CIRTRU CLASSIFIED Submitted in partial fulfillment of the requirements MASTER OF COMPUTER APPLICATION DEPARTMENT OF MASTER OF COMPUTER APPLICATION V. E. S. INSTITUTE O CIRTRU CLASSIFIED A PROJECT REPORT Submitted in partial fulfillment of the requirements Of the degree of MASTER OF COMPUTER APPLICATIONby Ajit T. Panada (Roll No. 39) Supervisor : Prof. Mr. Ramesh Solanki DEPARTMENT OF MASTER OF COMPUTER APPLICATIONV. E. S. INSTITUTE OF TECHNOLOGYCHEMBUR -74 UNIVERSITY OF MUMBAI 2014 - 2015 MASTER OF COMPUTER APPLICATION DEPARTMENT OF MASTER OF COMPUTER APPLICATION F TECHNOLOGY ii | P a g e VIVEKANAND EDUCATION SOCIETYSINSTITUTE OF TECHNOLOGYCollectorCERTIFICATE OF APPROVAL OF PROJECT WORKThisistocertifythatMcarriedoutthe projectwork tVIofMCAoftheUniversityofMumbai, 2014 2015. PRINCIPAL PROJECT GUIDE/INTERNAL VIVEKANAND EDUCATION SOCIETYSINSTITUTE OF TECHNOLOGYCollectors Colony, Chembur, Mumbai - 400 074 CERTIFICATE OF APPROVAL OF PROJECT WORKThisistocertifythatMr.AjitTankiaPanada(RollNo.39)hassatisfactorilcarriedoutthe projectwork titledCirtru Classified in partial fulfilment of Sem. ofMCAoftheUniversityofMumbai,MaharashtraStateHEAD OF DEPTPROJECT GUIDE/INTERNAL EXAMINEREXTERNAL EXAMINERiii | P a g eVIVEKANAND EDUCATION SOCIETYS INSTITUTE OF TECHNOLOGY 074 CERTIFICATE OF APPROVAL OF PROJECT WORK hassatisfactorily in partial fulfilment of Sem. MaharashtraStateduringtheyear HEAD OF DEPT EXAMINER iv | P a g e Project Report Approval for M.C.A ThisthesisprojectreportentitledCirtruClassifiedbyAjitTankiaPanadais approved for the degree of Master of Computer Applications. Examiners 1.----------------------------------------- 2.----------------------------------------- Date: Place: v | P a g e DECLARATION I declare that the report of the project work entitled Cirtru Classified, represents my ideas in my own words and where others' ideas or words have been included, I have adequatelycitedandreferencedtheoriginalsources.IalsodeclarethatIhave adheredtoallprinciplesofacademichonestyandintegrityandhavenot misrepresentedorfabricatedorfalsifiedanyidea/data/fact/sourceinmy submission.Iunderstandthatanyviolationoftheabovewillbecausefor disciplinary action by the Institute and can also evoke penal action from the sources which have thus not been properly cited orfrom whom proper permission has not been taken when needed. ---------------------------------------------- (Signature) ----------------------------------------- (Name of student and Roll No.) Date: vi | P a g e ACKNOWLEDGEMENT Ioweagreatmanythankstoagreatmanypeoplewhohelpedandsupportedme during the writing of this book. MydeepestthankstoLecturer,Mr.RameshSolankitheGuideoftheprojectfor guiding and correcting various documents of mine with attention and care. He has takenpaintogothroughtheprojectandmakenecessarycorrectionasandwhen needed. I express my thanks to the Principal Dr.(Mrs.) J. M. Nair for her continued support andIwouldliketo expressmy sincere thanks toMrs. NishiTiku(H.O.D) forhis constant encouragement, which made this project a success. My deep sense of gratitude to Mr. Navish Jain, Founder, CIRTRU CLASSIFIEDS PVT LTD for support and guidance. Thanks and appreciation to the helpful people at CIRTRU CLASSIFIEDS PVT LTD, for their support. During this project work I have gained both practical as well as theoretical knowledge of great significance. IwouldalsothankmyInstitutionandmyfacultymemberswithoutwhomthis projectwouldhavebeenadistantreality.Ialsoextendmyheartfeltthankstomy family and well wishers. Ajit Panada vii | P a g e ABSTRACT CurrentlyClassifiedwebserviceproviderlikeSulekha.comandOLXproviding servicestoallsocialclasseswheretrustfactorisbeingcompromised.Today classifiedsserviceproviderwebsitesverifytheirusersbasedonemailaddress andmobilenumber.Howeveranypersoncancreateanyfakeemailaddresses andgetverifyonrespectiveclassifiedwebsiteandcanpostfakeadvertiseon such web sites and make user frustrated. CirtruClassifiedsverifiessellersandbuyersbasedontheirworkemailwithout revealingtheirworkidentitytooutsiders.Insimplewords,itisLinkedInfor classifieds with identity hidden. It is very essential for a user to find elite seller or sellshisstufftotheworkingprofessionalsintheirownornearbycircles (companies). ThisentireprojectbuildsusingNode.js,Angular.js,HTML5&CSS3.Major componentsofthisprojectareresponsive,userfriendlyandhavegoodUXthat helps elite user to buy/sell items. It also helps to provide value to its contributors by making available to them its vast global audience reach. viii | P a g e LIST OF FIGURES Figure No.NamePage No. Figure 4.1Agile Methodology16 Figure 4.2 Figure 4.3 Figure 4.4 Figure 4.5 Figure 4.6 Figure 4.7 Figure 4.8 Agile Methodology Overview Agile Design Phase Use Case Diagram Cirtru Classified Use Case Diagram of Cirtru Classified Use Case Diagram for System Roles Sequence Diagram for Login through System Account Sequence Diagram for Login through Facebook Account 20 22 23 24 26 28 29 Figure 4.9Sequence Diagram for Login through Google Account30 Figure 4.10Sequence Diagram System Signup & Account Validation31 Figure 4.11Sequence Diagram Posting Ad32 Figure 4.12 Figure 4.13 Figure 4.14 Activity Diagram System Login Activity Diagram System Operation Activity Diagram System Operation for Seller 34 35 36 Figure 4.15Activity Diagram System Operation for Buyer37 ix | P a g e LIST OF ABBREVIATIONS PVT LTD Private Limited ITInformation Technology QAQuality Assurance RAD Rapid Application Development UAT User Acceptance Testing GUI Graphical User Interface UI User Interface UXUser Experience JS Java Script HTMLHypertext Markup Language CSSCascading Style SheetDBDataBase ADAdvertisement SOW Scope of Work x | P a g e TABLE OF CONTENT Sr. No. Title Page No. 1.CERTIFICATE ----------------------------------------------------------------------ii 2.DECLARATION -------------------------------------------------------------------- v 3.ACKNOWLEDGEMENT ---------------------------------------------------------vi 4.ABSTRACT --------------------------------------------------------------------------vii 5.LIST OF FIGURES -----------------------------------------------------------------viii 6.LIST OF ABBREVIATIONS -----------------------------------------------------ix Chapter1. Introduction-------------------------------------------------------------------1 1.1 Abstract--------------------------------------------------------------------------- 2 1.1.1About Organization -------------------------------------------------------31.2 System overview ----------------------------------------------------------------4 1.3 Objective ------------------------------------------------------------------------- 4 1.4 Scope ------------------------------------------------------------------------------ 5 1.5 Project Profile ------------------------------------------------------------------- 5 2. System Analysis ---------------------------------------------------------------7 2.1 System Study and Problem Formulation -----------------------------------8 2.1.1Bottlenecks Identified in Existing System ------------------------------ 8 2.1.2Need of the Current System -----------------------------------------------92.2Feasibility Study ---------------------------------------------------------------- 10 2.2.1 Technical Feasibility ------------------------------------------------------- 10 2.2.2 Resource Availability ------------------------------------------------------ 10 2.2.3 Operational Feasibility ----------------------------------------------------- 10 2.2.4 Economical Feasibility -----------------------------------------------------11 3. Process Description ----------------------------------------------------------12 3.1Project Overview --------------------------------------------------------------13 4. Development Life Cycle ----------------------------------------------------15 4.1Requirement Analysis --------------------------------------------------------- 19 4.2 Design Document and Prototype --------------------------------------------21 4.2.1 Use Case Diagram ---------------------------------------------------------- 22 4.2.1.1Diagram Building Blocks ------------------------------------------------22 4.2.1.2Use Case Diagram for Cirtru Classified -------------------------------23 4.2.1.3Use Case Diagram for System Roles -----------------------------------25 4.2.2Sequence Diagram --------------------------------------------------------- 26 4.2.2.1Diagram Building Blocks ------------------------------------------------26 4.2.2.2Sequence Diagram for Login through System Account --------------27 xi | P a g e 4.2.2.3Sequence Diagram for Login through Facebook Account ------------ 28 4.2.2.4Sequence Diagram for Login through Google Account --------------- 29 4.2.2.5Sequence Diagram for System Signup and Account Activation ----- 30 4.2.2.6Diagram for Posting Ad ----------------------------------------------------31 4.2.3Activity Diagram ----------------------------------------------------------32 4.2.3.1Diagram Building Blocks --------------------------------------------------32 4.2.2.2Activity Diagram for Simple System Login ---------------------------- 33 4.2.3.2Activity Diagram for System Operation -----------------------------------34 4.2.3.3Activity Diagram of System Operation for Seller ------------------------35 4.2.3.4Activity Diagram of System Operation for Buyer ------------------------36 4.3Iteration, Demo and Feedback ------------------------------------------------37 4.4Identify Defects and Resolve Bugs -------------------------------------------38 4.5Production and Technical Support ------------------------------------------39 5. System Requirement Study ------------------------------------------------- 40 5.1Introduction ----------------------------------------------------------------------41 5.2Requirement Specification ----------------------------------------------------41 5.2.1Hardware Requirement ----------------------------------------------------41 5.2.2Software Requirement -----------------------------------------------------41 6. Testing---------------------------------------------------------------------------47 6.1Unit Testing --------------------------------------------------------------------- 48 6.2Functionality Testing ----------------------------------------------------------49 6.2.1 Checking of all links -------------------------------------------------------49 6.2.2 Testing for forms -----------------------------------------------------------49 6.2.3 Cookies Testing ------------------------------------------------------------ 49 6.2.4 Database Testing ----------------------------------------------------------- 49 6.2.5 HTML/CSS Validation ---------------------------------------------------49 6.3Usability Testing --------------------------------------------------------------- 50 6.3.1 Testing for Navigation ----------------------------------------------------- 50 6.3.2 Content Checking -----------------------------------------------------------50 6.3.3 Other user information for user help ------------------------------------- 50 6.4Interface Testing --------------------------------------------------------------- 50 6.5Compatibility Testing --------------------------------------------------------- 51 6.6Performance Testing ---------------------------------------------------------- 51 6.7Security Testing ---------------------------------------------------------------- 52 7. User Manual ------------------------------------------------------------------53 8. Key Learning ----------------------------------------------------------------- 80 9. Bibliography ------------------------------------------------------------------ 82 1 | P a g e

1. Introduction

2 | P a g e 1. Introduction 1.1ABSTRACT Thisdocumentismeantfordescribingallthefeaturesandproceduresthatwere followedwhile developingthe system. Thisdocumentspeciallymentionsthedetailsoftheprojecthowitwasdeveloped,the primaryrequirement,aswellasvariousfeaturesandfunctionalitiesoftheprojectandthe proceduresfollowedin achievingthese objectives. Themainobjectiveofthisprojectistoallowuserstofindelitesellerstheycouldtrustwithin their nearby circles. CirtruClassifiedsverifiessellersandbuyersbasedontheirworkemailwithoutrevealingtheir work identity to outsiders. It is very essential for a user to find elite seller or sells his stuff to the working professionals in their own or nearby circles (companies). Thissystemisveryhelpfulforprovidingasmoothinteractionbetweenverifiedsellersand buyers, who have been working in same or different companies/schools. TheITinitiativeshaveencourageddevelopingasystemthatprovidesanintegratedand automated customer to customer transaction by keeping the trust and work identity verification as its centroid. The core features provided by Cirtru Classifieds to its users are: 1.Trust: User can deal with the people you would trust based on their employer or school. 2.Verification: Only Verified users are allowed to use services offered by Cirtru. 3.Work Identity Protection: Users work identity is never revealed to anyone, ever. 3 | P a g e 4.Security: None of user data is ever displayed on Cirtru. Hence no spam bots can ever reach to user. 1.1.1 ABOUT ORGANIZATION CirtruClassifiedPVTLTDisMumbaibasedstartupfirmwhichisclassifiedserviceprovider currentlycateringSanFranciscoBayArea.Cirtru.comisLinkedInforclassifiedswithidentity hidden.CirtruClassifiedPVTLTDisMumbaibasedstartupfoundedbyex-Stanfordandex-IITian.CurrentlymarketplaceforCirtruClassifiedisRental,Housing,Cars,andUseditems. CirtruClassifiedhelpsuserfindappropriatebuyer/sellerthatyoucouldtrust.Cirtruclassified initially available for Indian people in San Francisco, but now its available for all people inbay area. Cirtru Classified is local classified currently available for City of San Francisco, South Bay Area,EastBayArea,Peninsula,NorthBay,andSantaCruz,California.Cirtruclassifiedhelps userstofindelitesellerstheycouldtrustwithintheirnearbycircles.CirtruClassifiedsverifies sellersandbuyersbasedontheirworkemailwithoutrevealingtheirworkidentitytooutsiders. Cirtruverifies buyers/sellers basedontheiremployers/schools.Itisveryessentialforauserto findelitesellerorsellshisstufftotheworkingprofessionalsintheirownornearbycircles (companies).CurrentlyCirtruclassifiedhave5classifiedcategoriesasRoommates,Sublets, Cars,Furniture&Useditems.Cirtruclassifiedfocusesoncreatingtheirvaluesandproviding value added services to their customer. Read more at:https://cirtru.com/aboutus. 4 | P a g e 1.2SYSTEM OVERVIEW CirtruClassifiedwebsystemisbuiltonNode.js,AngularJS,Bootstrap,HTML5,CSS3,and MongoDB. The Web application is built to serve the following areas. Tomaketheprocessofpostinganadvertisementforusermorereliable, descriptive, and error free. Provide secure environment to the users by verifying them based on work emails. Real time response to the ad poster. Presenting statistical data related the classified users to the administrator. The databaseis self-explanatoryas the code. Administrator has a privilege to add, modify, and delete work email based on user request. Administratorhasprivilegetoadd,delete,andmodifyadvertisementpostedby user.User can register, login and post advertisement to the respected category.User can share their advertisement on social media such as facebook, twitter etc. 1.3OBJECTIVE Creatinguserfriendly,easytouse,attractiveUIandUXthathelpsusertopost advertise easily. Tomaintainandstoreaddetail,responsedetail,adviewerdetailsandadposter detail. Provide classifieds as a service to enable its users to connect with one another. UseNODE.JSandMongoDBservertechnologytocreatestrongandsecured databaseconnectivity. Provide value to its contributors by making available to them its vast global audience reach. Displayinginformationrelatedtoadvertisementineffectivemannersothatbuyers can find as per their requirements. Filter data as per user provided option. 5 | P a g e 1.4SCOPE CirtruClassifiedwebsiteisLinkedInforclassifiedswithuseridentityhidden.Currently CirtruClassifiedcateringservicestoonlySanFranciscoBayArea.Everyuseronthis classifiedisverifiedbasedonitsemployer/school.IfemployeeofGooglelookingfora roommateorbuyingusedcartrustsanAppleemployeemorethananystrangeronother classified site. Cirtru Classified keeps user privacy, never reveal or share it with others and keepsusersprotectedfromscams.CirtruClassifiedsallowsusersinseekingelite roommatesandtenantswithintheirnearbycirclesorcompaniesaswellashelpsthemin buyingandsellingofotherverticalsofclassifiedssuchascars,furnituresandother forsale items posted by users from same or different companies. 1.5PROJECT PROFILE 1.System Interface Website would be a self-contained system. It will not access data of any other application nor will other application have access to its data. 2.User Interface WebsitewillbeaccessedthroughaBrowserInterface.Theinterfacewouldbe viewedbest using 1024x 768 and 800x 600 pixels resolutionsettingfor desktop. As website is responsive in design it can be viewed from small size device such as mobilephonetolargesizedevicesuchasdesktop.Thesoftwarewouldbefully compatiblewithGoogleChromeBrowserandaboveversions.Nouserwouldbe able to access any part of the application without logging on to the system. 3.Hardware/ SoftwareEnvironment Hardware Interface: PentiumIV 80 GB Hard Disk 512 MB RAM 6 | P a g e Software Interface: Operating System : Any operating system DevelopmentTools oNode.JS oMongo DB oAngularJS oHTML5 and CSS3 oBootstrap3 Web Browser : oInternet Explorer 8 and higher versions oGoogle Chrome oSafari oOpera Mini oMozillaFirefox Documentation& PresentationTools oMicrosoftWord 2013 4.Constraints: UserinterfaceisonlyinEnglishi.e.nootherlanguageoption is available. User can login only with his assigned username and password i.e. no guest facility is available. 7 | P a g e 2. System Analysis 8 | P a g e 2. System Analysis 2.1System Study and Problem Formulation 2.1.1Bottlenecks Identified in Existing System CurrentlyClassifiedwebserviceproviderlikeSulekha.comandOLXprovidingservicestoall socialclasseswheretrustfactorisbeingcompromised.Todayclassifiedsserviceproviderweb sites verify their users based on email address and mobile number. However any person can create any fake email addresses and get verify on respective classified website and can post fake advertise on such web sites and make user frustrated. Craigslistisaclassifiedadvertisementswebsitewithsectionsdevotedtojobs,housing,and personals,forsale,services,community,anddiscussionforums.CraigNewmarkbeganthe service in 1995 as an email distribution list tofriends,featuringlocaleventsintheSan FranciscoBayArea.Craigslistbecameweb-basedservicein1996andexpandedintoother classifiedsectionandcategories.ItstartedexpandingtootherU.Scitiesin2000,andnow covers 50 countries. HoweverClassifiedsitecraigslisthasbeenlinkedwith330crimes,12murdersand105 robberies or assault in the United States last year due to anonymous interactions on the site, says a new study. ThestudyundertakenbyAIMGroup,whichexaminednationwidecrimereportsreportedin localmediacoverage,concludestheanonymityonCraigslistisexploitedbycriminalsacross thecountrytorobassaultorevenkillconsumersastheytrytobuyorsellthingslikecars, apartments and furniture.ThereportcallsCraigslistacesspoolofcrime,citingmurders,rapes,robberies,assaultand rentalrip-offsassomeoftheexamples.AIMconcludestheseareeverydayoccurrenceson Craigslist, warning users that the old rules ofmeetingin public and knowing whomyoure dealing with no longer apply.9 | P a g e AnonymousclassifiedscanposeaseriousdangertoconsumersandasaresultCraigslisthas become a one-stop shop for criminals, says Peter Zollman, founding principal of AIM. In this era of Facebook and socialnetworks, its smarter and safer to sell a car or a couch to someone you know.Oncraigslistbuyerdontknowwhomtheyaredealingwithontheothersideofthephoneor computer,whichmakesitunsafe.BesidesCraigslistcompletelyallowsuserssearchwithout requiring a user name or an email address which may lead into the risk of scam. 2.1.2Need of the Current System Tosolvesecurityrelatedproblemsinthedomainofclassified,theyrequireacomputerized system that verify userin order to introduce trustfactor in the classified section. Theyrequired awebbasedapplicationthatwillprovideaworkingenvironmentthatwillbeflexibleand will enable smooth interaction between elite buyer and seller. Aims andObjectiveCreating user friendly, easy to use, attractive UI that helps user to post advertise easily. To maintain and store ad detail, response detail, ad viewer details and ad poster detail. Providevaluetoitscontributorsbymakingavailableto themitsvastglobalaudience reach. Displaying information related to advertisement in effective manner so that buyers can find as per their requirements. Filter data as per user provided option. Constraints, Assumptions,Dependencies Constraints As this system is based on client server technology, so for normal operation minimum of 64 MB RAM will be required on all clients. Assumptions Ingeneralithasbeenassumedthattheuserhascompleteknowledgeofthe systemthatmeansuserisnotanaiveuser. Systemis target for users that have work email.Anydataenteredbyhim/herwill bevalid. Dependencies Oneshouldverifyhis/herownworkE-mailbeforepostingandcontactingany advertise in this system. 10 | P a g e 2.2 FEASIBLITY STUDY Feasibility Study is the measure of how beneficial or practical the development of an application or an information system would be to an organization. The feasibility study for Cirtru Classified Portal took place in following Phases: 1.Technical Feasibility 2.Resource Availability 3.Operational Feasibility 4.Economic Feasibility 2.2.1 Technical Feasibility Technical feasibility centers on the existing manual system of the test management process and to whatextentitcansupportthesystem.Accordingtofeasibilityanalysisprocedurethetechnical feasibilityofthesystemisanalyzedandthetechnicalrequirementssuchassoftwarefacilities, procedure, inputs are identified. It is also one of the importantphases of the system development activities. The system offers greater levels of user friendliness combined with greater processing speed.Therefore,thecost ofmaintenancecanbereduced.Since,processingspeedisveryhigh and the work is reduced in the maintenance point of viewmanagement convince that the project is operationally feasible. 2.2.2 Resource Availability Manpower: The required human resources are available. Hardware Availability: The required hardware is available. Software Availability: The required Software packages are installed and ready to use. 2.2.3 Operational Feasibility:Operationalfeasibilityisameasureofhowwellaproposedsystemsolvestheproblems,and takesadvantageoftheopportunitiesidentifiedduringscopedefinitionandhowitsatisfiesthe requirements identified in the requirements analysis phase of system development. ManagementSupport:Operationalfeasibilityreviewsthewillingnessofthe organizationtosupporttheproposedsystem.Thisisprobablythemostdifficultofthe feasibilitiestogauge.Inordertodeterminethisfeasibility,itisimportanttounderstand the management commitment to the proposed project.The managementisinfull support of this portal. 11 | P a g e CurrentSystemIssues:Inthecurrentsystem,theusersarenotawareoftheperson withwhomtheyaredealingwithontheothersideofthephoneorcomputer,which makes it unsafe and may lead into the risk of scam. The users are finding current system very easy to use in terms of UX but not in its UI design. UserInvolvement:Theusersarecompletelyinvolvedintheprocess ofdevelopment ofthisportalasithasbeencustomizedperiodicallybasedonusersfeedbackand suggestions. 2.2.4 Economical Feasibility:Economicanalysisismostfrequentlyusedforevaluationoftheeffectivenessofthesystem. Morecommonlyknownascost/benefitanalysistheprocedureistodeterminethebenefitand saving that are expected from a system and compare them with costs, decisions is made to design and implement the system. This part of feasibility study gives the top management the economic justification for the new system.Thisisanimportantinputtothemanagementthemanagement,becauseveryoftenthetop managementdoesnotliketogetconfoundedbythevarioustechnicalitiesthatboundtobe associated with a project of this kind. Theproposedsystemiseconomicallyfeasiblefortheorganizationsincetheorganizationneed not require any additional hardware and softwareresources as well as it saves a lot of time. 12 | P a g e 3. Process Description 13 | P a g e 3. Process Description 3.1Project Overview TheCirtruClassifiedshelpsusersinfindingeliteroommatesandbuying&sellingofother verticals of classifieds such as cars, furnitures and other forsale items. This online portal is created not only to allow the working professionals in seeking verified and trusted roommates in their nearby circles or companies but also to buy and sell cars, furnitures and other such forsale items among each other. The Cirtru Classifieds Portal allows the users to go through the following stages: Sign Up Verify Work Email Sign In Post AD Get Responses from other Users Sign Up Thisportalrequiresalluserstosignupbeforepostinganadvertisementorcontactingother relatedadvertisementspostedbysimilarusersintotheportal.Howeverthisportalprovides multiple ways to sign up for all users and they are: 1.Sign Up with Facebook2.Sign Up with Google Plus 3.Sign Up with Email Verify Work Email After a successful signup process, the user needs to verify his or her work email to ensure thathe/sheisavalidemployeeofanyparticularcompany.Theworkemailofusersis never revealed to other users and outsiders. Sign In: Inordertopostanadvertisementorcontactingotherlistingspostedbysimilarusersintothe portal,theuserneedtobeloggedinwithhis/herrespectiveuseridandpassword.Hencethis portalprovidesaqualityloginwindowwhichprovidestheusermultiplewaystoenterintothe site and they are: 14 | P a g e 1.Sign In with Facebook 2.Sign In with Google Plus 3.Sign In with Email Oncetheuserisloggedintotheportalforthefirsttime,theportalpromptstheusertoverify his/her work email. Hence it is more secure and reliable than other classified portals. Post Ad: Oncetheuserissuccessfullyloggedin,he/shecanpostanadvertisementfortheavailabilityof roomfor sharing among roommates or sublettingan entire room. The user is also allowed to sell his/hercar,furnituresandothersuchforsaleitemstogetfasterresponsefromthebuyerswho have been working in similar or other related circles or companies. Get responses from other users: Once the listing is live on Cirtru, the user will get response from other users if they are interested in his/her respective listing. However this portal keeps its promise of not disclosing the users work emailbyallowingtheseekersorbuyerstocontactontheuserspersonalemail.Thechanceof getting faster responses from verified users is very high in this portal. 15 | P a g e 4. Development Life Cycle 16 | P a g e 4. Development Life Cycle Project Development Approach Software Model Tosolveactualproblemsinanindustry,softwaredeveloperorateamofdevelopersmust incorporateadevelopmentstrategythatencompassestheprocess,methodsandtoolslayers andgenericphases.Thisstrategyisoftenreferredtoas,processmodelorasoftware developingparadigm.Aprocessmodelforsoftwaredevelopingischosenbasedonthenature ofprojectandapplication,themethodsandtoolstobeused,andthecontrolsand deliverablesthatarerequired.Allsoftwaredevelopmentcanbecharacterizedasaproblem solvingloopinwhichfourdistinctstagesareencountered:Statusquo,Problemdefinition, technicaldevelopmentandsolutionintegration.Regardlessoftheprocessmodelthatis chosenforasoftware project all of the stages coexist simultaneouslyat some level of detail. TheSoftwareDevelopmentlifecycleacceptedforthedevelopmentof Cirtru Classified Portal is Agile Methodology. Agile Methodology TheAgilemethodologyisanapproachtoprojectmanagement,typicallyusedinsoftware development.Ithelpsteamsrespondtotheunpredictabilityofbuildingsoftwarethrough incremental,iterativesprints.Belowisadiagramshowingthevariouscomponentsoftheagile method. AgilemethodologiesrequireaProjectManagertoworkcloselywiththedevelopment teamand customer; driving the pace of the project. As a result, the Project Manager plays anintegral role in the success of the overall project. Agilemethodologyisacollectionofinnovative,user-centeredapproachestosystem development.Ittriestodefineanoverallsystemplanquickly,developandreleasesoftware quickly, and then continuously revise the software to add additional features. After the downsides 17 | P a g e ofthetraditionalsoftwaredevelopmentapproacheswereidentified(toomanydocumentations, all requirements must be known at the beginning of a project) it became obvious that we needed anotherapproach.AndthatshowAgilewascreated.Agilesoftwaredevelopmentusesiterative development as a basis but advocates a lighter and more people-centric viewpoint than traditional approaches. Agile processes fundamentally incorporate iteration and the continuous feedback that it provides to successively refine and deliver a software system. Fig 4.1: Agile Methodology 1.Requirement Analysis: This is equivalent to researching and brainstorming what the product requires.Examplescanincludegeneralfeatures,architecturediscussions,workflow discussions and general product discovery. 2.DesignDocument&Prototype:Thisis the SOW (Scope of work), which willhave all the requirements defined for the product. 18 | P a g e 3.Iterations,Demo&Feedback:Duringthedevelopment,iterationsareneededtotestthe code as well as get feedback from the customer on progress. Feedback from the customer can include: mockups, front-end designs, and usability. 4.Identifydefects&ResolveBugs:Bugsanddefectsarealwaysaconstantinthesoftware developmentprocess.ItisimportantthattherearegoodQualityAssurancestandardsto eliminate general issues. 5.Production&TechnicalSupport:Thesoftwareapplicationisfinallydeployedandlive. Once this occurs, a support plan needs to be in place for maintenance andgeneral support on potential future issues. Agile software development (also called agile) isnt a set of tools or a single methodology, but a philosophy of people who had realized that in software development its pretty hard to predict: The number of changes and priority changes in software requirements How much design is needed before construction is used to prove it The time for analysis, design, construction and testing These are key characteristics of the agile methodology: Deliver frequently More iterations Less defects Test frequently Collaborative approach Maximum ROI Itisveryeffectiveinenvironmentswherefrequentchangesintherequirementshappenquite oftenduetovariousbusinessreasons.Sinceithasmoreiterationsandmorethanonebuilt deployment for a project, it involvesmore client interactions and testing which brings a solution for the requirement. Some people believe that there is less documentation in Agile, but it includes documentation and it can be used either in small or in large projects. 19 | P a g e Fig 4.2: Agile Methodology Overview 4.1 Requirement Analysis: TherequirementsfortheCirtruclassifiedsportalweregeneratedbytheFounderwhoona regular basis builds and deploy various important applications of the firm. AsthemodelbeingusedinthisprojectdevelopmentisAgileMethodology,newrequirements evolve over time. Inthisproject,thetechnicalteamcannoteffectivelyproduceallrequirementsinhighenough detailforimplementationtooccuratthebeginningofaproject.SinceAgileMethodologywas used, this portal values a high visibility and customer involvement.ThefrequentchangesmadetothisportalusingAgileapproachesgivescustomersachanceto try portal periodically and provide feedback. The requirements of the users for Cirtru Classified included the following: 1.Classified web application which is robust, scalable in nature. 2.Classified portal which have fast, responsive in design and have better UX and UI. 20 | P a g e 3.Classified portal that provide value to its contributors by making available to them its vast global audience reach. 4.Displaying information related to advertisement in effective manner so that buyers can find as per their requirements. 5.Filtering of data based on cities, price range and user provided options. 6.Classified portal that can provide statistical data of users to the superadmin 7.Classified portal whichcan easilysupport mapbasedfeature such as GoogleMAPS and latest APIs. 8.Classified portal which can easily communicate with mail server and support their APIs. 21 | P a g e 4.2 Design Document & Prototype IntheDesignphase,designoftheproduct/solutiontobedoneiscomeupwith.Herethe developmentteamunderstandstherequirementsandcomesupwithateststrategy/planto proceed with testing of the piece being developed. Inthedesignphase,weanalyzeindividualrequirementsby modelstorming onajust-in-time (JIT)basisforafewminutesbeforespendingseveralhoursordaysimplementingthe requirement. Guided by our architecture models, often hand-sketched diagrams, we take a highly-collaborative, test-driven design (TDD) approach to development where we iteratively write a test and then write just enough production code to fulfill that test. IntheAgileMethodology,overallsystemdesignwillemergeovertime,evolvingtofulfillnew requirements and take advantage of new technologies as appropriate. HenceDesign models need tobe justbarelygoodenough.Youdontneedtomodeleverysingledetailinyourmodels, the modelsdontneedtobeperfect,andtheycertainlydontneedtobecomplete.AgileModel allowsthedeveloperstodosomehigh-levelarchitecturalmodelingduringinitialIteration,also known as the warm-up phase, and detailed design during development iterations and even during the end game (if needed). Fig 4.3: Agile Design Phase 22 | P a g e 4.2.1Use Case Diagram Use case diagrams are used to describea set of actions (use cases) that some system or systems shouldorcanperformincollaborationwithoneormoreexternalusersoftheSystem(actors). Eachusecaseshouldprovidesomeobservableandvaluableresulttotheactorsorother stakeholders of the system. Use case diagrams are used to specify: requiredusagesofa system -tocapturewhatasystemunderconstruction is supposed to do. The functionality offered by a system. How the environment shouldinteract with the system so that it willbe able to perform its services. 4.2.1.1Diagram Building Blocks System: Presentedbyarectanglewithsystemnameinuppercornerwithapplicableusecases inside the rectangle and actors outside the system boundaries. Actor: Presented by a stick man icon with the name of the actor above or below the icon. Use case: Usually shown as an ellipse containing the name of the use case. Extend: Arelationshipinwhichoneusecase(extension)extendsthebehaviorofanother use case (base). Shown as a dashedline anopen arrowhead directed from the extending use case to the extended (base) use case. The arrow is labeled with the keyword . Include:Arelationshipinwhichoneusecase(base)includesthefunctionalityofanotheruse case (inclusion). The arrow is labeled with the keyword . 23 | P a g e 4.2.1.2Use Case Diagram for Cirtru Classified Fig 4.4: Use Case Diagram Cirtru Classified 24 | P a g e

Fig 4.5: Use Case Diagram of Cirtru Classified 25 | P a g e 4.2.1.3Use Case Diagram for System Roles Fig 4.6: Use Case Diagram for System Roles 26 | P a g e 4.2.2Sequence Diagram A sequence diagramis a kind ofinteraction diagram that shows how processes operate with one anotherandinwhatorder.Itdepictstheobjectsandclassesinvolvedinthescenarioandthe sequence of messages exchanged between the objects needed to carry out the functionality of the scenario.SequencediagramstypicallyareassociatedwithusecaserealizationsintheLogical View of the system under development. 4.2.2.1Diagram Building Blocks Whendrawingasequencediagram,lifelinenotationelementsareplacedacrossthetopofthe diagram. Lifelines represent either roles or object instances that participate in the sequence being modeled.Lifelinesaredrawnasaboxwithadashedlinedescendingfromthecenterofthe bottomedge.Thelifeline'snameisplacedinsidethebox.Inordertodisplayinteraction, messages are used. These are horizontal arrows with the message name written above them. Solid arrowswithfullheadsaresynchronouscalls,solidarrowswithstickheadsareasynchronous calls and dashed arrows with stick heads are return messages.Activationboxesormethod-callboxesareopaquerectanglesdrawnontopoflifelinesto represent that processes are being performed in response to the message. 27 | P a g e 4.2.2.2Sequence Diagram for System Login through system Account Fig 4.7: Sequence Diagram for System Login through system Account 28 | P a g e 4.2.2.3Sequence Diagram for System Login through Facebook Account Fig 4.8: Sequence Diagram - System Login through Facebook Account 29 | P a g e 4.2.2.4Sequence Diagram for System Login through Google Account Fig 4.9: Sequence Diagram - System Login through Google Account 30 | P a g e 4.2.2.5Sequence Diagram for System Signup & Account activation Fig 4.10: Sequence Diagram - System Signup & Account activation 31 | P a g e 4.2.2.6Diagram for Posting Ad Fig 4.11: Sequence Diagram - Posting Ad 32 | P a g e 4.2.3Activity Diagram Activitydiagramsaregraphicalrepresentationsofworkflowsofstepwiseactivitiesandactions withsupportforchoice,iterationandconcurrency.IntheUnifiedModelingLanguage,activity diagramscanbeusedtodescribethebusinessandoperationalstepby-stepworkflowsof components in a system. An activity diagram shows the overall flow of control. 4.2.3.1Diagram Building Blocks Activitydiagramsareconstructedfromalimitednumberofshapes,connectedwith arrows. The most important shape types: Rounded rectangles represent activities Diamonds represent decisions Bars represent the start (split) or end (join) of concurrent activities A black circle represents the start (initial state) of the workflow An encircled black circle represents the end (final state) 33 | P a g e 4.2.3.2Activity Diagram for Simple System Login Fig 4.12: Activity Diagram System Login 34 | P a g e 4.2.3.3Activity Diagram for System operation Fig 4.13: Activity Diagram System operation 35 | P a g e 4.2.3.4Activity Diagram of System operation for seller Fig 4.14: Activity Diagram System operation for Seller 36 | P a g e 4.2.3.5Activity Diagram of System operation for Buyer Fig 4.15: Activity Diagram System operation for Buyer 37 | P a g e 4.3Iterations, Demo & Feedback Themainfocusinthisphaseisonbuildingtheprototypeiterativelyandgettingitreviewedby the users (Development team) to ensure that the requirements are met. Theprototypeisimprovedthroughdemonstrationtotheuser,takingthefeedbackand incorporatingthechanges.Thiscycleisrepeatedgenerallytwiceorthriceuntilapartof functional model is agreed upon. Theendproductofthisphaseisafunctionalmodelconsistingofanalysismodelandsome software components containing the major functionality. Various Phases of this stage are: Agree PlanCreate Functional PrototypeReview PrototypeIdentify Functional Prototype Agreement on Plan Alltheanalysisdoneinthebusinessstudyphasemustbeagreedbytheuser.The development should go accordingly. Creating Functional Prototype To develop functional prototype all the required GUI Components must be ready.The functional prototype is just to check whether it meets a particular requirement. In this LifeCycledevelopmenteveryrequirementmayleadto thedevelopmentofaparticular prototype which would then be tested and implemented Review Prototype Thisstepisabouttestingandreviewingprototype.Thischeckswhetherallthe requirements are met or not. 38 | P a g e Identify Functional Prototype The reviews or feedback from users is carefully analyzed and checked. For the proper identification of the exact requirement, the whole cycle may be repeated.4.4Identify Defects & Resolve Bugs Bugs and defects are always a constant in the software development process. It isimportant that there are good Quality Assurance standards to eliminate general issues. Some Agile teams, especially those that embrace lean development, take a different approach to defects. Anytime a bug is identified, an automated test is written to reproduce it, the bug is fixed, andboth the code fix and the test are checkedin. The test documents the bug, and will alert the team in case that same problem occurs again. This enables teams to fix and forget bugs. AmuchbetterprimaryuseforQATestersaretohelpdefinethefunctionalrequirementsand workwithDeveloperstoensurethoserequirementsaredevelopedtocorrectlybeforeany Acceptance Testingis done. If a problem such as a failed Test Scenarioisfoundin theAgile QA Test state then the Developers and QA work together to fix it immediately. ThisisoneofthewaysagileprojectsgenerallycostlessthansimilarTraditionalprojects. In Agile projects we fix the problems sooner in the cycle so that the developer who wrote the code is able to fix and the sooner they find it and fix it the cheaper it is to do so.And we dont need to document everything.We only document what we feel is necessary and will retain its value over the long run. IfasystemispurposefullydesignatedthatitmustgothroughanEnd-to-Endprocessbya separateteam,thenanypost-developmenttestingthatiscoveredbyAcceptedUserStoriesthat break are legitimate defects to be created, fixed and tracked. 39 | P a g e 4.5Production and Technical Support The software application is finally deployed and live. Once this occurs, a support plan needs to be in place for maintenance and general support on potential future issues. ThegoaloftheProductionphaseistokeepsystemsusefulandproductiveafter theyhavebeen deployedto theusercommunity.Thisprocesswilldifferfromorganizationto organizationand perhaps even from system to system, but the fundamental goal remains the same: keep the system running and help users to use it. The Production phase ends when the release ofa systemhasbeen slatedfor retirement or when support for that release has ended. The latter may occur immediately upon the release of a newer version,sometime after the release of a newer version, or simply on a date that the business has decided to end support. The Release Retirement milestone, described in detail in a later section, is the final approval for a release to exit the production phase. Thisphasetypicallyhasoneiterationbecauseitappliestotheoperationallifetimeofasingle releaseofyoursoftware.Theremaybemultipleiterations,however,ifyoudefinedmultiple levels of support that your software will have over time. The Production phase for a release does not necessarily end when a new development project for a subsequent release of that product begins. You will have to operate and support earlier releases inparalleltodevelopmentefforts.Infact,youmayhavemultiplereleasesinproductionatthe same time. For example, the operations and support for both versions 1.0 and 1.1 continues for a shortperiodafterversion1.1isreleased.Itisnotuntilversion2.0isreleasedthatsupportfor version 1.0 is discontinued. 40 | P a g e

5. System Requirement Study 41 | P a g e 5. System Requirement Study Software Requirement Specification 5.1Introduction Asoftwarerequirementsspecification(SRS)isacomprehensivedescriptionoftheintended purposeandenvironmentforsoftwareunderdevelopment.TheSRSfullydescribeswhatthe software will do and howit willbe expected to perform. An SRSminimizes the time and effort required by developers to achieve desired goals and also minimizes the development cost. A good SRSdefineshowanapplicationwillinteractwithsystemhardware,otherprogramsandhuman usersinawidevarietyofreal-worldsituations.Parameterssuchasoperatingspeed,response time,availability,portability,maintainability,footprint,securityandspeedofrecoveryfrom adverse events are evaluated. Methods of defining an SRS are described by the IEEE (Institute of Electrical and Electronics Engineers) specification 830-1998. 5.2Requirement Specification 5.2.1Hardware Requirement PentiumIV 80 GB Hard Disk 512 MB RAM 5.2.2Software Requirement Technology Requirement oNode.JS oMongo DB oAngular JS oHTML5 and CSS3 oBootstrap3 oJavaScript 42 | P a g e DevelopmentTools oGIT oWebStorm IDE Web Browser : oInternet Explorer 8 and higher versions oGoogle Chrome oSafari oOpera Mini oMozillaFirefox Node.js Node.jsisaserversideplatformbuiltonGoogleChrome'sJavaScriptEngine(V8Engine). Node.js was developed by Ryan Dahlin 2009 anditslatest versionis v0.10.36.Node.jsis an opensource,cross-platformRuntimeEnvironmentforserver-sideandnetworking applications. Node.js applications are written in JavaScript, and can be run within the Node.js runtime on OS X, Microsoft Windows, and Linux. Node.jsalsoprovidesarichlibraryofvariousJavaScriptmoduleswhicheasesthe development of web application using Node.js to great extents. Following are the areas where Node.js is proving itself a perfect technology partner. I/O bound applications Data Streaming Application Data Intensive Real-time Application JSON APIs based application Single Page Application Features of Node.js 1.Asynchronous and Event Driven AllAPIsofNode.jslibraryareasynchronousthatisnon-blocking.ItmeansaNode.js based server never waits for a API to return data. Server moves to next API after calling it and anotificationmechanism of Events of Node.js helps server to get responsefrom the previous API call. 2.Very Fast 43 | P a g e BeingbuiltonGoogleChrome'sV8JavaScriptEngine,Node.jslibraryisveryfastin code execution. 3.Single Threaded but highly Scalable Node.jsusesasinglethreadedmodelwitheventlooping.Eventmechanismhelpsserver torespondinanon-blockingwaysandmakesserverhighlyscalableasopposedto traditional servers which create limited threads to handle requests. 4.No Buffering Node.jsapplicationsneverbufferanydata.Theseapplicationssimplyoutput thedatain chunks. Mongo DB MongoDB is a cross-platform, document oriented database that provides, high performance, high availability, and easy scalability. MongoDB works on concept of collection and document. Features of MongoDB 1.Schema Less MongoDBisdocumentdatabaseinwhichonecollectionholdsdifferentdocuments. Numberoffields,contentandsizeofthedocumentcanbedifferingfromonedocument to another. 2.Single Object Concept Structure of a single object is clear and simple. 3.No complex Joins 4.Deep Query ability MongoDBsupportsdynamicqueriesondocumentsusingadocument-basedquery language that's nearly as powerful as SQL. 5.Tuning 6.Scalable MongoDB is easy to scale 7.No need for object mapping Mapping of application objects to database objects not needed in MongoDB. 44 | P a g e Angular JS AngularJS is an open source web application framework. It was originally developed in 2009 byMiskoHeveryandAdamAbrons.ItisnowmaintainedbyGoogle.Itslatestversionis 1.3.14.AngularJSisapowerfulJavaScriptbaseddevelopmentframeworktocreateRICH InternetApplication(RIA).AngularJSprovidesdevelopersoptionstowriteclientside application (using JavaScript) in a clean MVC (Model View Controller) way. Features of AngularJS 1.Data Binding Databindingimprovesdatareusability.Databindingisautomaticsynchronizationof data between model and view components. 2.Templates Thesearetherenderedviewwithinformationfromthecontrollerandmodel.Thesecan be a single file (like index.html) or multiple views in one page using "partials".3.MVC AngularJSincorporatesthebasicprinciplesbehindtheoriginalMVCsoftwaredesign patternintohowitbuildsclient-sidewebapplications.AngularJSdoesnotimplement MVC in the traditional sense, but rather something closer to MVVM (Model-View-View Model). 4.Dependency Injection AngularJShasabuilt-independencyinjectionsubsystemthathelpsthedeveloperby making the application easier to develop, understand, and test.Dependency Injection (DI) allows you to ask for your dependencies, rather than having to go look for them or make them yourself. 5.Directives 45 | P a g e DirectivescanbeusedtocreatecustomHTMLtagsthatserveasnew,customwidgets. Theycanalsobeusedto"decorate"elementswithbehaviorandmanipulateDOM attributes in interesting ways. 6.Services AngularJScomewithseveralbuilt-inservicesforexample$httptomakea XMLHttpRequests.7.Filters These select a subset of items from an array and return a new array. 8.Routing It is concept of switching views. 9.Scope These are objects that refer to the model. They act as glue between controller and view. HTML5 TheHTML5languagehasa"custom"HTMLsyntaxthatiscompatiblewithHTML4and XHTML1documentspublishedontheWeb,butisnotcompatiblewiththemoreesoteric SGML features of HTML 4. HTML 5 does not have the same syntax rules as XHTML where we neededlower case tag names, quoting our attributes; an attribute had to have a valueand to close all empty elements. New elements are introduced into HTML5, which helps for better structure.RichsetofApplicationProgrammingInterfacesareavailablesuchasHTML Geolocation,HTMLDragandDrop,HTMLLocalStorage,HTMLCachewhichhelps development of web application a lot easier. CSS3 CSS3isthelateststandardforCSS.CSS3iscompletelybackwards-compatiblewithearlier versionsofCSS.Itcontainsthe"oldCSSspecification"(whichhasbeensplitintosmaller pieces). In addition, new modules are added. Some of the most important CSS3 modules are: Selectors Box Model Backgrounds and Borders 46 | P a g e Text Effects 2D/3D Transformations Animations BOOTSTRAP3 Bootstrapisasleek,intuitive,andpowerful,mobilefirstfront-endframeworkforfasterand easier web development. It uses HTML, CSS andJavaScript. Bootstrap easily and efficiently scalesyourwebsitesandapplicationswithasinglecodebase,fromphonestotabletsto desktops with CSSmedia queries. It was released as an open source product inAugust 2011 on GitHub. JavaScript JavaScriptisadynamiccomputerprogramminglanguage.Itislightweightandmost commonlyusedasapartofwebpages,whoseimplementationsallowclient-sidescriptto interactwiththeuserandmakedynamicpages.Itisaninterpretedprogramminglanguage with object-oriented capabilities. JavaScript is complementary to and integrated with HTML.JavaScript is open and cross platform. Git Git is a free and open source distributed version control system designed to handle everything from small to very large projects with speed and efficiency. The Git feature that really makes it stand apart from nearly every other SCM out there is its branching model. 47 | P a g e 6. Testing 48 | P a g e 6. Testing 6.1Unit Testing Thisisthefirstandthemostimportantleveloftesting.Assoonastheprogrammer developsaunitofcodetheunitistestedforvariousscenarios.Astheapplicationisbuiltitis muchmore economical to find and eliminate the bugs early on. Unit Tests are a key component of software engineering, and the Extreme Programming discipline leverages them to permit easy code changes. Developers write tests for every class they produce. The tests are intended to test every aspect of the class that could conceivably not work. HenceUnitTestingisthemostimportantofallthetestinglevels.As the software project progresses ahead it becomes more and more costly to find and fix the bugs. Thetestinginvolvedafullreviewofthecodingandcheckingiffurtherenhancementscanbemadetothealreadysuccessfulmodule,theunittestingiscarriedoutduring development stage of the project and it rightly justifies.InUnittesting,whiletestingwefocusedonverifyingsmallportionsoffunctionalityofCirtru classified. For example, an individual unit test case focuses on verifying that the correct data has been saved to the database when post ad button on form is being clicked. Animportantsubsetofunittestingthatisoftenoverlookedisrangechecking.Thatis,making sureallthefieldsthatcollectinformationfromtheuser,cangracefullyhandleanyvaluethatis entered.Mostpeoplethinkofrangecheckingasmakingsurethatanumericfieldonlyaccepts numbers. Oncetheunittestingiscompletedforalltheallowedmodulesorformsthemajoreventof integration testing takes place. Unit testing is done by developers. 49 | P a g e 6.2Functionality Testing Inthistesting,weperformedtestingforallthelinksinwebpagesforsubmittingorgetting information from user, cookie testing. 6.2.1Checking of all links Testing for all internal links. Testing links jumping on the same page. Testing of links used to send the email to admin or other users from web pages. Testing for orphan pages. Testing for broken links. 6.2.2Testing for forms Testing for validation on each field Testing for Default values of the fields. Testing of options to create forms if any, form delete, view or modify the forms. 6.2.3Cookies Testing Cookies are smallfiles stored on user machine. These are basically used to maintain the session or store user related data. Here we test the web application by enabling or disabling the cookies in your browser options. In this we test if the cookies are encrypted before writing to user machine. Also we test for login sessions and user statistics after session end.6.2.4Database Testing Dataconsistencyisveryimportantinwebapplication.Checkingfordataintegrityanderrors whileuseredit,delete,modifytheformsordoanyDBrelatedfunctionality.Testing if the entire database queries are executing correctly, data is retrieved correctly and als qo updated correctly is being performed.6.2.5HTML/CSS Validation HTML/CSS validation playsveryimportant rolefor search engines, hence playsimportant role. In this web site is validate for HTML syntax errors. 50 | P a g e 6.3Usability Testing 6.3.1Testing for navigation: Usercannavigatefromonepagetoanotherthroughdifferentcontrolslikebuttons,boxesor using the links on the pages to surf different pages. Usability testing includes:Web site should be easy to use. Instructions should be provided clearly. Check if the provided instructions are correct means whether they satisfy purpose. Main menu should be provided on each page. It should be consistent. 6.3.2Content Checking Contentshouldbelogicalandeasytounderstand.Checkforspellingerrors.Use ofdarkcolors annoysusersandshouldnotbeusedinsitetheme.Therearesomestandardsthatareusedto followforwebpageandcontentbuilding.Thesearecommonacceptedstandardslikeas mentioned above about annoying colors, fonts, frames etc. Content should be meaningful. All the anchortextlinksshouldbeworkingproperly.Imagesshouldbeplacedproperlywithproper sizes.6.3.3Other user information for user help Sitemap should be present with all the links in web sites with proper tree view of navigation. Check for all links on the sitemap. Search in the site option will help users to find content pages they are looking for easily and quickly. These are all optional items.6.4Interface Testing The main interfaces are: Web server and application server interface Application server and Database server interface. Checking of all interactions between these servers are executed properly is done in this part. Errorsarehandledproperly.Ifdatabaseorwebserverreturnsanyerrormessageforany querybyapplicationserverthenapplicationservershouldcatchanddisplaytheseerror messages appropriately to users. 51 | P a g e 6.5Compatibility Testing Browser Compatibility: Differentbrowsershavedifferentconfigurationsandsettingsthatyourwebpageshould becompatiblewith.Yourwebsitecodingshouldbecrossbrowserplatformcompatible. IncaseofusingjavascriptsorAJAXcallsforUIfunctionality,performingsecurity checks or validations then givemore stress on browser compatibility testing ofyour web application.TestwebapplicationondifferentbrowserslikeInternetexplorer,Firefox, Netscape navigator, AOL, Safari, Opera browsers with different versions. Operating System Compatibility Somefunctionalityinyourwebapplicationismaynotbecompatiblewithalloperating systems.Allnewtechnologiesusedinwebdevelopmentlikegraphicsdesigns,interface callslikedifferentAPIsmaynotbeavailableinallOperatingSystems.Itistestingof webapplicationondifferentoperatingsystemslikeWindows,UNIX,MAC,Linux,and Solaris with different OS flavors. Mobile Browsing Here we test the web pages in mobile browsers. If any compatibility issues may be there on mobile browser, they may note down and notify to developers during this. 6.6Performance Testing Web application should sustain to heavy load. Web performance testing should include: Web Load Testing WebLoadTestingconsistsoftestingapplicationperformanceondifferentinternet connection speed. Inwebload testing, test ifmany users are accessing or requesting the same page. Can system sustain in peak load times?Siteshouldhandlemanysimultaneoususerrequests,largeinputdatafromusers, Simultaneous connection to DB, heavy load on specific pages etc. 52 | P a g e Web Stress Testing Webstresstestingisperformedtobreakthesitebygivingstressandcheckedhow systemreacts tostressandhowsystemrecoversfromcrashes.Stressisgenerallygiven oninputfields,loginandsignupareas.Inwebperformancetestingwebsite functionality on different operating systems anddifferent hardware platformsis checked for software, hardware memory leakage errors. 6.7Security Testing Following are some test cases considered for web security testing: 1.Test by pasting internalURL directly into browser address bar without login. Internal pages should not open. 2. Ifyou areloggedin using username and password andbrowsinginternal pages then trychangingURLoptionsdirectly.I.e.Ifyouarecheckingsomepublishersite statisticswithpublishersiteID=123.TrydirectlychangingtheURLsiteID parametertodifferentsiteIDwhichisnotrelatedtologgedinuser.Accessshould deny for this user to view others stats. 3.Trysomeinvalidinputsininputfieldslikeloginusername,password,andinput text boxes. Check the system reaction on all invalid inputs. 4. Webdirectoriesorfilesshouldnotbeaccessibledirectlyunlessgivendownload option. 5.Test if SSL is used for security measures. If used proper message should get displayed when user switch from non-secure http:// pages to secure https:// pages and vice versa. 6.Alltransactions,errormessages,securitybreachattemptsshouldgetloggedinlog files somewhere on web server. 53 | P a g e 7. User Manuals 54 | P a g e Cirtru Home Page 55 | P a g e 56 | P a g e 57 | P a g e 58 | P a g e User Sign Up page 59 | P a g e User Sign in Page 60 | P a g e User Home Page 61 | P a g e User Setting Page 62 | P a g e 63 | P a g e 64 | P a g e Roommates Listing Page 65 | P a g e 66 | P a g e 67 | P a g e Post Roommate Ad Page 68 | P a g e

69 | P a g e 70 | P a g e 71 | P a g e FAQ Page 72 | P a g e About Us Page Contact Us Page 73 | P a g e Circles of Trust page Sitemap Page 74 | P a g e Cirtru Home Page in Mobile View 75 | P a g e Cirtru Sign In Page in Mobile View

76 | P a g e Cirtru Roommates Listing and View Page

77 | P a g e Cirtru Sublets Listing and View Page

78 | P a g e Cirtru CarsListing and View Page 79 | P a g e Cirtru Forsale Listing and View Page

80 | P a g e 8. Key Learnings 81 | P a g e 8. Key Learnings TheinternshipperiodinCirtru classified Pvt Ltdprovidedmeagreatopportunitytolearn and experience many new things. It gave me a chance to learn various technologies in great detail. Key learning: 1.Creating & managing web applications through Node.js and Angular.js. 2.Node.JS frameworks and its working 3.Techniques and methods to create responsive web designs. 4.Validation and filtering of data using Angular.js and validation in HTML5. 5.Techniques ofusing an API of Google Maps and analytics 6.Use of MVC architecture for building website. 7.Use of dependency injection and customizing angular plugins. 8.Use of JavaScript with angular for dynamic content generation. 9.Creation of Email templates. 10. Testing tools for automation testing. 11. Knowledge about UI and UX design 12. Techniques for creating and customizing css through css preprocessors. AlongwiththetechnicallearningIalsohadanopportunitytounderstandmany marketing terms. I also got a chance to improve my skills to interact with users. Ialsogotmotivatedtohaveastrongtestingofwebsystemandtobuildallpossibletestcases. Thus I understood the importance of testing. Internship in Cirtru Classified Pvt Ltd not only helped me to improve my technical skills but also helped me advance my personal and professional skills and competencies. 82 | P a g e 9. Bibliography 83 | P a g e Books: Learning JavaScript Design PatternsBuilding Node Applications with Mongodb and Backbone by Mike Wilson Angular JS by Shyam Seshadri Websites: www.codeschool.com www.tutorialspoint.com www.stackoverflow.com www.w3schools.com docs.mongodb.org/manual/core/document/ nodejs.org getbootstrap.com