 7-11)Do you ever wonder what makes your favorite toys work? Learn about the mechanics and inner workings of classic American toys. You get to take toys apart to see what’s really inside – and even build your own toys to take home.
XDKC-779 $149
ID#13338 April6-10 M-F 8:30a.m.-noon TC
Theater Explorers (Ages 7-11)Experience the rush of dramatic and performing arts during this fun week of group theater games and improvisation. Share your new-found dramatic talents in a performance at the end of camp
XDKC-637 $139
ID#13339 April6-10 M-F 1-4:30p.m. TC
SUMMER CAMPS
Summer Camps: This summer, let your children make memories that last a
lifetime with summer camps at Trident Tech! Learn video game
design techniques, whip up delicious culinary delights, train to
becomeababysitter,tryyourhandatfilmandmediaprojects,
orgainconfidenceandimproveself-esteemwiththeater
camps.Half-day,week-longcampsrunfrom8:30a.m.-noon
and1-4:30p.m.atallTridentTechnicalCollegecampusesJune
8-July31,2020.Optionsareavailableforearlydropoffand
late pickup as well as supervised lunchtime making camp fun
availablefrom7:30a.m.-5:30p.m.RegistrationopensFeb.15,
2020.
For more information, visit
www.tridenttech.edu/ce/programs/summer-camps/index
56LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars ; = Payment Plan Available
Campuses and Sites
BERKELEY CAMPUS1001S.LiveOakDr.(Highway17-A),MoncksCorner,SC29461843.899.8000
Winter/Spring Continuing Education Classes• AmericanSignLanguage(ASL)–Level2,seepg.46• CBD Oil Explained, see pg. 49• Drone/UAV Piloting, see pg. 49• Lowcountry Landscaping Basics, see pg. 48• Starting a Food Truck Business, see pg. 15• Train the Trainer, see pg. 30• Welding - Gas Metal Arc 200-Hour, see pg. 28• Welding - Gas Metal Arc MIG, see pg. 28• Welding - Gas Tungsten Arc TIG, see pg. 28• Welding Basics for Beginners, see pg. 40
MOUNT PLEASANT CAMPUS1125 John Dilligard Lane, Mount Pleasant, SC 29464 843.958.5810
Winter/Spring Continuing Education Classes• Aikido - Soft Martial Arts, see pg. 45• AmericanSignLanguage(ASL)–Level1and2, see pg. 46• AutoCAD/Revit for Interior Design, see pg. 16• Beekeeping – Introduction, see pg. 48• Dog Grooming Basics for Owners, see pg. 50• Interior Design Special Topics, see pg. 16• Interior Design Studio II and III, see pg. 16• Passport to Retirement, see pg. 49• Pet Emergency Care, see pg. 50• Sewing Fundamentals, see pg. 40• Starting a Food Truck Business, see pg. 15• SterileProcessingTechnician(SPT),seepg.20• Therapy Dog Introduction, see pg. 50
In addition to the Thornley Campus in North Charleston, Trident Technical College offers continuing education courses at its convenient campuses and sites across the Lowcountry.
Continuing Education Call Center – 843.574.6152 57
Campuses and Sites
PALMER CAMPUS66 Columbus St., Charleston, SC 29403 843.722.5500
Winter/Spring Continuing Education Classes• A Taste of Mardi Gras, see pg. 43• Beekeeping – Introduction, see pg. 48• CharlestonClassicsDemystified,seepg.41• Craft Beer Brewing, see pg. 41• FridaysintheBakeShop:Baguettes,Bagelsand Bialys, see pg. 42• FridaysintheBakeShop:EuropeanYeastBreads, see pg. 42• FridaysintheBakeShop:FermentationandCultures, see pg. 42• FridaysintheBakeShop:SweetBreads,seepg.42• Homebrewing Fundamentals, see pg. 42• International Easter Baking, see pg. 42• NonprofitFundraisingWorkshop,seepg.49• Sewing Fundamentals, see pg. 40• Starting a Food Truck Business, see pg. 15
ST. PAUL’S PARISH SITE5231 Hwy. 165, Hollywood, SC 29449 843.323.3800
Public Broadband Computer Center – FREEThe center is equipped with computers utilizing high-speed internet and is open for members of the community to use free ofcharge(hoursaresubjecttochange).• Monday-Thursday:8:30a.m.-12:30p.m. and2:30-7:30p.m.• Friday:8:30a.m.-12:30p.m.• Saturday:10a.m.-2p.m.
Winter/Spring Continuing Education Class• AmericanSignLanguage(ASL)–Level1,seepg.46
DORCHESTER COUNTY QUICKJOBS TRAINING CENTER5164 E. Jim Bilton Blvd., St. George, SC 29477 843.563.5269 or 843.574.2591
Public Broadband Computer Center – FREEThe center is equipped with computers utilizing high-speed internet and is open for members of the community to use free ofcharge(hoursaresubjecttochange).• Monday:7:30a.m.-5p.m.• Tuesday:7:30a.m.-9p.m.• Wednesday:7:30a.m.-5p.m.• Thursday:7:30a.m.-5p.m.• Friday:7:30a.m.-12:30p.m.• FirstSaturdayofeachmonth:8-10:30a.m.
Winter/Spring Continuing Education Classes• Check back next term for new continuing education offerings.
58LOCATION KEY: BC = Berkeley Campus; MP = Mount Pleasant Campus; OL = Online; OS = Offsite; PC = Palmer Campus;
SP = St. Paul’s Parish Site; TC = Thornley Campus; n = Veterans Education Benefits; = Senior Scholars ; = Payment Plan Available
How to RegisterRegisternow–coursesfillquickly!Pre-registrationisrequired.Please enroll at least one week prior to the class start date to help prevent your course from being cancelled.
Fees must be paid in full at time of registration. We accept cash, check, American Express®, Discover®, MasterCard®, VISA® and purchase orders. Payment plans are available for coursesthatcost$499ormoreandincludethe symbol in this catalog.
Onlinewww.tridenttech.edu/ceandhttp://tridenttech.augusoft.net
PhoneCall 843.574.6152; available Monday-Friday, 8 a.m.-5 p.m.
FaxPrinttheformfromwww.tridenttech.edu/ce(RegistrationInformation)andlistcredit/debitcardpaymentinformationand fax to 843.574.6310.
MailPrinttheformfromwww.tridenttech.edu/ce(RegistrationInformation)andmailwithfullpaymentto:Trident Technical CollegePO Box 118067, CE-MCharleston, SC 29423-8067
In PersonOpenMonday-Friday,8a.m.-5p.m.,visit:Trident Technical College Thornley Campus, Bldg. 9102001 Mabeline Rd.North Charleston, SC 29406
Discounts, Scholarships and Veterans BenefitsVisitwww.tridenttech.edu/ce(FundingOpportunities)toseeifyouqualifyforscholarshipsorveteransbenefits.Coursesthatinclude the n symbol are currently approved for Veterans EducationBenefits.
Studentsages65andoldercanreceivea10%discountonselect personal enrichment courses with this symbol as Senior Scholars. Discount is applied to eligible classes automatically at checkout.
Registration Information
Continuing Education Call Center – 843.574.6152 59
BooksPurchase your Continuing Education textbooks at the TTC Bookstore.Visithttp://bookstore.tridenttech.eduorcall843.574.6578 for information. Please have your course code available.
Online CoursesFor the Online Course Help Desk, call 843.574.6689 or email ceonlinehelp@tridenttech.edu.
Course Changes, Drops and ConfirmationsEmailce.reg@tridenttech.eduorcalltheRegistrationofficeat843.574.6152 at least a week before your course start date.
Wait-ListIfyourdesiredcourseisfilled,pleasecheckforotheropenclass dates or add yourself to a class wait-list. You will be contacted by a registration specialist if a spot becomes available.
Refund PolicyTrident Technical College reserves the right to cancel courses duetoinsufficientenrollmentorinstructoravailability,inwhichcase registrants receive a full refund. The college gives no refunds after a course starts. No-shows are responsible for the full registration fee.
• Continuing Education Courses The college grants a full refund to registrants or sponsoring agenciesifthecancellationisreceivedfiveormorebusinessdays before the course starts, or the registration fee may be transferred to colleagues or associates. The college willrefundregistrantsorsponsoringagencies75%oftheregistration fee if the cancellation is received within four business days before the course starts.
• Teen University and Kids’ College The college grants a full refund to registrants if the cancellation is received 11 or more business days before thecoursestarts,lessa$20processingfee.Thecollegewillrefundregistrants75%oftheregistrationfeeifthecancellation is received within 10 business days before the coursestarts,lessa$20processingfee.
Auxiliary AidsIf you require any auxiliary aids, services or accommodations, please call 843.574.6131.
For more information, call 843.574.6152 and visit www.tridenttech.edu/ce.
College HolidaysAll Trident Technical College campuses and sites are closed to the public around various holidays throughout the year. Classesarenotheldonthefollowingdates:
*Dec. 24, 2019-Jan. 1, 2020
*Jan. 20, 2020
*May 25, 2020
*July 4, 2020
*Sept. 7, 2020
*Nov. 26-27, 2020
*Dec. 24, 2020-Jan. 1, 2021
Registration Information
Learn more on pg. 30
top related