Top Banner
Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya ii j
46

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Dec 06, 2020

Download

Documents

dariahiddleston
Welcome message from author
This document is posted to help you gain knowledge. Please leave a comment to let me know what you think about it! Share it to your friends and learn new things together.
Transcript
Page 1: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

ii

j

Page 2: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

i

Diterbitkanoleh

DirektoratPembinaanSekolahMenengahAtasDirektoratJenderalPendidikanDasarDanMenengahKementerianPendidikanDanKebudayaanJalanR.S.Fatmawati,Cipete,Jakarta12410Telepon:(021)7694140,75902679,Fax.7696033Laman:www.psma.kemdikbud.go.idPengarah

PurwadiSutantoKoordinatorProgram

Suharlan,SuhadiKoordinatorPengembangModul

JunusSimangunsongKoordinatorPelaksana

HeriFitrionoPenulisModul

TulusWidodoPenelaahModul

MuheriPalwantoEditor

ElsiEkaRahmawati,LanggengHadiLayout

ArsoAgungDewantoro

Page 3: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

ii

KataPengantar

Pendidikan sebagai ujung tombak kemajuan suatu bangsa hendaknya memberikanpelayananyangselarasdengantuntutanzaman.Agarmenjadipribadiyangsuksesdiabadke-21seseorangyanghidupdiabadtersebutdituntutberbagaiketerampilanrelevanyangharusdikuasaiagardapatberadaptasidanberkontribusi.Tuntutankemampuanabad21yang semakin kompetitif menuntut empat kompetensi yaitu: Critical Thinking andProblemSolving,CreativityandInnovation,CommunicationdanCollaboration.Pendidikansebagaipengembanperan reformatif dan transformatif harusmampumempersiapkanpesertadidikuntukmenguasaiberbagaiketerampilantersebut.Kebutuhanterhadaplulusanyangkritis,kreatif,komunikatfdankolaboratifinilahyangmenjadikompetensilulusanutamapadakurikulum2013.Pengembangankurikuluminididasarkanprinsippokokyaitukompetensilulusanyangdidasarkanataskebutuhan,isikurikulum dan mata pelajaran yang diturunkan secara langsung dari kebutuhankompetensi,matapelajaranyangkontributifpadapembentukansikap,pengetahuandanketerampilan.Penerapanprinsip-prinsipyangesensialinidiharapkanagarimplementasikurikulum2013menghasilkanlulusanyangsiapmenghadapiabad21.Sebagai bagian yang utuh dan selaras dengan komponen kurikulum 2013, penilaianberperan untuk menstimulus capaian pembelajaran yang salah satunya membangunsikap kritis. Untuk membangun kemampuan Critical Thinking and Problem Solving,instrumen penilaian diarahkan pada soal berstandar internasional yaituHigher OrderThinking SkillsatauKeterampilanBerpikirTingkatTinggi.Buku inimerupakanmodulpenyusunansoalHOTSmatapelajaranyangbertujuanuntukmeningkatkanpemahamandanketerampilangurudalamsebuahpenilaianyangdiharapkanakanberdampakpadapeningkatankemampuanberpikirkritisbagipesertadidik.Buku modul ini menjelaskan strategi penyusunan soalHOTS yang secara garis besarmemuattentanglatarbelakang,konsepdasarpenyusunansoalHOTS,penyusunansoalHOTSmatapelajarandandancontohsoalHOTS,strategiimplementasipenyusunansoalHOTS. Diharapkan buku modul ini dapat menjadi referensi agar kegiatan bimbinganteknispenyusunan soalHOTS berjalandengan lancar sehinggapada akhirnyamampumencapai tujuan yang diharapkan yaitu lulusan yang krisis, kreatif, komunikatif dankolaboratif.Untuk memperbaiki buku ini, kami sangat mengharapkan saran dan masukan dariBapak/Ibu.

Jakarta,Juli2019DirekturPembinaanSMA,PurwadiSutantoNIP.196104041985031003

Page 4: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

iii

DaftarIsi

Halaman

KATAPENGANTAR.................................................................................................................................................iiDAFTARISI................................................................................................................................................................iiiDAFTARGAMBAR...................................................................................................................................................ivDAFTARTABEL.........................................................................................................................................................vBABIPENDAHULUAN...........................................................................................................................................1

A. Rasional.......................................................................................................................................................1B. Tujuan..........................................................................................................................................................2C. HasilyangDiharapkan........................................................................................................................2

BABIIKONSEPDASARPENYUSUNANSOALHOTS............................................................................3

A. Pengertian..................................................................................................................................................3B. Karakteristik.............................................................................................................................................4C. LevelKognitif...........................................................................................................................................6D. SoalHOTSdanTingkatKesukaranSoal....................................................................................9E. PeranSoalHOTSdalamPenilaianHasilBelajar..................................................................10F. Langkah-LangkahPenyusunanSoalHOTS............................................................................11

BABIIIPENYUSUNANSOALHOTSMATAPELAJARANSENIBUDAYA................................13

A. KarakteristikMapelSeniBudaya................................................................................................13B. AnalisisKD..............................................................................................................................................15C. ContohStimulus...................................................................................................................................17D. PenjabaranKDmenjadiIndikatorSoal....................................................................................18E. MenyusunKisi-kisi.............................................................................................................................19F. KartuSoalHOTS...................................................................................................................................21

BABIVSTRATEGIIMPLEMENTASI...........................................................................................................29

A. Strategi......................................................................................................................................................29B. Pusat..........................................................................................................................................................29C. DinasPendidikan................................................................................................................................29D. Sekolah.....................................................................................................................................................29E. Implementasi.........................................................................................................................................29

DAFTARPUSTAKA...............................................................................................................................................31Lampiran1...............................................................................................................................................................32Lampiran2...............................................................................................................................................................33Lampiran3...............................................................................................................................................................35

Page 5: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

iv

DaftarGambar

Halaman

Gambar2.1.AlurPenyusunanSoalHOTS .......................................................................... 12

Page 6: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

v

DaftarTabel

Halaman

Tabel2.1.Perbandinganasesmentradisionaldankontekstual ......................................... 5

Tabel2.2.DimensiProsesBerpikir ..................................................................................... 7

Tabel31.ContohanalisisKD ............................................................................................ 15

Tabel3.2.ContohStimulusSenbiBudaya .......................................................................... 17

Tabel3.3.ContohPenjabaranKDMenjadiIndikatorSoal ................................................ 19

Tabel34.Kisi-KisisoalHOTS............................................................................................ 19

Page 7: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal
Page 8: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

1

BabIPendahuluan

A. Rasional Peraturan Menteri Pendidikan dan Kebudayaan Nomor 36 Tahun 2018 tentangPerubahanatasPeraturanMenteriPendidikandanKebudayaanNomor59Tahun2014tentang Kurikulum 2013 Sekolah Menengah Atas/Madrasah Aliyah pada lampiran Imenyatakanbahwasalahsatudasarpenyempurnaankurikulumadalahadanyatantanganeksternal,antaralainterkaitdenganarusglobalisasidanberbagaiisulingkunganhidup,kemajuan teknologi dan informasi, kebangkitan industri kreatif, budaya, danperkembanganpendidikanditingkatinternasional.Pendidikanpadaerarevolusi industri4.0diarahkanuntukpengembangankompetensiabadke-21,yangterdiridaritigakomponenutamayaitukompetensiberpikir,bertindak,dan hidup di dunia. Komponen berpikir meliputi berpikir kritis, berpikir kreatif, dankemampuanpemecahanmasalah.Komponenbertindakmeliputikomunikasi,kolaborasi,literasidata,literasiteknologi,danliterasimanusia.Komponenhidupdiduniameliputiinisiatif, mengarahkan diri (self-direction), pemahaman global, serta tanggung jawabsosial.Munculnyaliterasibaruyaitu(1)literasidatayaitukemampuanuntukmembaca,menganalisis,danmenggunakaninformasi(bigdata)diduniadigital,(2)literasiteknologiyaitu kemampuan memahami cara kerja mesin, aplikasi teknologi (coding, artificialintelligence, and engineering principles), dan (3) literasi manusia terkait denganhumanities, communication, collaboration,merupakan tantangan tersendiri untuk bisahiduppadaabadke-21.Terkaitdenganisuperkembanganpendidikanditingkatinternasional,Kurikulum2013dirancangdenganberbagaipenyempurnaan.Pertama,padastandarisi,yaitumengurangimateriyangtidakrelevansertapendalamandanperluasanmateriyangrelevanbagisiswasertadiperkayadengankebutuhansiswauntukberpikirkritisdananalitissesuaidenganstandar internasional. Kedua, pada standar penilaian, dengan mengadaptasi secarabertahapmodel-modelpenilaianstandarinternasional.Penilaianhasilbelajardiharapkandapatmembantusiswauntukmeningkatkanketerampilanberpikirtingkattinggi(HigherOrder Thinking Skills/HOTS), karena keterampilan berpikir tingkat tinggi dapatmendorongsiswauntukberpikirsecaraluasdanmendalamtentangmateripelajaran.Kurikulum 2013 lebih diarahkan untuk membekali siswa sejumlah kompetensi yangdibutuhkanmenyongsong abadke-21.Beberapakompetensipentingyangdibutuhkanpada abad ke-21 yaitu 4C meliputi: (1) critical thinking (kemampuan berpikir kritis)bertujuan agar siswa dapat memecahkan berbagai permasalahan kontekstualmenggunakan logika-logika yang kritis dan rasional; (2) creativity (kreativitas)mendorong siswauntukkreatifmenemukanberagamsolusi,merancang strategi baru,ataumenemukan cara-cara yang tidak lazim digunakan sebelumnya; (3) collaboration(kerjasama)memfasilitasisiswauntukmemilikikemampuanbekerjadalamtim,toleran,memahamiperbedaan,mampuuntukhidupbersamauntukmencapaisuatutujuan;dan(4) communication (kemampuan berkomunikasi) memfasilitasi siswa untuk mampuberkomunikasi secara luas, kemampuan menangkap gagasan/informasi, kemampuanmenginterpretasikansuatuinformasi,dankemampuanberargumendalamartiluas.Hasil telaah butir soal yang dilakukan oleh Direktorat Pembinaan SMA padaPendampinganUSBN tahun2018 terhadap26matapelajaranpada136SMARujukanyangtersebardi34Provinsi,menunjukkanbahwadari1.779butirsoalyangdianalisissebagianbesaradapadaLevel-1danLevel-2.Dari136SMARujukan,hanya27sekolah

BABI Pendahuluan

Page 9: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

2

yangmenyusunsoalHOTSsebanyak20%dariseluruhsoalUSBNyangdibuat,84sekolahmenyusunsoalHOTSdibawah20%,dan25sekolahmenyatakantidaktahuapakahsoalyangdisusunHOTSatautidak.HalitutidaksesuaidengantuntutanpenilaianKurikulum2013yanglebihmeningkatkanimplementasimodel-modelpenilaianHOTS.Selainitu,hasilstudiinternasionalProgrammeforInternationalStudentAssessment(PISA)menunjukkan prestasi literasi membaca (reading literacy), literasi matematika(mathematicalliteracy),danliterasisains(scientificliteracy)yangdicapaisiswaIndonesiasangat rendah.Padaumumnyakemampuansiswa Indonesiasangat rendahdalam: (1)mengintegrasikaninformasi;(2)menggeneralisasikasusdemikasusmenjadisuatusolusiyangumum;(3)memformulasikanmasalahdunianyatakedalamkonsepmatapelajaran;dan(4)melakukaninvestigasi.Berdasarkan fakta-fakta di atas, maka perlu adanya perubahan sistem dalampembelajarandanpenilaian.Soal-soalyangdikembangkanolehgurudiharapkandapatmendorongpeningkatanketerampilanberpikirtingkattinggi,meningkatkankreativitas,dan membangun kemandirian siswa untuk menyelesaikan masalah. Oleh karena itu,DirektoratPembinaanSMAmenyusunModulPenyusunanSoalHOTSbagiguruSMA.

B. Tujuan Modul Pembelajaran dan Penilaian Keterampilan Berpikir Tingkat Tinggi atau HOTSdisusundengantujuansebagaiberikut.1. MemberikanpemahamankepadaguruSMA tentangkonsepdasarpenyusunanSoalHOTS;

2. MeningkatkanketerampilanguruSMAuntukmenyusunSoalHOTS;3. Memberikan pedoman bagi pengambil kebijakan baik di tingkat pusat dan daerahuntukmelakukanpembinaandansosialisasitentangpenyusunanSoalHOTS.

C. HasilyangDiharapkan Sesuai dengan tujuan penyusunanmodul di atas, maka hasil yang diharapkan adalahsebagaiberikut.1. MeningkatnyapemahamanguruSMAtentangkonsepdasarpenyusunanSoalHOTS;2. MeningkatnyaketerampilanguruSMAuntukmenyusunSoalHOTS;3. TerorganisirnyapolapembinaandansosialisasitentangmenyusunSoalHOTS.

Page 10: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

3

BABIIKONSEPDASARPENYUSUNANSOALHOTS

A. PengertianPenilaianHOTS tidakdapatdipisahkandenganpembelajaranHOTS. Tugas gurubukanhanya melakukan penilaian HOTS, melainkan juga harus mampu melaksanakanpembelajaran yang dapatmelatih siswa untukmemiliki keterampilan berpikir tingkattinggi.Tujuanutamanyaadalahuntukmeningkatkanprosesberpikirtingkattinggiyanglebihefektif.Prinsipumumuntukmenilaiberpikirtingkattinggiadalahsebagaiberikut.Menentukansecaratepatdanjelasapayangakandinilai.Merencanakan tugas atau butir soal yang menuntut siswa untuk menunjukkanpengetahuanatauketerampilanyangmerekamiliki.Menentukanlangkahapayangakandiambilsebagaibuktipeningkatanpengetahuandankecakapansiswayangtelahditunjukandalamproses.Penilaianberpikirtingkattinggimeliputi3prinsip:Menyajikanstimulusbagisiswauntukdipikirkan,biasanyadalambentukpengantarteks,visual,skenario,wacana,ataumasalah(kasus).Menggunakan permasalahan baru bagi siswa, belum dibahas di kelas, dan bukanpertanyaanhanyauntukprosesmengingat.Membedakanantaratingkatkesulitansoal(mudah,sedang,atausulit)danlevelkognitif(berpikirtingkatrendahdanberpikirtingkattinggi).Soal-soal HOTS merupakan instrumen pengukuran yang digunakan untuk mengukurketerampilan berpikir tingkat tinggi, yaitu keterampilan berpikir yang tidak sekadarmengingat (remembering), memahami (understanding), atau menerapkan (applying).Soal-soalHOTSpadakonteksasesmenmengukurkemampuan:1)transfersatukonsepkekonseplainnya,2)memprosesdanmengintegrasikaninformasi,3)mencarikaitandariberbagaiinformasiyangberbeda-beda,4)menggunakaninformasiuntukmenyelesaikanmasalah (problem solving), dan 5)menelaah ide dan informasi secara kritis. Dengandemikiansoal-soalHOTSmengujikemampuanberpikirmenganalisa,mengevaluasi,danmencipta.Dimensi proses berpikir dalam Taksonomi Bloom sebagaimana yang telahdisempurnakanolehAnderson&Krathwohl(2001),terdiriataskemampuan:mengingat(remembering-C1), memahami (understanding-C2), menerapkan (applying-C3),menganalisis(analyzing-C4),mengevaluasi(evaluating-C5),danmencipta(creating-C6).Soal-soal HOTS pada umumnya mengukur kemampuan pada ranah menganalisis(analyzing-C4), mengevaluasi (evaluating-C5), dan mencipta (creating-C6). Kata kerjaoperasional(KKO)yangadapadapengelompokkanTaksonomiBloommenggambarkanproses berpikir, bukanlah kata kerja pada soal. Ketiga kemampuan berpikir tinggi ini(analyzing, evaluating, dan creating) menjadi penting dalam menyelesaikan masalah,transferpembelajaran(transferoflearning)dankreativitas.Padapemilihankatakerjaoperasional (KKO)untukmerumuskan indikatorsoalHOTS,hendaknya tidak terjebak pada pengelompokkan KKO. Sebagai contoh kata kerja‘menentukan’ pada Taksonomi Bloom ada pada ranah C2 dan C3. Dalam kontekspenulisan soal-soal HOTS, kata kerja ‘menentukan’ bisa jadi ada pada ranah C5(mengevaluasi) apabila soal tersebut untukmenentukan keputusan didahului denganprosesberpikirmenganalisisinformasiyangdisajikanpadastimuluslalusiswadimintamenentukankeputusanyangterbaik.Bahkankatakerja‘menentukan’bisadigolongkanC6 (mencipta) bila pertanyaan menuntut kemampuan menyusun strategi pemecahan

BABII KonsepDasarPenyusunanSoalKeterampilanBerpikirTingkatTinggi

Page 11: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

4

masalahbaru.Jadi,ranahkatakerjaoperasional(KKO)sangatdipengaruhiolehprosesberpikirapayangdiperlukanuntukmenjawabpertanyaanyangdiberikan.Dilihatdaridimensipengetahuan,umumnyasoalHOTSmengukurdimensimetakognitif,tidak sekadar mengukur dimensi faktual, konseptual, atau prosedural saja. Dimensimetakognitif menggambarkan kemampuan menghubungkan beberapa konsep yangberbeda,menginterpretasikan,memecahkanmasalah(problemsolving),memilihstrategipemecahanmasalah,menemukan(discovery)metodebaru,berargumen(reasoning),danmengambilkeputusanyangtepat.Dalamstruktursoal-soalHOTSumumnyamenggunakanstimulus.Stimulusmerupakandasarberpijakuntukmemahamiinformasi.DalamkonteksHOTS,stimulusyangdisajikanharus bersifat kontekstualdanmenarik. Stimulusdapat bersumber dari isu-isu globalseperti masalah teknologi informasi, sains, ekonomi, kesehatan, pendidikan,infrastruktur, dan lain-lain. Stimulus juga dapat bersumber dari permasalahan-permasalahanyangadadilingkungansekitarsekolahsepertibudaya,adat,kasus-kasusdidaerah,atauberbagaikeunggulanyangterdapatdidaerahtertentu.Stimulusyangbaikmemuat beberapa informasi/gagasan, yang dibutuhkan untuk mengembangkankemampuanmencarihubunganantarinformasi,transferinformasi,danterkaitlangsungdenganpokokpertanyaan.

B. KarakteristikSoal-soal HOTS sangat direkomendasikan untuk digunakan pada berbagai bentukpenilaianhasil belajar.Untukmenginspirasi gurumenyusun soal-soalHOTSdi tingkatsatuanpendidikan,berikutinidipaparkankarakteristiksoal-soalHOTS.

1. MengukurKeterampilanberpikirTingkatTinggiTheAustralianCouncilforEducationalResearch(ACER)menyatakanbahwaketerampilanberpikir tingkat tinggi merupakan proses: menganalisis, merefleksi, memberikanargumen(alasan),menerapkankonseppadasituasiberbeda,menyusun,danmencipta.Keterampilanberpikirtingkattinggimeliputikemampuanuntukmemecahkanmasalah(problemsolving),keterampilanberpikirkritis(criticalthinking),berpikirkreatif(creativethinking),kemampuanberargumen(reasoning),dankemampuanmengambilkeputusan(decisionmaking).Keterampilanberpikirtingkattinggimerupakansalahsatukompetensipentingdalamduniamodern,sehinggawajibdimilikiolehsetiapsiswa.KreativitasmenyelesaikanpermasalahandalamHOTS,terdiriatas:a. kemampuanmenyelesaikanpermasalahanyangtidakfamiliar;b. kemampuanmengevaluasi strategi yangdigunakanuntukmenyelesaikanmasalah

dariberbagaisudutpandangyangberbeda;c. menemukan model-model penyelesaian baru yang berbeda dengan cara-cara

sebelumnya.Keterampilanberpikirtingkat tinggidapatdilatihdalamprosespembelajarandikelas.Olehkarena ituagarsiswamemilikiketerampilanberpikir tingkat tinggi,makaprosespembelajarannyajugamemberikanruangkepadasiswauntukmenemukanpengetahuanberbasis aktivitas. Aktivitas dalampembelajaran harus dapatmendorong siswa untukmembangunkreativitasdanberpikirkritis.

Page 12: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

5

2. BerbasisPermasalahanKontekstualdanMenarik(ContextualandTrendingTopic)Soal-soalHOTSmerupakanasesmenyangberbasissituasinyatadalamkehidupansehari-hari,dimanasiswadiharapkandapatmenerapkankonsep-konseppembelajarandikelasuntukmenyelesaikanmasalah.Permasalahankontekstualyangdihadapiolehmasyarakatduniasaatiniterkaitdenganlingkunganhidup,kesehatan,kebumiandanruangangkasa,kehidupan bersosial, penetrasi budaya, serta pemanfaatan ilmu pengetahuan danteknologi dalam berbagai aspek kehidupan. Kontekstualisasi masalah pada penilaianmembangkitkansikapkritisdanpeduliterhadaplingkungan.Berikutinidiuraikanlimakarakteristikasesmenkontekstual,yangdisingkatREACT.a. Relating,terkaitlangsungdengankontekspengalamankehidupannyata.b. Experiencing, ditekankan kepada penggalian (exploration), penemuan (discovery),

danpenciptaan(creation).c. Applying,kemampuansiswauntukmenerapkanilmupengetahuanyangdiperolehdi

dalamkelasuntukmenyelesaikanmasalah-masalahnyata.d. Communicating, kemampuan siswa untukmampumengomunikasikan kesimpulan

modelpadakesimpulankonteksmasalah.e. Transfering,kemampuansiswauntukmentransformasikonsep-konseppengetahuan

dalamkelaskedalamsituasiataukonteksbaru.Ciri-ciri asesmen kontekstual yang berbasis pada asesmen autentik, adalah sebagaiberikut.a. Siswa mengonstruksi responnya sendiri, bukan sekedar memilih jawaban yang

tersedia;b. Tugas-tugasmerupakantantanganyangdihadapkandalamdunianyata;c. Tugas-tugas yang diberikan tidak mengkungkung dengan satu-satunya jawaban

benar, namun memungkinkan siswa untuk mengembangkan gagasan denganberagam alternative jawaban benar yang berdasar pada bukti, fakta, dan alasanrasional.

Berikutdisajikanperbandinganasesmentradisionaldanasesmenkontekstual.

Tabel2.1.Perbandinganasesmentradisionaldankontekstual

AsesmenTradisional AsesmenKontekstualSiswa cenderung memilih responsyangdiberikan.

Siswamengekspresikanrespons

Konteksduniakelas(buatan) Konteksdunianyata(realistis)Umumnya mengukur aspek ingatan(recalling)

Mengukur performansi tugas(berpikirtingkattinggi)

Terpisahdenganpembelajaran TerintegrasidenganpembelajaranPembuktian tidak langsung,cenderungteoretis.

Pembuktian langsung melaluipenerapan pengetahuan danketerampilandengankonteksnyata.

Respon memaparkanhafalan/pengetahuanteoritis.

Respondisertai alasan yang berbasisdatadanfakta

Stimulus soal-soalHOTS harus dapatmemotivasi siswa untukmenginterpretasi sertamengintegrasikan informasi yangdisajikan, tidak sekedarmembaca. Salah satu tujuanpenyusunan soal-soal HOTS adalah meningkatkan kemampuan berkomunikasi siswa.Kemampuan berkomunikasi antara lain dapat direpresentasikan melalui kemampuanuntukmencarihubunganantarinformasiyangdisajikandalamstimulus,menggunakaninformasiuntukmenyelesaikanmasalah,kemampuanmentransferkonseppadasituasibaru yang tidak familiar, kemampuan menangkap ide/gagasan dalam suatu wacana,

Page 13: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

6

menelaah idedan informasi secarakritis, ataumenginterpretasikan suatu situasi baruyangdisajikandalambacaan.Untuk membuat stimulus yang baik, agar dipilih informasi-informasi, topik, wacana,situasi, berita atau bentuk lain yang sedang mengemuka (trending topic). Sangatdianjurkan untuk mengangkat permasalahan-permasalahan yang dekat denganlingkungansiswaberada,ataubersumberpadapermasalahan-permasalahanglobalyangsedang mengemuka. Stimulus yang tidak menarik berdampak padaketidaksungguhan/ketidakseriusanpesertatesuntukmembacainformasiyangdisajikandalam stimulus atau mungkin saja tidak mau dibaca lagi karena ending-nya sudahdiketahui sebelummembaca (bagi stimulus yang sudah seringdiangkat, sudah umumdiketahui). Kondisi tersebut dapat mengakibatkan kegagalan butir soal untukmengungkapkemampuanberkomunikasi siswa. Soaldengan stimuluskurangmenariktidakmampumenunjukkan kemampuan siswa untukmenghubungkan informasi yangdisajikan dalam stimulus ataumenggunakan informasi untukmenyelesaikanmasalahmenggunakanlogika-logikaberpikirkritis.

3. TidakRutindanMengusungKebaruanSalahsatutujuanpenyusunansoal-soalHOTSadalahuntukmembangunkreativitassiswadalam menyelesaikan berbagai permasalahan kontekstual. Sikap kreatif erat dengankonsepinovatifyangmenghadirkanketerbaharuan.Soal-soalHOTStidakdapatdiujikanberulang-ulangpadapesertatesyangsama.ApabilasuatusoalyangawalnyamerupakansoalHOTS diujikan berulang-ulang padapeserta tes yang sama,makaproses berpikirsiswamenjadimenghafaldanmengingat.Siswahanyaperlumengingatcara-carayangtelahpernahdilakukansebelumnya.Tidaklagiterjadiprosesberpikirtingkattinggi.Soal-soal tersebut tidak lagidapatmendorongpeserta tesuntukkreatifmenemukan solusibaru. Bahkan soal tersebut tidak lagi mampu menggali ide-ide orisinil yang dimilikipesertatesuntukmenyelesaikanmasalah.Soal-soal yang tidak rutin dapat dikembangkan dari KD-KD tertentu, denganmemvariasikanstimulusyangbersumberdariberbagaitopik.PokokpertanyaannyatetapmengacupadakemampuanyangharusdimilikiolehsiswasesuaidengantuntutanpadaKD. Bentuk-bentuk soal dapat divariasikan sesuai dengan tujuan tes, misalnya untukpenilaianhariandianjurkanuntukmenggunakansoal-soalbentukuraiankarenajumlahKD yang diujikan hanya 1 atau 2 KD saja. Sedangkan untuk soal-soal penilaian akhirsemester atau ujian sekolah dapatmenggunakan bentuk soal pilihan ganda (PG) danuraian.Untukmengukurketerampilanberpikirtingkattinggi(HOTS)akanlebihbaikjikamenggunakan soal bentuk uraian. Pada soal bentuk uraian mudah dilihat tahapan-tahapanberpikiryangdilakukansiswa,kemampuanmentransferkonsepkesituasibaru,kreativitas membangun argumen dan penalaran, serta hal-hal lain yang berkenaandenganpengukuranketerampilanberpikirtingkattinggi.Mencermati salah satu tujuan penyusunan soalHOTS adalah untuk mengembangkankreativitassiswa,makaparagurujugaharuskreatifmenyusunsoal-soalHOTS.Guruharusmemilikipersediaansoal-soalHOTSyangcukupdanvariatifuntukKD-KDtertentuyangdapat dibuatkan soal-soalHOTS, agar karakteristik soal-soal HOTS tidak berubah dantetapterjagamutunya.

C. LevelKognitifAnderson & Krathwohl (2001) mengklasifikasikan dimensi proses berpikir sebagaiberikut.

Page 14: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

7

Tabel2.2.DimensiProsesBerpikir

HOTS

Mencipta

Menciptaide/gagasansendiri.Kata kerja: mengkonstruksi, desain, kreasi,mengembangkan, menulis, menggabungkan,memformulasikan.

MengevaluasiMengambilkeputusantentangkualitassuatuinformasi.Kata kerja: evaluasi,menilai,menyanggah,memutuskan,memilih,mendukung,menduga,memprediksi.

MenganalisisMenspesifikasiaspek-aspek/elemen.Kata kerja: mengurai, membandingkan, memeriksa,mengkritisi,menguji.

LOTS

MengaplikasiMenggunakaninformasipadadomainberbedaKata kerja: menggunakan, mendemonstrasikan,mengilustrasikan,mengoperasikan.

MemahamiMenjelaskanide/konsep.Kata kerja: menjelaskan, mengklasifikasi, menerima,melaporkan.

Mengingat Mengingatkembalifakta,konsep,danprosedur.Katakerja:mengingat,mendaftar,mengulang,menirukan.

Sumber:Anderson&Krathwohl(2001)Sebagaimana telah diuraikan sebelumnya, terdapat beberapa kata kerja operasional(KKO) yang sama namun berada pada ranah yang berbeda. Perbedaan penafsiran iniseringmunculketikagurumenentukanranahKKOyangakandigunakandalampenulisanindikator soal. Untuk meminimalkan permasalahan tersebut, Puspendik (2015)mengklasifikasikannya menjadi 3 level kognitif, yaitu: 1) level 1 (pengetahuan danpemahaman), 2) level2 (aplikasi), dan3) level3 (penalaran). Berikutdipaparkansecarasingkatpenjelasanuntukmasing-masingleveltersebut.Level1(PengetahuandanPemahaman)Level kognitif pengetahuan dan pemahaman mencakup dimensi proses berpikirmengetahui (C1) dan memahami (C2). Ciri-ciri soal pada level 1 adalah mengukurpengetahuanfaktual,konsep,danprosedural.Bisajadisoal-soalpadalevel1merupakansoalkategorisukar,karenauntukmenjawabsoaltersebutsiswaharusdapatmengingatbeberaparumusatauperistiwa,menghafaldefinisi,ataumenyebutkanlangkah-langkah(prosedur)melakukansesuatu.Namunsoal-soalpadalevel1bukanlahmerupakansoal-soal HOTS. Contoh KKO yang sering digunakan adalah: menyebutkan, menjelaskan,membedakan,menghitung,mendaftar,menyatakan,danlain-lain.Contohsoallevel1:Berdasarkansumberbunyinya,alatmusikyangsumberbunyinyaberasaldaritali,senarataudawaidigolongkankedalamjenis?A. AerophoneB. MembranophoneC. IdeophoneD. KordophoneE. ElektrophoneJawaban:DPenjelasan:

Page 15: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

8

Soaldiatastermasuklevel1karenahanyamembutuhkankemampuanmengingatataumenghafaljenismusikberdasarkansumberbunyinyasaja.Level2(Aplikasi)Soal-soalpada levelkognitifaplikasimembutuhkankemampuanyang lebih tinggidaripada level pengetahuan dan pemahaman. Level kognitif aplikasi mencakup dimensiprosesberpikirmenerapkanataumengaplikasikan(C3).Ciri-cirisoalpadalevel2adalahmengukur kemampuan: a) menggunakan pengetahuan faktual, konseptual, danproseduraltertentupadakonseplaindalammapelyangsamaataumapellainnya;ataub)menerapkan pengetahuan faktual, konseptual, dan prosedural tertentu untukmenyelesaikan masalah rutin. Siswa harus dapat mengingat beberapa rumus atauperistiwa, menghafal definisi/konsep, atau menyebutkan langkah-langkah (prosedur)melakukan sesuatu untuk menjawab soal level 2. Selanjutnya pengetahuan tersebutdigunakan pada konsep lain atau untuk menyelesaikan permasalahan kontekstual.Namun soal-soalpada level 2 bukanlahmerupakan soal-soalHOTS. Contoh KKO yangsering digunakan adalah: menerapkan, menggunakan, menentukan, menghitung,membuktikan,danlain-lain.Contohsoallevel2:RumusuntukmembuatAkordCMayoradalahsebagaiberikut:

Berdasarkanrumusandiatas,makaSusunanAkorduntukGMayoradalah....A. G–E–CB. G–C–EC. G–B–DD. G–A–CE. G–F–AJawaban:CPenjelasan:Soal di atas termasuk level 2 karena siswa harus memahami dulu rumus dalampembuatanAkordMayoruntukselanjutnyaditerapkanpadapembuatanAkordlainnya.Level3(Penalaran)Level penalaranmerupakan level keterampilan berpikir tingkat tinggi (HOTS), karenauntukmenjawabsoal-soalpadalevel3siswaharusmampumengingat,memahami,danmenerapkanpengetahuanfaktual,konseptual,danproseduralsertamemilikilogikadanpenalaranyangtinggiuntukmemecahkanmasalah-masalahkontekstual(situasinyatayangtidakrutin).Levelpenalaranmencakupdimensiprosesberpikirmenganalisis(C4),mengevaluasi(C5),danmencipta(C6).Padadimensiprosesberpikirmenganalisis(C4)menuntut kemampuan siswauntukmenspesifikasi aspek-aspek/elemen,menguraikan,mengorganisir,membandingkan,danmenemukanmaknatersirat.Padadimensiprosesberpikir mengevaluasi (C5) menuntut kemampuan siswa untuk menyusun hipotesis,mengkritik,memprediksi,menilai,menguji,membenarkanataumenyalahkan.Sedangkanpada dimensi proses berpikir mencipta (C6) menuntut kemampuan siswa untukmerancang, membangun, merencanakan, memproduksi, menemukan, memperbaharui,menyempurnakan, memperkuat, memperindah, menggubah. Soal-soal pada levelpenalaran tidak selalu merupakan soal-soal sulit. Ciri-ciri soal pada level 3 adalah

Page 16: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

9

menuntutkemampuanmenggunakanpenalarandanlogikauntukmengambilkeputusan(evaluasi),memprediksi&merefleksi,sertakemampuanmenyusunstrategibaruuntukmemecahkan masalah kontesktual yang tidak rutin. Kemampuan menginterpretasi,mencarihubunganantarkonsep,dankemampuanmentransferkonsepsatukekonseplain,merupakankemampuanyangsangatpentinguntukmenyelesaiakansoal-soallevel3(penalaran). Kata kerja operasional (KKO) yang sering digunakan antara lain:menguraikan, mengorganisir, membandingkan, menyusun hipotesis, mengkritik,memprediksi,menilai,menguji,menyimpulkan,merancang,membangun,merencanakan,memproduksi, menemukan, memperbaharui, menyempurnakan, memperkuat,memperindah,danmenggubah.Contohsoallevel3:Akord yaitu kumpulan tiga nada atau lebih yang bila dimainkan secara bersamaanterdengar harmonis. Alat musik yang dapat memainkan Akord umumnya adalah alatmusikharmonisseperti:Gitar,Piano,keyboarddanlain-lain.Alatmusikmelodisadalahalatmusikyangmampumenghasilkanbunyidanmemainkanrangkaianmelodiataunada-nadadarisebuahlagu.Contohnya:Biola,Saxophone,Sulingdanlain-lain.Pertanyaan:BagaimanajikakitainginmembuatdanmendengarkansuaraAkorddariSulingataupunsaxophone, padahal keduanya adalah alat musik melodis yang memainkan meloditunggal?Jelaskan!Jawaban:Suling dan Saxophone dapat disusunmenjadi alat musik Harmonis dalam permainanbersama seperti ansambelmaupunorkestra.Dengan caramembagibeberapa serulinguntukmemainkannadayangberbeda.Misalnya:

• Suling1memainkannadaC• Suling2memainkannadaE• Suling3memainkannadaG

JikaketigasulingtersebutdibunyikanberbarenganmakaakanmenghasilkanbunyiyangserempakdanharmonisdandisituterciptalahAkord.Penjelasan:Soal di atas termasuk level 3 (penalaran) yangmengukur kemampuanHOTSmencarikaitan dari informasi yang berbeda dan menggunakan informasi untuk memecahkanmasalahmelalui tahapanberpikirmulaidarimemahamiduapengertianyangberbedatentang fungsi alat musik dan konsep Akord. Ketika dihadapkan padamasalah harusmembuat Akord bukan dari alat musik harmonis, siswa mampu menjawab melaluipenalarannya.

D. SoalHOTSdanTingkatKesukaranSoalBanyakyangsalahmenafsirkanbahwasoalHOTSadalahsoalyangsulit.SoalsulitbelumtentusoalHOTS,demikianpulasebaliknya‘Difficulty’isNOTthesameasthehigherorderthinking.”kalimatsederhanainibermaknabahwasoalyangsulittidaklahsamadengansoalHOTS. Kenyataannya, baik soal LOTS maupunHOTS, keduanya memiliki rentangtingkatkesulitanyangsamadariyangmudah,sedangdansulit.Dengankatalain,adasoalLOTSyangmudahdanada jugasoalHOTSyangmudah,demikian jugadengantingkatkesulitan yang tinggi ada jugapada soalLOTS. Sebagai contoh, untukmengetahui arti

Page 17: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

10

sebuahkatayang tidakumum(uncommonword)mungkinmemilikitingkatkesukaranyang sangat tinggi karena hanya sedikit siswa yang mampu menjawab benar, tetapikemampuan untuk menjawab permasalahan tersebut tidak termasuk higher orderthinkingskills.Sebaliknyasebuahsoalyangmemintasiswauntukmenganalisadenganmelakukanpengelompokanbendaberdasarkancirifisikbukanmerupakansoalyangsulituntukdijawabolehsiswa.Tingkatkesukaran(mudahv.s.sukar)dandimensiprosesberpikir(berpikirtingatrendahv.s. berpikir tingkat tinggi) merupakan dua hal yang berbeda. Kesalahpahamaninterpretasi kalau LOTS itu mudah dan HOTS itu sulit dapat mempengaruhi prosespembelajaran. Implikasi dari kesalahpahaman ini adalah guru menjadi engganmemberikan atau mebiasakan siswanya untuk berpikir tingkat tinggi hanya karenasiswanyatidaksiap,danhanyamenerapkanpembelajaranLOTSdantugasyangbersifatdrillsaja.

E. PeranSoalHOTSdalamPenilaianHasilBelajar PeransoalHOTSdalampenilaianhasilbelajarsiswadifokuskanpadaaspekpengetahuandanketerampilanyangterkaitdenganKDpadaKI-3danKI-4.Soal-SoalHOTSbertujuanuntukmengukurketerampilanberpikirtingkattinggi.Padapenilaianhasilbelajar,gurumengujikan butir soal HOTS secara proporsional. Berikut peran soal HOTS dalampenilaianhasilbelajar.

1. Mempersiapkankompetensisiswamenyongsongabadke-21Penilaian hasil belajar pada aspek pengetahuan yang dilaksanakan oleh sekolahdiharapkan dapat membekali siswa untuk memiliki sejumlah kompetensi yangdibutuhkanpadaabadke-21.Secaragarisbesar,terdapat3kelompokkompetensiyangdibutuhkanpadaabadke-21 (21st centuryskills) yaitu:a)memiliki karakter yangbaik(religius,nasionalis,mandiri,gotongroyong,danintegritas);b)memilikikemampuan4C(criticalthinking,creativity,collaboration,dancommunication);sertac)menguasailiterasimencakup keterampilan berpikir menggunakan sumber-sumber pengetahuan dalambentukcetak,visual,digital,danauditori.Penyajian soal-soal HOTS dalam penilaian hasil belajar dapat melatih siswa untukmengasahkemampuandanketerampilannya sesuaidengantuntutankompetensiabadke-21diatas.Melaluipenilaianberbasispadasoal-soalHOTS,keterampilanberpikirkritis(critical thinking), kreativitas (creativity)dan rasapercayadiri (learning self reliance),akan dibangun melalui kegiatan latihan menyelesaikan berbagai permasalahan nyatadalamkehidupansehari-hari(problem-solving).

2. Memupukrasacintadanpeduliterhadapkemajuandaerah(localgenius)Soal-soalHOTShendaknyadikembangkansecarakreatifolehgurusesuaidengansituasidankondisididaerahnyamasing-masing.Kreativitasgurudalamhalpemilihanstimulusyang berbasis permasalahan daerah di lingkungan satuan pendidikan sangat penting.Berbagaipermasalahanyangterjadididaerahtersebutdapatdiangkatsebagaistimuluskontekstual. Dengan demikian stimulus yang dipilih oleh guru dalam soal-soal HOTSmenjadisangatmenarikkarenadapatdilihatdandirasakansecaralangsungolehsiswa.Di samping itu, penyajian soal-soal HOTS dalam penilaian hasil belajar dapatmeningkatkanrasamemilikidancintaterhadappotensi-potensiyangadadidaerahnya.Sehinggasiswamerasaterpanggiluntukikutambilbagiandalammemecahkanberbagaipermasalahanyangtimbuldidaerahnya.

Page 18: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

11

3. Meningkatkanmotivasibelajarsiswa

Pendidikan formal di sekolah hendaknya dapat menjawab tantangan di masyarakatsehari-hari.Ilmupengetahuanyangdipelajarididalamkelashendaknyaterkaitlangsungdenganpemecahanmasalahdimasyarakat.Dengandemikiansiswamerasakanbahwamateripelajaranyangdiperolehdidalamkelasbergunadandapatdijadikanbekaluntukterjundimasyarakat.Tantangan-tantanganyang terjadidimasyarakatdapatdijadikanstimuluskontekstualdanmenarikdalampenyusunansoal-soalpenilaianhasil belajar,sehingga munculnya soal-soal berbasis soal-soalHOTS, diharapkan dapat menambahmotivasibelajarsiswa.Motivasiinilahyangmenjadikansiswamenjadiinsanpembelajarsepanjanghayat

4. MeningkatkanmutudanakuntabilitaspenilaianhasilbelajarInstrumen penilaian dikatakan baik apabila dapatmemberikan informasi yang akuratterhadap kemampuan peserta tes. Penggunaan soal-soal HOTS dapat meningkatkankemampuanketrampilanberpikiranak.Akuntabilitaspelaksanaanpenilaianhasilbelajaroleh guru dan sekolah menjadi sangat penting dalam rangka menjaga kepercayaanmasyarakatkepadasekolah.Pada Kurikulum 2013 sebagian besar tuntutan KD ada pada level 3 (menganalisis,mengevaluasi,ataumencipta).Soal-soalHOTSdapatmenggambarkankemampuansiswasesuaidengantuntutanKD.Kemampuansoal-soalHOTSuntukmengukurketerampilanberpikirtigkattinggi,dapatmeningkatkanmutupenilaianhasilbelajar.

F. Langkah-LangkahPenyusunanSoalHOTSUntukmenulisbutirsoalHOTS,terlebihdahulupenulissoalmenentukanperilakuyanghendakdiukurdanmerumuskanmateriyangakandijadikandasarpertanyaan(stimulus)dalamkontekstertentusesuaidenganperilakuyangdiharapkan.Pilihmateriyangakanditanyakanmenuntutpenalarantinggi,kemungkinantidakselalutersediadidalambukupelajaran.Olehkarena itudalampenulisan soalHOTS, dibutuhkanpenguasaanmateriajar,keterampilandalammenulissoal,dankreativitasgurudalammemilihstimulussoalyangmenarik dan kontekstual. Berikutdipaparkan langkah-langkahpenyusunan soal-soalHOTS.1. MenganalisisKDyangdapatdibuatsoal-soalHOTSTerlebih dahulu guru-guru memilih KD yang dapat dibuatkan soal-soal HOTS. TidaksemuaKDdapatdibuatkanmodel-modelsoalHOTS.PilihlahKDyangmemuatKKOyangpadaranahC4,C5,atauC6.Guru-gurusecaramandiriataumelaluiforumMGMPdapatmelakukananalisisterhadapKDyangdapatdibuatkansoal-soalHOTS.2. Menyusunkisi-kisisoalKisi-kisipenulisansoal-soalHOTSbertujuanuntukmembantuparagurumenulisbutirsoalHOTS. Kisi-kisi tersebutdiperlukanuntukmemandugurudalam:(a)menentukankemampuanminimaltuntutanKDyangdapatdibuatsoal-soalHOTS,(b)memilihmateripokokyangterkaitdenganKDyangakandiuji,(c)merumuskanindikatorsoal,dan(d)menentukanlevelkognitif.3. MerumuskanStimulusyangMenarikdanKontekstualStimulusyangdigunakanharusmenarik,artinyastimulusharusdapatmendorongsiswauntukmembacastimulus.Stimulusyangmenarikumumnyabaru,belumpernahdibacaolehsiswa,atauisu-isuyangsedangmengemuka.Sedangkanstimuluskontekstualberartistimulusyangsesuaidengankenyataandalamkehidupansehari-hari,mendorongsiswauntukmembaca.Beberapahalyangperludiperhatikanuntukmenyusunstimulussoal

Page 19: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

12

HOTS: (1)pilihlahbeberapa informasi dapatberupagambar,grafik, tabel,wacana,dllyang memiliki keterkaitan dalam sebuah kasus; (2) stimulus hendaknya menuntutkemampuan menginterpretasi, mencari hubungan, menganalisis, menyimpulkan, ataumenciptakan;(3)pilihlahkasus/permasalahankonstekstualdanmenarik(terkini)yangmemotivasi siswa untuk membaca (pengecualian untuk mapel Bahasa, Sejarah bolehtidak kontekstual); dan (4) terkait langsung dengan pertanyaan (pokok soal), danberfungsi.4. Menulisbutirpertanyaansesuaidengankisi-kisisoalButir-butirpertanyaanditulissesuaidengankaidahpenulisanbutirsoalHOTS.KaidahpenulisanbutirsoalHOTS,padadasarnyahampirsamadengankaidahpenulisanbutirsoal pada umumnya. Perbedaannya terletak pada aspek materi (harus disesuaikandengankarakteristiksoalHOTSdiatas), sedangkanpadaaspekkonstruksidanbahasarelatifsama.Setiapbutirsoalditulispadakartusoal,sesuaiformatterlampir.5. Membuatpedomanpenskoran(rubrik)ataukuncijawabanSetiapbutir soalHOTS yangditulis harusdilengkapidenganpedomanpenskoranataukuncijawaban.Pedomanpenskorandibuatuntukbentuksoaluraian.Sedangkankuncijawabandibuatuntukbentuksoalpilihanganda,danisiansingkat.Untukmemperjelaslangkah-langkahpenyusunansoalHOTS,disajikandalamgambar1dibawahini

Gambar2.1.AlurPenyusunanSoalHOTS

Kompetensi Dasar

Analisis KD

Menyusun Kisi-Kisi

Form Kisi-Kisi

Merumuskan Stimulus

Form Kartu Soal

Menulis Soal HOTS

Pedoman Penskoran

Page 20: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

13

BABIIIPENYUSUNANSOALKETERAMPILANBERPIKIRTINGKAT

A. KarakteristikMapelSeniBudayaDalamPedomanMataPelajaran(PMP)SeniBudayapadaPermendikbudNo.59Tahun2014dapatdisimpulkanbahwakarakteristikmapelSeniBudayaadalahsebagaiberikut:

1. TujuanMata Pelajaran Seni Budaya bertujuan untuk menumbuhkembangkan kepekaan rasaestetikdanartistik,sikapkritis,apresiatif,dankreatifpadadirisetiappesertapendidiksecaramenyeluruh.Sikapinihanyamungkintumbuhjikadilakukanserangkaianprosesaktivitasberkesenianpadapesertadidik.MatapelajaranSeniBudayamemiliki tujuankhusus,yaitu;Menumbuhkembangkansikaptoleransi,Menciptakandemokrasiyangberadab,Menumbuhkanhiduprukundalammasyarakatmajemuk,MengembangkankepekaanrasadanketerampilanMenerapkanteknologidalamberkreasiMenumbuhkanrasacintabudayadanmenghargaiwarisanbudayaIndonesiaMembuatpergelarandanpamerankaryaseni.

2. RuangLingkupRuanglingkupmatapelajaranSeniBudayamemiliki4aspekseni,yaitu:a. SeniRupa.Apresiasisenirupa,Estetikasenirupa,Pengetahuanbahandanalatseni

rupa,Teknikpenciptaansenirupa,Pameransenirupa,Evaluasisenirupa,Portofoliosenirupa.PadaSekolahMenengahAtassenirupaberisikegiatanmengkreasikaryasenirupaduadantigadimensi

b. SeniMusik.Apresiasisenimusik,Estetikasenimusik,Pengetahuanbahandanalat

seni musik, Teknik penciptaan seni musik, Pertunjukan seni musik, Evaluasi senimusik,Portofoliosenimusik.PadaSekolahMenengahAtasSenimusikmenampilkanpergelarankaryamusik.

c. SeniTari.Apresiasisenitari,Estetikasenitari,Pengetahuanbahandanalatsenitari,

Teknikpenciptaansenitari,Pertunjukkansenitari,Evaluasisenitari,Portofoliosenitari..PadaSekolahMenengahAtassenitarimelakukandanmengkreasikankaryasenitari

d. SeniTeater.Apresiasiseniteater,Estetikaseniteater,Pengetahuanbahandanalat

seni teater,Teknikpenciptaan seni teater, Pertunjukkan seni teater, Evaluasi seniteater, Portofolio seni teater. Pada Sekolah Menengah Atas teater menampilkanpementasankaryateater.

BABIII PenyusunanSoalKeterampilanBerpikirTingkatTinggiMataPelajaranSeniBudaya

Page 21: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

14

3. PembelajaranPembelajaranSeniBudayamerupakanprosespendidikanolahrasamembentukpribadiharmonis,danmenumbuhkanmultikecerdasan.Pembelajarandilakukandenganaktivitasberkesenian sehingga dapat meningkatkan kemampuan sikap menghargai, memilikipengetahuan, dan keterampilan dalam berkarya dan menampilkan seni denganmemperhatikankebutuhandanperkembanganpesertadidiksertasesuaidengankonteksmasyarakat dan budayanya. Falsafah lama dari Kong Fu Chu mengatakan bahwapembelajaranharusdialamiolehpesertadidik.Falsafahitumengungkapkanbahwasayadengarsayalupa,sayalihatsayaingatdansayalakukansayamengerti.PembelajaranSeniBudayadilakukandenganmemberikanpengalamanestetikmencakupkonsepsi,apresiasi,kreasidankoneksi.KeempathaltersebutselarasdenganKompetensiIntiyangadapadakurikulum2013,pertamatentanghubungannyadenganmenjalankanajaranagamayangdianutnya,keduadenganmenerapkannilai-nilaidalammengapresiasikaryaseni,ketigadenganmemahamipengetahuanfaktualberkaitantentangmaterisenibudaya dan keempat melakukan aktivitas berkesenian yang meliputi berekspresi,berkreasi dan berapresiasi “belajar dengan seni,” “belajar melalui seni” dan “belajartentangseni.”

4. PenilaianBerbagai teknik penilaian hasil Belajar Seni Budaya yang digunakan untuk penilaiankompetensisikap,pengetahuan,danketerampilandalamSistemPenilaianKelassebagaiberikut:a. PenilaianKompetensiSikapPendidikmelakukanpenilaiankompetensisikapmelalui

observasi, penilaiandiri, penilaian “teman sejawat” (peer evaluation) olehpesertadidik dan jurnal. Instrumen yang digunakan untuk observasi, penilaian diri, danpenilaianantarpesertadidikadalahdaftarcekatauskalapenilaian(ratingscale)yangdisertairubrik,sedangkanpadajurnalberupacatatanpendidik.

b. Penilaian Kompetensi Pengetahuan Pendidik menilai kompetensi pengetahuan

melaluitestulis,teslisan,danpenugasan.c. Penilaian Kompetensi Keterampilan Pendidik menilai kompetensi keterampilan

melalui penilaian kinerja, yaitu penilaian yang menuntut peserta didikmendemonstrasikan suatukompetensi tertentudenganmenggunakan tespraktik,projek,danpenilaianportofolio.Instrumenyangdigunakanberupadaftarcekatauskalapenilaian(ratingscale)yangdilengkapirubrik.

1) Tes praktik adalah penilaian yang menuntut respon berupa keterampilan

melakukansuatuaktivitasatauperilakusesuaidengantuntutankompetensi.Tespraktik sangat umum digunakan untuk mengukur kompetensi keterampilandalammengekspresikandanberkayaseni.

2) Projek adalah tugas-tugas belajar (learning tasks) yang meliputi kegiatan

perancangan, pelaksanaan, dan pelaporan secara tertulis maupun lisan dalamwaktu tertentu. Penilaian projek dalam pembelajaran Seni Budaya dapatdilakukangurupadakegiatanpameranataupergelaranseni,selainitujugadapatdalam bentuk membuat laporan, ulasan atau kritik seni yang dipresentasikanpesertadidik.

3) Penilaianprodukadalahpenilaianterhadapprosespembuatandankualitassuatu

produk.Penilaianprodukmeliputipenilaiankemampuanpesertadidikmembuat

Page 22: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

15

produk-produk teknologi dan seni, seperti:makanan, pakaian, hasil karya seni(patung,lukisan,gambar),barang-barangterbuatdarikayu,keramik,plastik,danlogam.

4) Penilaian portofolio adalah penilaian yang dilakukan dengan cara menilai

kumpulan seluruh karya peserta didik dalam bidang tertentu yang bersifatreflektif-integratif untukmengetahui minat, perkembangan, prestasi, dan/ataukreativitas peserta didik dalam kurun waktu tertentu. Penilaian portofoliodiberikan agar karya peserta didik didokumentasikan dengan baik sebagaipendukungdalamkemampuanmenilaikemampuandiri.PortofoliodalammatapelajaranSeniBudayadapatberupakumpulanhasilkaryaSeniRupaataukarya-karyasenidalambentukVCDdandeskripsikaryaseni.

B. AnalisisKDBerdasarkanPermendikbudNo.37Tahun2018tentangKI-KD,kitadapatmemilihKDyangakandibuatsoalHOTSdenganmelihattuntutanKDpadaKKOyangterteradiawal.Umumnya KD yang dapat dibuat Soal HOTS-nya adalah pada Level Kognitif C-4(Menganalisis)namuntidaktertutupkemungkinanuntukmenggunakanKDpadaLevelKognitifC-2(Memahami)jikastimulussoalmampumengantarkanpesertadidikuntuksampaipadakemampuanberfikirkritisataupadapemahamanMetakognitif. BerikutContohanalisisKDpadayangakandibuatsoalHOTS:

Tabel31.ContohanalisisKD

No. KELAS/SMT KompetensiDasar Level

KognitifSeniRupa3.14.1

X/1 memahamikonsep,unsur,prinsip,bahan,danteknikdalamberkaryasenirupamembuatkaryasenirupaduadimensimenggunakanberbagaimediadanteknikdenganmelihatmodel

C2

3.24.2

X/1 memahamikaryasenirupaberdasarkan,jenis,tema,dannilaiestetisnyamembuat karya seni rupa tiga dimensi denganmelihatmodel

C2

3.34.3

X/2 memahamikonsepdanprosedurpamerankaryasenirupamenyelenggarakan pameran hasil karya seni rupadua dan tiga dimensi yang dibuat berdasarkanmelihatmodel

C2

3.43.4

X/2 memahamikonsep,prosedur,danfungsikritikdalamkaryasenirupamembuat deskripsi karya seni rupa berdasarkanpengamatandalambentuklisanatautulisan

C2

3.14.1

XI/1 menganalisis konsep, unsur, prinsip, bahan, danteknikdalamberkaryasenirupamembuat karya seni rupa dua dimensi denganmemodifikasiobjek

C4

3.24.2

XI/1 menganalisis karya seni rupa berdasarkan jenis,tema,fungsi,dannilaiestetisnya

C4

Page 23: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

16

membuat karya seni rupa tiga dimensi denganmemodifikasiobjek

3.34.3

XI/2 menganalisis perencanaan, pelaksanaan, danpelaporanpamerankaryasenirupamenyelenggarakanpamerankaryasenirupaduadantigadimensihasilmodifikasi

C4

3.43.4

XI/2 menganalisis konsep, prosedur, fungsi, tokoh, dannilaiestetisdalamkaryasenirupamembuat analisis karya seni rupa berdasarkankonsep, prosedur, fungsi, tokoh, dan nilai estetisdalambentuklisanatautulisan

C4

3.14.1

XII/1 mengevaluasi konsep, unsur, prinsip, bahan, danteknikdalamberkaryasenirupaberkreasikaryasenirupaduadimensiberdasarkanimajinasidenganberbagaimediadanteknik

C5

3.24.2

XII/1 mengevaluasi karya seni rupa berdasarkan jenis,tema,fungsidannilaiestetisnyaberkreasikaryasenirupa tigadimensiberdasarkanimajinasidenganberbagaimadiadanteknik

C5

3.34.3

XII/2 mengevaluasihasilpenyelenggaraanpamerankaryasenirupamenyelenggarakanpamerankaryasenirupaduadantigadimensihasilkreasisendiri

C5

3.43.4

XII/2 mengevaluasi karya seni rupa berdasarkan tema,jenis,fungsitokoh,dannilaiestetisnya.membuat evaluasi dalam bentuk kritik karya senirupaberdasarkantema,jenis,fungsitokoh,dannilaiestetisnyadalambentuklisanatautulisan

C5

SeniMusik3.14.1

X/1 memahamijenisdanfungsialatmusiktradisionalmemainkanalatmusiktradisional

C2

3.24.2

X/1 menganalisis alat musik tradisional berdasarkanjenisdanfungsinyapadamasyarakatpendukungnyamempresentasikan hasil analisis alat musiktradisional berdasarkan jenis dan fungsinya padamasyarakatpendukungnya

C4

3.34.3

X/2 memahami dan mengapresiasi pertunjukan musiktradisionalmenampilkanpertunjukanmusiktradisional

C2

3.43.4

X/2 memahami konsep, bentuk dan jenis pertunjukanmusiktradisionalmembuat tulisan hasil analisis pertunjukan musiktradisional

C2

3.14.1

XI/1 memahamikonsepmusikBaratmemainkanalatmusikBarat

C2

3.24.2

XI/1 menganalisismusikBaratmempresentasikanhasilanalisismusikBarat

C4

3.34.3

XI/2 menganalisishasilpertunjukanmusikBaratmembuattulisantentangmusikBarat

C4

3.43.4

XI/2 memahamiperkembanganmusikBaratmenampilkanbeberapalagudanpertunjukanmusikBarat

C2

Page 24: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

17

3.14.1

XII/1 memahami konsep dan teknik berkreasi musikkontemporermempresentasikan konsep dan teknik berkreasimusikkontemporer

C2

3.24.2

XII/1 menganalisiskaryamusikkontemporermempresentasikanhasilanalisismusikkontemporer

C4

3.34.3

XII/2 mengevaluasipertunjukanmusikkontemporermenerapkan konsep dan teknik berkreasi musikkontemporer

C5

3.43.4

XII/2 merancang konsep dan teknik berkreasi musikkontemporersecaramandirimenampilkan karya musik kontemporer kreasisendiri

C6

(*)diujikandalamUjianPraktik

C. ContohStimulusPenting dirumuskan Stimulus dalam pembuatan Soal HOTS sebagai sarana untukmengantarkanpesertadidikmencapai kemampuanyangdituntutdalamHOTS sepertimenginterpretasi,menganalisis,menyimpulkandanlain-lain.

Tabel3.2.ContohStimulusSenbiBudaya

No. KompetensiDasar Stimulus Kemampuan

YangDiuji TahapanBerpikir

SeniRupa1 3.1memahami

konsep, unsur,prinsip,bahan,dan teknikdalamberkarya senirupa

Disajikangambar batikmotifBanyumasan

Mengidentifikasisumber idemotifnya.

MengidentifikasiunsursenirupaMemahami teknikberkaryasenirupaMenganalisis konsepsenirupadaerah

2 3.2menganalisisperencanaan,pelaksanaan,dan pelaporanpamerankarya senirupa

Disajikangambardenahpameran

Menganalisispenataanpameran

Memahami konseppameranMemahamipenataanpameranMenentukan alurpengunjungMenganalisispenataanpameran

3 3.4menganalisiskonsep,prosedur,fungsi, tokoh,dan nilaiestetis dalamkarya senirupa

Disajikandeskripsikaryaseni

Menganalisiskonseppenciptaan motifkainsasirangan

Memahami konsepkaryasenirupaMemahami teknikberkaryasenirupaMenerapkan nilaiestetis karya senirupaMenganalisisprosedur penciptaankaryasenirupa

SeniMusik

Page 25: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

18

No. KompetensiDasar Stimulus Kemampuan

YangDiuji TahapanBerpikir

1 3. 1memahamijenis danfungsi alatmusiktradisional

DisajikanTabel berisiGambar alatmusiktradisional.

Mengelompokkanalat musiktradisionalberdasarkansumberbunyidanFungsinya(LOTS)

Menjelaskan fungsiAlat musiktradisionalMenjelaskanperbedaan alatmusik tradisionalberdasarkan sumberbunyinyaMengelompokkanalat musiktradisionalberdasarkan sumberbunyidanfungsinya

2 3.2menganalisisalat musiktradisionalberdasarkanjenis danfungsinyapadamasyarakatpendukungnya

Disajikanwacana dangambartangganadaDiatonisMayor danpembentukanTangganadaPentatonisSunda(Pelog)

Menganalisis danmengembangkantangganadaPentatonis dariTangganadaDiatonis(HOTS)

Menjelaskantangganada diatonismayorMengubahtangganada diatonisMayor menjadiPentatonisMengembangkantransposetangganadapentatonis

D. PenjabaranKDmenjadiIndikatorSoalKDyangsudahdianalisisdijabarkanmenjadiindikatorsoaldenganmemperhatikanhal-haldibawahini:1. IndikatorSoalbentukPGhanyamenggunakansatukatakerjaoperasional(KKO)yangterukur

2. Memenuhiprinsip:a. Audienceb. Behaviorc. Condition

3. Sebaiknyamenggunakan stimulus (dasar pertanyaan) berupa gambar, grafik, tabel,datahasilpercobaan,kurva,wacana,ataukasusyangdapatmerangsang/memotivasipesertadidikberpikirsebelummenentukanpilihanjawaban

4. JenisIndikatora. Indikatorsoal terbuka:penulissoaldapatberimprovisasisecarabebasuntuk

mengembangkanbutirsoalb. Indikator soal tertutup: umumnya digunakan untuk penyusunan butir soal

dalambeberapapaketparalel,sehinggaharusmemenuhipersyaratansbb.• Kesetaraankonten(materiyangdiujikan).• Kesetaraantingkatkesukaran(judgement).• Kesetaraankonteks(rumusanbutirsoal,kompleksitas).

Page 26: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

19

Tabel3.3.ContohPenjabaranKDMenjadiIndikatorSoal

No. KompetensiDasar ContohIndikatorSoal1 3.1 memahami konsep, unsur,

prinsip, bahan, dan teknik dalamberkaryasenirupa

Disajikan gambar batik motifBanyumasan peserta didik dapatmengidentifikasi sumber idemotifnya.

2 3.2 menganalisis perencanaan,pelaksanaan, dan pelaporanpamerankaryasenirupa

Disajikan tips penataan ruangpameranyangbaikdengansegalaperalatan yang dibutuhkan dandua gambar denah ruang pameryangberbeda,siswadapatmenilaipenataanruangpameran.

3 3.4 menganalisis konsep,prosedur, fungsi, tokoh, dan nilaiestetisdalamkaryasenirupa

Disajikanpaparanmengenaimotifkain sasirangan peserta didikdapat menganalisis konseppenciptaanmotifkainsasirangan

4 3.1 memahami jenis dan fungsialatmusiktradisional

DisajikanTabelberisiGambaralatmusik tradisional, peserta didikdapat Mengelompokkan alatmusik tradisional berdasarkansumber bunyi dan Fungsinya(LOTS)

5 3.2 menganalisis alat musiktradisional berdasarkan jenisdanfungsinya pada masyarakatpendukungnya

Disajikan wacana dan gambartangganada Diatonis Mayor danpembentukan TangganadaPentatonis Sunda (Pelog), Pesertadidik dapat Menganalisis danmengembangkan tangganadaPentatonis dari TangganadaDiatonis(HOTS)

E. MenyusunKisi-kisiTabel34.Kisi-KisisoalHOTS

No KompetensiDasar Materi

Kelas/Semester

IndikatorSoalLevelKognitif

BentukSoal

No.Soal

1. 3.1 memahamikonsep, unsur,prinsip, bahan,danteknikdalamberkarya senirupa

konsep,unsur,bahan,danteknikberkaryasenirupa

X/1 Disajikangambarbatik motifBanyumasanpeserta didikdapatmengidentifikasisumber idemotifnya.

C2 PG 1

2 3.2 menganalisisperencanaan,

Pameransenirupa

XI/2 Disajikan tipspenataan ruang

C4 PG 2

Page 27: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

20

No KompetensiDasar Materi

Kelas/Semester

IndikatorSoalLevelKognitif

BentukSoal

No.Soal

pelaksanaan,danpelaporanpameran karyasenirupa

pameran yangbaik dengansegala peralatanyang dibutuhkandan dua gambardenah ruangpamer yangberbeda, siswadapat menilaipenataan ruangpameran.

3 3.4 menganalisiskonsep,prosedur, fungsi,tokoh, dan nilaiestetis dalamkaryasenirupa

Konsepkaryasenirupa

XI/2 Disajikandeskripsimengenai motifkain sasiranganpeserta didikdapatmenganalisiskonseppenciptaan motifkainsasirangan

C4 PG 3

2 3.2 menganalisisalat musiktradisionalberdasarkanjenis danfungsinya padamasyarakatpendukungnya

MusikTradisionalNusantara

X/1 Disajikanwacanadisertai gambartangganadaDiatonis MayordanpembentukanTangganadaPentatonisSunda(Pelog), Pesertadidik dapatMenganalisis danmengembangkantangganadaPentatonis dariTangganadaDiatonis(HOTS)

C4 Uraian 4

Page 28: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

21

F. KartuSoalHOTS BerikutinicontohpengisiankartuSoaluntukSoalPilihanGandadanUraian KARTUSOAL(PILIHANGANDA)MataPelajaran :SeniBudaya(SeniMusik)Kelas/Semester :X/1Kurikulum :2013KompetensiDasar : 3.1memahamijenisdanfungsialatmusiktradisionalMateri : AlatMusikTradisionalIndikatorSoal : Disajikan Tabel berisi Gambar alat musik tradisional,

pesertadidikdapatMengelompokkanalatmusiktradisionalberdasarkansumberbunyidanFungsinya

LevelKognitif : C-2Soal:

No Gambar BerdasarkanFungsi BerdasarkanSumberBunyi

1

Sasando

Ritmis Ideophone

2

Sape

Melodis Kordophone

Page 29: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

22

No Gambar BerdasarkanFungsi BerdasarkanSumberBunyi

3

Suling

Harmonis Elektrophone

4

Kendang

Ritmis Membranophone

1.Kombinasiketerangangambaryangpalingbenardaritabeldiatasadalah....A.Nomor1dan2B.Nomor1dan3C.Nomor2dan3DNomor2dan4E.Nomor3dan4

KunciJawaban:DKeterangan:Soal ini bukanHOTS karenamasihdalam tahapanberpikirC -2dimanapesertadidikhanyadimintauntukmengelompokkanalatmusikberdasarkantabelyangdisajikan.KARTUSOALNOMOR1(PILIHANGANDA)MataPelajaran :SeniBudaya(SeniRupa)Kelas/Semester :X/1Kurikulum :2013KompetensiDasar : 3.1 memahami konsep, unsur, prinsip, bahan, dan teknik

dalamberkaryasenirupaMateri : konsep,unsur,bahan,danteknikberkaryasenirupaIndikatorSoal : Disajikan gambar batik motif Banyumasan peserta didik

dapatmengidentifikasisumberidemotifnya.LevelKognitif : C-2Soal:Perhatikanmotifbatikberikut!

Page 30: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

23

Keragaman corak batik nusantara mencerminkan masing-masing daerah. Batik padagambar tersebutmerupakan batik Banyumasan.Motif yangmenginspirasi pembuatanbatiktersebutadalah….A. menggambarkanmotifpedalamanyangsesuailingkungandaaerahnyayangbanyak

terdapathutandanpegununganB. motiflekuk-lekuksepertibungayangmenggambarkansuatukeindahanlingkungan

danmasyarakatnyaC. menggunakan warna yang jelas hal ini menggambar masyarakatnya tegas dan

cenderungapaadanyaD. motif tumbuhan yang dibuat secara realistis sesuai dengan karakteristik

masyarakatnyaE. sesuaibudayamasyarakatnyayangselaluberdinamikadanmenerimahasilbudaya

lainKunciJawaban:AKeterangan:SoaliniHOTSkarenaharusmenggunakaninformasiuntukmenyelesaikanmasalah.Untukmenjawabsoalinisiswaharusmamputerlebihdahulumengidentifikasiunsursenirupa,memahamiteknikberkaryasenirupa,danmenganalisiskonsepsenirupadaerah.

Page 31: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

24

KARTUSOALNOMOR2(PILIHANGANDA)MataPelajaran :SeniBudaya(SeniRupa)Kelas/Semester :XI/2Kurikulum :2013KompetensiDasar : 3.3menganalisisperencanaan,pelaksanaan,danpelaporan

pamerankaryasenirupaMateri : PameransenirupaIndikatorSoal : Disajikan tipspenataan ruangpameran yang baikdengan

segalaperalatan yangdibutuhkandandua gambar denahruangpameryangberbeda,siswadapatmenilai penataanruangpameran.

LevelKognitif : C-4Soal:Perhatikan denah ruang pamer pada gambar 1 dan gambar 2 kemudian pilihlahpernyataandibawahiniyangpalingbenar!A. Kelemahandaripenataanruangpameranpadagambar2adalahterdapatcelahatau

peluangterjadinyatabrakanpengunjung.B. Perbedaandaripenataanruangpameranpadagambar1dangambar2adalahpada

alursirkulasipengunjungnya.C. Perbedaanyangmutlakdari ruangpameranpadagambar1dangambar2adalah

jumlahkaryayangdapatdipamerkan.D. Alurpergerakanpengunjungdiruangpamerpadagambar1memungkinkanterjadi

penumpukanpengunjungdisalahsatusisi.E. Ruangpamerangambar2memungkinkanpengunjungberjalantidaksesuaidengan

aluryangdirencanakanpanitia.KunciJawaban:CKeterangan:SoaliniHOTSkarenaharusmemprosesdanmengintegrasikaninformasi.Untukmenjawabsoalinisiswaharusmamputerlebihdahulu

Page 32: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

25

KARTUSOALNOMOR3(PILIHANGANDA)MataPelajaran :SeniBudaya(SeniRupa)Kelas/Semester :XI/2Kurikulum :2013KompetensiDasar : 3.4menganalisiskonsep,prosedur,fungsi,tokoh,dannilai

estetisdalamkaryasenirupaMateri : KonsepkaryasenirupaIndikatorSoal : Disajikandeskripsimengenaimotifkainsasiranganpeserta

didik dapat menganalisis konsep penciptaan motif kainsasirangan

LevelKognitif : C-4Soal:Kain Sasirangan merupakan kain khas Kalimantan Selatan yang terkenal dengankeindahan motif-motifnya. Dalam proses penciptan motif pada kain sasiranganmasyarakatbanjarpadajamandahulumengambilinspirasidariberbagaihalyangdekatdengan kehidupan mereka, seprti flora, fauna hingga kepercayaan, dengan harapanmakna-maknayangterkandungdidalamtiapmotifmenjadilambangataudoaagarsangpemakaikainmemilikisifatsepertiyangterkandungdidalammotifsasirangan.Adapunsalahsatumotifkainsasiranganyaitumotifgigiharuanyangmemilikimaknaketajamanberpikir.IkanHaruanataudikenaljugadengannamaikangabus(ChannaStriata)adalahjenis makhluk karnivora yang hidup di habitat air tawar yang banyak ditemukan diperairanKalimantanSelatan.IkanHaruanbertubuhbulatdamemilikimulutlebardangigi-gigi yang runcing.Salah satukeunikan ikanharuanadalah jikasawah, kolamatauparitmengering,ikaniniakanberupayapindahketempatlain,ataubilaterpaksa,akanmenguburdirididalamlumpurhinggatempatitukembaliberair.JikaditinjaudaridarisudutgizidanjugasudutpanganikanharuanmemilikipotensiyangtinggimakatakanehjikaikanharuanjugabanyakdiolahmenjadiberbagaihidanganbagimasyarakatBanjar.SimpulkamkenapamotifgigiharuandigunakanmasyarakatBanjarpadajamandahulusebagailambangdariketajamanberpikir?A. Ikanharuanmerupakan ikan favorit orangBanjar, gigi-giginya runcingdan tajam

sehinggamasyrakatbanjarberharapmemilikikemampuanberpikirseruncingdansetajamgigiharuan.

B. IkanharuanmerupakanikanfavoritorangBanjar,yangmemilikiinstingyangluarbiasadalamberburu.Halinijugaditunjangdengandesainbentuktubuhyangbulatdangigi-gigiyangruncing.

C. IkanharuanmerupakanikanfavoritorangBanjar,meilikikandungangiziyangtinggisehingga orang banjar percaya ketika mengonsumsi ikan haruan maka akanmeninggkatkankecerdasanotak

D. Ikan haruan merupakan ikan favorit orang Banjar, yang persebaranya banyakterdapatdiperaiaranKalimantanselatansehinggasangatwajarjikamenjadisangatakrabdenganbudayaorangbanjar.

E. Ikanharuanmerupakan ikan favorit orangBanjar, yangdikenalmampubertahandimusimkemaraudenganmembenankandirinyakedalamtanah,dankeluarkembaliketikahujaturun.menjadiinspirasiketajamanberpikir

KunciJawaban:AKeterangan:

Page 33: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

26

SoaliniHOTSkarenaharusmenelaahidesecarakritis.Untukmenjawabsoalinisiswaharusmamputerlebihdahulumemahamikonsepkaryasenirupa,memahamiteknikberkaryasenirupa,menerapkannilaiestetiskaryasenirupa,danmenganalisisprosedurpenciptaankaryasenirupa.

Page 34: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

27

KARTUSOALNOMOR4(URAIAN)MataPelajaran :SeniBudaya(SeniMusik)Kelas/Semester :X/1Kurikulum :2013KompetensiDasar : 3.2menganalisis alatmusik tradisional berdasarkan jenis

danfungsinyapadamasyarakatpendukungnyaMateri : MusikTradisionalNusantaraIndikatorSoal : Disajikan wacana disertai gambar tangganada Diatonis

Mayor dan pembentukan Tangganada Pentatonis Sunda(Pelog), Peserta didik dapat Menganalisis danmengembangkan tangganada Pentatonis dari TangganadaDiatonis(HOTS)

LevelKognitif : C-4Soal:TangganadaDiatonisMayormemilikisusunanNotdanIntervalsepertipadagambardibawahini:

Untuk membuat susunantangganadaPentatonisSunda(Pelog)dapatdisusundenganmenghilangkannotDdanAsehinggasusunannyamenjadi:CEFGBC’padaNadaDasarC=doDenganmemperhatikan perubahan tangganada di atas, bagaimanamembuat susunantangganadapelogpadanadadasarG=do/1#,jelaskan!PEDOMANPENSKORAN:No. UraianJawaban/KataKunci Skor1 Jika jawaban dimulai dengan menjabarkan interval tangganada

pentatonispadanadadasarC=do(CEFGBC’)dengangambar

1

2 Menggunakan/menyusuntangganadadiatonis1#GABCDEF#G’

1

3 Menghilangkan dua Not : A dan E sehingga susunan tangganadapelogterbentukmenjadiGBCDF#G

1

4 Menggambarkansusunantangganadapelogberikutintervalnya: 1

Page 35: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

28

TotalSkor 4

Keterangan:SoaldiatasmerupakansoalHOTS:Terdapattransferdarisatukonsepkekonseplainnyadanmenggunakaninformasiuntukmenyelesaikanmasalah.Untukmenjawabsoalinisiswaharusmemahamiterlebihdahulukonsepintervaldalamtangganada diatonis, kemudian menerapkan pemahaman tersebut kedalam KonsepTangganadaPentatonisSunda(Pelog)hinggadapatsecarakreatifmengembangkan(C-6)ketangganada1#(naik).

Page 36: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

29

BABIV

A. StrategiStrategi pembelajaran dan penilaian HOTS dilakukan dengan melibatkan seluruhkomponenstakeholderdibidangpendidikanmulaidaritingkatpusatsampaikedaerah,sesuaidengantugaspokokdankewenanganmasing-masing.

1. PusatDirektoratPembinaanSMAsebagaileadingsectordalampembinaanSMAdiseluruhIndonesia, mengkoordinasikan strategi pembelajaran dan penilaian HOTS dengandinas pendidikan provinsi/kabupaten/kota dan instansi terkait melalui kegiatan-kegiatansebagaiberikut.MerumuskankebijakanpembelajarandanpenilaianHOTS;MenyiapkanbahanberupamodulpembelajarandanpenilaianHOTS;Melaksanakanpelatihanpengawas,kepalasekolah,danguruterkaitdenganstrategipembelajarandanpenilaianHOTS;Melaksanakanpendampingankesekolah-sekolahbekerjasamadengandinaspendidikanprovinsi/kabupaten/kotadaninstansiterkaitlainnya.

2. DinasPendidikanDinas pendidikan provinsi sesuai dengan kewenangannya di daerah,menindaklanjutikebijakanpendidikanditingkatpusatdenganmelakukankegiatan-kegiatansebagaiberikut.MensosialisasikankebijakanpembelajarandanpenilaianHOTS dan implementasinya dalam penilaian hasil belajar; Memfasilitasi kegiatanpembelajaran dan penilaianHOTS dalam rangka persiapan penyusunan soal-soalpenilaian hasil belajar; Melaksanakan pengawasan dan pembinaan ke sekolah-sekolahdenganmelibatkanpengawassekolah.

3. SekolahSekolah sebagai pelaksana teknis pembelajaran dan penilaian HOTS, merupakansalahsatubentukpelayananmutupendidikan.Dalamkontekspelaksanaanpenilaianhasilbelajar,sekolahmenyiapkanbahan-bahandalambentuksoal-soalyangmemuatsoal-soal HOTS. Langkah-langkah yang dapat dilakukan oleh sekolah antara lainsebagai berikut. Meningkatkan pemahaman guru tentang pembelajaran danpenilaian yang mengukur keterampilan berpikir tingkat tinggi (Higher OrderThinking Skills/HOTS). Meningkatkan keterampilan guru untuk menyusuninstrumenpenilaian(HighOrderThinkingSkills/HOTS) terkaitdenganpenyiapanbahanpenilaianhasilbelajar.

B. ImplementasiPembelajaran dan penilaianHOTS di tingkat sekolah dapat diimplementasikan dalambentukkegiatansebagaiberikut.1. Kepala sekolah memberikan arahan teknis kepada guru-guru/MGMP sekolah

tentangstrategipembelajarandanpenilaianHOTSyangmencakup:a. MenganalisisKDyangdapatdibuatkansoal-soalHOTS;b. Menyusunkisi-kisisoalHOTS;c. MenulisbutirsoalHOTS;d. MembuatkuncijawabanataupedomanpenskoranpenilaianHOTS;e. MenelaahdanmemperbaikibutirsoalHOTS;f. MenggunakanbeberapasoalHOTSdalampenilaianhasilbelajar.

BABIVStrategiImplementasi

Page 37: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi Mata Pelajaran Seni Budaya

30

2. WakasekkurikulumdanTimPengembangKurikulumSekolahmenyusun rencanakegiatan untuk masing-masing MGMP sekolah yang memuat antara lain uraiankegiatan,sasaran/hasil,pelaksana,jadwalpelaksanaankegiatan;

3. Kepala sekolah menugaskan guru/MGMP sekolah melaksanakan kegiatan sesuai

rencanakegiatan;4. Guru/MGMPsekolahmelaksanakankegiatansesuaipenugasandarikepalasekolah;5. Kepala sekolah dan wakasek kurikulum melakukan evaluasi terhadap hasil

penugasankepadaguru/MGMPsekolah;6. Kepala sekolahmengadministrasikan hasil kerja penugasan guru/MGMP sekolah,

sebagaibuktifisikkegiatanpenyusunansoal-soalHOTS.

Page 38: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

31

DaftarPustakaBrookhart, SusanM. (2010).How to Assess Higher Order Thinking Skill In Your Class.

VirginiaUSA:Alexandria.PeraturanMenteriPendidikandanKebudayaanNomor36Tahun2018TentangPerubahan

atasPeraturanMenteriPendidikandanKebudayaanNomor59Tahun2014tentangKurikulum2013SekolahMenengahAtas/MadrasahAliyah.

PeraturanMenteriPendidikandanKebudayaanNomor37Tahun2018TentangPerubahan

AtasPeraturanMenteriPendidikandanKebudayaanNomor24Tahun2016TentangKompetensi Inti dan Kompetensi Dasar Pelajaran Pada Kurikulum 2013 PadaPendidikanDasardanPendidikanMenengah.

PeraturanMenteriPendidikandanKebudayaanNomor20Tahun2016TentangStandar

KompetensiLulusanPendidikanDasardanMenengah.PeraturanMenteriPendidikandanKebudayaanNomor21Tahun2016TentangStandarIsi

PendidikanDasardanMenengahPeraturanMenteriPendidikandanKebudayaanNomor22Tahun2016TentangStandar

ProsesPendidikanDasardanMenengah.PeraturanMenteriPendidikandanKebudayaanNomor23Tahun2016TentangStandar

PenilaianPendidikan.Schunk, Dale H., Pintrici, Paul R., &Meece, Judith L. (2008).Motivation in Education:

Theory,Research,andApplicationsThirdEdition.NewJersey:PearsonPrenticeHall.Widana, IWayan. (2017).HigherOrderThinkingSkillsAssessment (HOTS). Journal of

Indonesia Student Assessment and Evaluation (JISAE).http://journal.unj.ac.id/unj/index.php/jisae/article/view/4859, Vol. 3 No. 1February2017,pp.32-44.ISSN:2442-4919.

Widana, I Wayan, dkk. (2017). Modul Penyusunan Soal HOTS. Jakarta: Direktorat

PembinaanSMA,DirjenDikdasmen,KementerianPendidikandanKebudayaan.Widana, I., Parwata, I., Parmithi, N., Jayantika, I., Sukendra, K., & Sumandya, I. (2018).

HigherOrderThinkingSkillsAssessmenttowardsCriticalThinkingonMathematicsLesson.InternationalJournalOfSocialSciencesAndHumanities(IJSSH),2(1),24-32.doi:10.29332/ijssh.v2n1.74

http://www.nu.or.id/post/read/47893/sunnahnya-puasa-tutup-

kendanghttps://www.pictame.com/media/1531880163083350975_4831024616https://dapurethnic.com/products/instruments/instrumen-musik-etnis-tiup/suling-

bali/http://graphic.nobody.jp/grayscale/sasando_2.html

Page 39: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

32

Lampiran1.FORMATKISI-KISISOALKETERAMPILANBERPIKIRTINGKATTINGGI

MataPelajaran :.....................

No. KompetensiDasar MateriKelas/Semester

IndikatorSoalLevelKognitif

BentukSoal

No.Soal

1

2

3

4

...............................,....................................

Mengetahui KoordinatorMGMP.....................................

KepalaSMA.........................................

................................................................ ................................................................

NIP. NIP.

Page 40: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

33

Lampiran2.KARTUSOAL

(PILIHANGANDA)MataPelajaran :..................Kelas/Semester :..................Kurikulum :..................KompetensiDasar : Materi : IndikatorSoal : LevelKognitif : Soal:KunciJawaban:Keterangan:Deskripsikan alur berpikir yang diperlukan untuk menjawab soal ini, misalnyatransformasikonsep,mencarihubunganantar informasi,menyimpulkan,dan lain-lain.Deskripsiinipentinguntukmemberikanpemahamankepadapembaca,mengapasoalinimerupakansoalHOTS.

Page 41: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

34

KARTUSOALNOMOR(URAIAN)

MataPelajaran :..................Kelas/Semester :..................Kurikulum :..................KompetensiDasar : Materi : IndikatorSoal : LevelKognitif : Soal:PEDOMANPENSKORAN:No. UraianJawaban/KataKunci Skor TotalSkor

Keterangan:Deskripsikan alur berpikir yang diperlukan untuk menjawab soal ini, misalnyatransformasikonsep,mencarihubunganantar informasi,menyimpulkan,dan lain-lain.Deskripsiinipentinguntukmemberikanpemahamankepadapembaca,mengapasoalinimerupakansoalHOTS.

Page 42: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

35

Lampiran3.INSTRUMENTELAAHSOALKETERAMPILANBERPIKIRTINGKATTINGGI

BENTUKTESPILIHANGANDANamaPengembangSoal :..................MataPelajaran :..................Kls/Prog/Peminatan :...................... No. Aspekyangditelaah

ButirSoal**)1 2 3 4 5

A.1.

MateriSoalsesuaidenganindikator.

2. Soal menggunakan stimulus yang menarik (baru,mendorongsiswauntukmembaca).

3. Soal menggunakan stimulus yang kontekstual(gambar/grafik,teks,visualisasi,dll,sesuaidengandunianyata)*

4. Soal mengukur level kognitif penalaran (menganalisis,mengevaluasi,mencipta).

5. Jawabantidakditemukanpadastimulus. 6. Tidakrutin(tidakfamiliar)danmengusungkebaruan. 7. Pilihanjawabanhomogendanlogis. 8. Setiapsoalhanyaadasatujawabanyangbenar. B.9.

KonstruksiPokoksoaldirumuskandengansingkat,jelas,dantegas.

10. Rumusan pokok soal dan pilihan jawaban merupakanpernyataanyangdiperlukansaja.

11. Pokoksoaltidakmemberipetunjukkekuncijawaban. 12. Pokok soal bebas dari pernyataan yang bersifat negatif

ganda.

13. Gambar,grafik,tabel,diagram,atausejenisnya jelasdanberfungsi.

14. Panjangpilihanjawabanrelatifsama. 15. Pilihan jawabantidakmenggunakanpernyataan"semua

jawabandiatassalah”atau“semuajawabandiatasbenar"dansejenisnya.

16. Pilihan jawaban yang berbentuk angka/waktu disusunberdasarkan urutan besar kecilnya angka ataukronologisnya.

17. Butirsoaltidakbergantungpadajawabansoallain. C.18.

BahasaMenggunakanbahasayangsesuaidengankaidahbahasaIndonesia,untukbahasadaerahdanbahasaasingsesuaikaidahnya.

19. Tidakmenggunakanbahasayangberlakusetempat. 20. Soalmenggunakankalimatyangkomunikatif. 21. Pilihanjawabantidakmengulangkata/kelompokkatayang

sama,kecualimerupakansatukesatuanpengertian.

Page 43: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

36

No. Aspekyangditelaah

ButirSoal**)1 2 3 4 5

D. AturanTambahan 15. SoaltidakmengandungunsurSARAPPPK(Suku,Agama,

Ras, Antargolongan, Pornografi, Politik, Propopaganda,danKekerasan).

*)KhususmatapelajaranBahasadanSatraIndonesiadanSejarahdapatmenggunakanteksyangtidakkontekstual(fiksi,karangan,dansejenisnya).**)PadakolomButirSoaldiisikantandacentang( )bilasoalsesuaidengankaidahatautandasilang(X)bilasoaltersebuttidakmemenuhikaidah.

.................,..............................Penelaah...........................................NIP.

Page 44: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

37

INSTRUMENTELAAHSOALKETERAMPILANBERPIKIRTINGKATTINGGIBENTUKTESURAIAN

NamaPengembangSoal :..................MataPelajaran :..................Kls/Prog/Peminatan :...................... No. Aspekyangditelaah

ButirSoal*)1 2 3 4 5

A.1.

MateriSoalsesuaidenganindikator(menuntuttestertulisuntukbentukUraian).

2. Soal menggunakan stimulus yang menarik (baru,mendorongsiswauntukmembaca).

3. Soal menggunakan stimulus yang kontekstual(gambar/grafik,teks,visualisasi,dll,sesuaidengandunianyata)*

4. Soal mengukur level kognitif penalaran (menganalisis,mengevaluasi,mencipta).

5. Jawabantidakditemukanpadastimulus. 6. Tidakrutin(tidakfamiliar)danmengusungkebaruan. B.7.

KonstruksiRumusankalimatsoalataupertanyaanmenggunakankata-katatanyaatauperintahyangmenuntutjawabanterurai.

8. Memuat petunjuk yang jelas tentang cara mengerjakansoal.

9. Ada pedoman penskoran/rubrik sesuai dengankriteria/kalimatyangmengandungkatakunci.

10. Gambar, grafik, tabel, diagram, atau sejenisnya jelasdanberfungsi.

11. Butirsoaltidakbergantungpadajawabansoallain. C.12.

BahasaMenggunakanbahasa yangsesuaidengankaidahbahasaIndonesia,untukbahasadaerahdanbahasaasingsesuaikaidahnya.

13. Tidakmenggunakanbahasayangberlakusetempat/tabu. 14. Soalmenggunakankalimatyangkomunikatif. D.

AturanTambahan

15. Soal tidakmengandung unsur SARAPPPK (Suku, Agama,Ras, Anatargolongan, Pornografi, Politik, Propopaganda,danKekerasan).

Page 45: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

38

*)KhususmatapelajaranBahasadanSatraIndonesiadanSejarahdapatmenggunakanteksyangtidakkontekstual(fiksi,karangan,dansejenisnya).**)PadakolomButirSoaldiisikantandacentang( )bilasoalsesuaidengankaidahatautandasilang(X)bilasoaltersebuttidakmemenuhikaidah.

.................,..............................Penelaah..........................................NIP.

Page 46: Modul Penyusunan Soal Keterampilan Berpikir Tingkat Tinggi ...€¦ · peningkatan kemampuan berpikir kritis bagi peserta didik. Buku modul ini menjelaskan strategi penyusunan soal

39