MergedFile - Universiti Teknologi Petronas...2. Simulates the bloom of a floralbud while injecting a graphic outline of the PETRONAS Twin Towers. 3. Reflects the beginning of a journey

Centre for Graduate StudiesUniversiti Teknologi PETRONAS

32610 Seri IskandarPerak Darul Ridzuan

2019

©UNIVERSITI TEKNOLOGI PETRONAS, 2019First Printing 2018

Second Printing 2018 Second Edition 2019

All rights reserved. No part of this publication may be reproduced or transmitted in any form or by any means, including photocopying and recording, without the written permission of the copyright holder, application for which should be addressed to Universiti Teknologi PETRONAS. Such written permission must also be obtained before any part of this

publication is stored in a retrieval system of any nature.

Centre for Graduate StudiesUniversiti Teknologi PETRONAS

32610 Seri IskandarPerak Darul Ridzuan

Tel: 05-368 8000/8585/8197/8190/81918258/8193/8194/8198/8255/8189/8687/8257

CONTENT

CHAPTER I GENERAL INFORMATION1.0 Introduction 1 2.0 University

2.1 Vision 12.2 Mission 1 2.3 University Logo 1

3.0 Centre for Graduate Studies 23.1 Organization Chart 2

4.0 University Academic Committee 24.1 Senate 24.2 University Academic Committee 34.3 University Examination Committee 34.4 Academic Appeal Committee 34.5 Academic Discipline Committee 3

5.0 Definition 35.1 Vice Chancellor 35.2 Registrar 45.3 Deputy Vice Chancellor, Academic 45.4 Deputy Vice Chancellor, Research and Innovation 45.5 Deputy Vice Chancellor, Student Affairs and Alumni5.6 Dean 45.7 Chair of Department 45.8 Senior Manager for Central of Graduate Studies 45.9 Lecturer 45.10 Tutor 45.11 Laboratory Demonstrator 45.12 Student 4

CHAPTER II ACADEMIC GUIDE 1.0 Academic 5

1.1 Academic Terms 51.2 Modes of Delivery 61.3 Final Assessment 7

2.0 Academic Performance 82.1 Academic Misconduct 82.2 Satisfactory Performance 82.3 Appeals for Reinstatement 9

Postgraduate Programme HandbookVI

3.0 Academic Administration 93.1 Change of Programme, Change of Study Mode and Deferment of Studies 93.2 Semester Registration 93.3 Add/Drop/Withdrawal of Courses 103.4 Appeal for Reinstatement/Readmission 103.5 Suspension Period 113.6 Attendance 113.7 Visa Application & Renewal 113.8 Student Clearance 113.9 Final Transcript and Degree 11

4.0 Academic Graduation Requirements 114.1 Research Methodology Courses 114.2 Publication Requirement (Research Mode Only) 154.3 Pre-Requisite Course 164.4 Fees Policy 16

CHAPTER III RESEARCH PROGRAMME 1.0 List of Programmes 19

1.1 Master by Research 191.2 PhD by Research 19

2.0 Candidacy Period 192.1 Extension of Candidacy 202.2 Graduate On Time 20

3.0 Course Registration 204.0 Supervision 20

4.1 Appointment of Supervisor 204.2 Roles and Responsibility Supervisors and Students 21

5.0 Postgraduate Assessment and Progress Monitoring 245.1 Research Proposal Defense (RPD) 255.2 Biannual Postgraduate Conference (BAPC) 275.3 Research Completion Seminar (RCS) 295.4 Viva Voce Examination 30

6.0 Upgrading Master to PhD 346.1 Eligibility 346.2 Application Process 346.3 Members for The Upgrading Panel of Assessors 346.4 Written Submission 346.5 Oral Presentation 346.6 Evaluation 346.7 Panel of Evaluation 35

7.0 Financial Assistance 357.1 Graduate Assistantship Scheme (GA) 357.2 Graduate Research Assistance Scheme (GRA) 39

8.0 Plagiarism 438.1 Quality and Integrity of The Thesis/Dissertation 438.2 Plagiarism 44

Postgraduate Programme Handbook VII

CHAPTER IV COURSEWORK PROGRAMME 1.0 Introduction 45

1.1 List of Programmes 451.2 Programme Duration 45

2.0 The Duration of Candidacy for MSc 45 2.1 Project & Dissertation 45 2.2 Graduation Requirements 453.0 Master of Business Administration in Energy Management 46 3.1 Introduction 46

3.2 Programme Objectives 463.3 Programme Outcomes 463.4 Programme Curriculum Structure 473.5 Specialization Modules 473.6 Enrolment Modes 473.7 Graduation Requirement 473.8 Business Core Modules 483.9 Energy Management Specialization Modules 523.10 Management Consultancy Project (MBA Capstone Project) 54

4.0 Master of Science in Asset Management & Maintenance 554.1 Introduction 554.2 Programme Objectives 554.3 Programme Outcomes 554.4 Programme Curriculum Structure 554.5 Core Modules 564.6 Technical Electives 584.7 Management Elective Course 594.8 University Requirement 614.9 Dissertation Project 61

5.0 Master of Science in Drilling Engineering 615.1 Introduction 615.2 Programme Objectives 625.3 Programme Outcomes 625.4 Programme Duration 625.5 Programme Curriculum Structure 635.6 Enrolment Mode 635.7 Graduation Requirements 635.8 Core Modules 645.9 National Requirement 685.10 Individual Project 68

6.0 Master of Science in Electronics Systems Engineering 696.1 Introduction 696.2 Programme Objectives 696.3 Programme Outcomes 706.4 Programme Curriculum Structure 706.5 Core Modules 716.6 Technical Electives 726.7 Management Elective Course 756.8 University Requirement 766.9 Dissertation Project 77

Postgraduate Programme HandbookVIII

7.0 Master of Science in Offshore Engineering 777.1 Introduction 777.2 Programme Objectives 777.3 Programme Outcomes 787.4 Programme Duration 787.5 Programme Curriculum Structure 787.6 Core Modules 807.7 Technical Electives 827.8 University Requirement 857.9 Dissertation Project 86

8.0 Master of Science in Petroleum Engineering 878.1 Introduction 878.2 Programme Objectives 878.3 Programme Outcomes 878.4 Programme Curriculum Structure 878.5 Core Modules 898.6 Management Elective Course 938.7 University Requirement 958.8 Dissertation Project 95

9.0 Master of Science In Petroleum Geosciences 969.1 Introduction 969.2 Programme Objectives 969.3 Programme Outcomes 969.4 Programme Curriculum Structure 979.5 Core Modules 989.6 Management Elective Course 1039.7 University Requirement 1039.8 Dissertation Project 104

10.0 Master of Science in Process Integration 10410.1 Introduction 10410.2 Programme Objectives 10510.3 Programme Outcomes 10510.4 Programme Curriculum Structure 10510.5 Core Modules 10610.6 Technical Electives 10810.7 Management Elective Course 11210.8 University Requirement 11310.9 Dissertation Project 114

11.0 Master of Science in Process Safety 11411.1 Introduction 11411.2 Programme Objectives 11411.3 Programme Outcomes 11411.4 Programme Curriculum Structure 11511.5 Core Modules 11611.6 Electives Modules 11911.7 Management Elective Course 122

Postgraduate Programme Handbook IX

CHAPTER V STUDENT AFFAIRS1.0 Health, Safety And Environment 125 2.0 Facilities 125 2.1 Facilities And Services 1253.0 International Students 1264.0 Counseling 126 4.1 Counseling Services 1265.0 Co-Curricullum Activities 126 5.1 Sports And Recreation 1266.0 Postgraduate Student Council (PGSC) 126 6.1 Vision 126 6.2 Mission 1277.0 Student Disciplinary Rules And Regulations 127

Appendix 129

1GENERAL INTRODUCTION

1.0 INTRODUCTIONUniversiti Teknologi PETRONAS (UTP) was established on January 10, 1997 when PETRONAS was invited by the Malaysian Government to set up a university.

The university was formerly known as The Institute of Technology PETRONAS (ITP) and was a wholly-owned subsidiary of PETRONAS. It was registered with the Ministry of Education on April 26, 1995 and obtained approval under the “Essential Higher Education Institute Regulation 1996”. ITP began operations at PETRONAS Management Training Sdn. Bhd. (PERMATA), Kajang, Selangor on July 3, 1995. On July 26, 1995, ITP was registered as a private limited company and transferred its operations to Bandar Seri Iskandar, Perak Darul Ridzuan on July 1, 1996.

2.0 UNIVERSITY

2.1 VisionA Leader in Technology Education and Centre for Creativity and Innovation

2.2 Mission1. UTP is an institute of higher learning. We provide opportunities to pursuit of knowledge

and expertise for the advancement of engineering, science and technology to enhance the nation’s competitiveness.

2. Our objective is to produce well-rounded graduates who are creative and innovative with the potential to become leaders of industry and the nation.

3. Our aim is to nurture creativity and innovativeness and expand the frontiers of technology and education for the betterment of society.

2.3 University Logo

Postgraduate Programme Handbook2

1. Relates to the concept of renaissance, birth and nurturing of the mind for national advancement of the highest order.

2. SimulatesthebloomofafloralbudwhileinjectingagraphicoutlineofthePETRONASTwin Towers.

3. Reflectsthebeginningofajourneytowardsnewstandardsinhighereducation.4. Gold to donate light, and deep pastel blue to signify peace and tranquility.

3.0 CENTRE FOR GRADUATE STUDIES

3.1 Organisation Chart

Figure 1: Organisation Chart of Centre for Graduate Studies

• General email: [email protected]• Contact Number : 05 - 368 8193 / 8191 / 8192 / 8255 / 8258• ContactviaUTPUnifiedCustomerServices(UCS)links-https://utp.

microsoftcrmportals.com/support/

4.0 UNIVERSITY ACADEMIC COMMITTEE

4.1 SenateThe Senate is an academic body of UTP and is subject to the provisions contained in the constitution, statues, procedures and rules of UTP. It is empowered to monitor the development and delivery of academic programmes, research, examinations, awards degrees,diplomasandcertificates.

Members of SENATE are:1. Chairman – Vice Chancellor2. Secretary – Registrar3. Members:

• Deputy Vice Chancellor, Academic• Deputy Vice Chancellor, Research & Innovation• Deputy Vice Chancellor, Student Affairs and Alumni• Deans• Chair of Academic Departments• ChiefFinancialOfficer• DirectorofProjectManagementOffice• Other members appointed by the Chairman

DEAN

SENIOR MANAGER

SECRETARY

9 Programme Managers(9 Master by Coursework Programmes)

FUNDING MANAGEMENT,TRAVELLING & CONFERENCE

PAYMENT

POSTGRADUATE ADMINISTRATION

POSTGRADUATE ADMISSION,

REGISTRATION &GRADUATION

EXAMINATION ASSESSMENT &

RESEARCH COMPLETION (VIVA)

POSTGRADUATE SKILLS DEVELOPMENT

& TRAINING

Department Chairs

Postgraduate Programme Handbook 3

4.2 University Academic Committee The University Academic Committee is the body appointed by the Senate to administer academic matters.

Members of the Academic Committee are:1. Chairman – Deputy Vice Chancellor, Academic2. Secretary – Senior Manager of Academic Central Services3. Members:

• Deans• Chair of Academic Departments• Other members appointed by the Chairman

4.3 University Examination Committee The University Examination Committee is the body appointed by the Senate to administer examination matters.Members of University Examination Committee are:1. Chairman – Deputy Vice Chancellor, Academic2. Secretary – Manager of Registry3. Members:

• Deans• Chair of Academic Departments• Other members appointed by the Chairman

4.4 Academic Appeal CommitteeThe Academic Appeal Committee is the body appointed by the Senate to administer appeals with regards to academic matters.Members of Academic Appeal Committee are:1. Chairman – Vice Chancellor2. Secretary – Manager of Registry3. Members:

• Registrar• Representative of Academic Departments• Other members appointed by the Chairman

4.5 Academic Discipline CommitteeThe Academic Disciplinary Committee is the body appointed by the Senate to administer academic misconduct.Members of Academic Disciplinary Committee are:1. Chairman – Deputy Vice Chancellor, Academic.2. Secretary – Executive of Registry3. Members:

• Two (2) representatives from relevant Academic Departments• One (1) representative from another department• One (1) Legal Advisor

5.0 DEFINITION

5.1 Vice Chancellor TheViceChancelloristheChiefExecutiveOfficer/ManagingDirectoroftheUniversityand responsible in determining the University’s directions in order to achieve its visions and missions.


5.2 RegistrarThe Registrar is an officer of the University, responsible in administering students’intake, academic records, course registration, examinations, graduation approval and accreditation of Programmes.

5.3 Deputy Vice Chancellor, AcademicThe Deputy Vice Chancellor, Academic (DVCA) leads the Academic Division of University. DVCA is responsible for all matters involving foundation, undergraduate and postgraduate academic studies.

5.4 Deputy Vice Chancellor, Research and InnovationThe Deputy Vice Chancellor, Research and Innovation (DVCRI), leads the Research & Development and Consultancy Division. DVCRI is responsible for all matters involving research, development and consultancy.

5.5 Deputy Vice Chancellor, Student Affairs and AlumniThe Deputy Vice Chancellor, Student Affairs and Alumni (DVCSAA) is responsible for all matters to provide facilities, services and structured programmes to all students to support the university’s aspiration to produce well-rounded graduates.

5.6 DeanThe Dean is a leader in Faculty or Centre for Graduate Studies.

5.7 Chair of DepartmentAChair of Department (COD) is an officer of theUniversity who head of academicdepartment. COD is responsible for managing all academic and administration matters of the department.

5.8 Senior Manager for Centre of Graduate StudiesThe Senior Manager for Centre of Graduate Studies is responsible in managing all academic related services, such as the academic facilities, laboratories, timetabling of courses offered and development of education technology.

5.9 LecturerA lecturer is a person assigned by the respective Chair of Department to manage a certain course, who is responsible in delivering course materials, supervising students’ projects and evaluating students’ achievements.

5.10 TutorA tutor is a trainee lecturer/a postgraduate student/any individual assigned by the respective Chair of Department to assist a lecturer in managing a certain course, who is responsible in managing and evaluating tutorials for a particular course.

5.11 Laboratory DemonstratorA demonstrator is a trainee lecturer/a postgraduate student/any individual assigned by the respective Chair of Department to assist a lecturer in conducting laboratory work/practical training. A demonstrator is responsible in demonstrating the usage of laboratory or computer equipment and evaluating laboratory reports and assignments.

5.12 StudentA student is an individual who enrols for any academic programme at the University.

2ACADEMIC GUIDE

1.0 ACADEMICUTPoffersmasterdegreeandPhDdegreeinvariousfieldsinengineering,technologyand management. Courses offered in two modes - coursework and research. The program under coursework, it is compulsory for students attending and passing courses withspecificcredithours,andcarryoutaresearchreport.Theprogramunderresearchmode, students conduct full research to carry out a dissertation, publish their articles and pass viva voce for graduation.

1.1 ACADEMIC TERMS

1.1.1 ProgrammeProgramme refers to the approved curriculum offered and conducted by the University.

1.1.2 Course

A course is a subject that carries a unique code and a number of credit hour.

1.1.3 SemesterA semester is study period within a year of study.

1.1.3.1 Coursework A semester for coursework programme is about four (4) months and normally starts in January, May and September.

1.1.3.2 Research

A semester for research programme is about six (6) months and normally starts in January and July.

1.1.4 ModulesThe detail of code, credit hours, syllabus and the coursework occurred.

1.1.5 Candidacy Period of StudyA student is allowed to register for semester courses and must complete their study within the subscribed candidacy period of study.

1.1.6 CurriculumCurriculum comprises of courses and other activities that are compulsory for students, as determined by the University.


1.1.7 Credit HoursA credit hour is a weightage given to a course based on the number of hours per week of lectures, tutorials, research work or laboratory work.

1.1.8 Core Specialisation CoursesCore Specialisation Courses is a group of courses offered by the respective programme for their students to choose in the area of specialisation that they are interested to pursue at the end of their studies. The courses taken shall contribute to the overall programme structure.

1.1.9 DissertationA dissertation is a writing project for the purpose of assessment derived from literary readings, research using a methodology and sampling to obtain data that can answer all the hypothesis.

1.1.10 TranscriptA transcript is a complete record of a student’s particulars and academic performance.

1.2 MODES OF DELIVERY

1.2.1 SupervisoryA lecturer acts as a facilitator when supervising students’ project.

1.2.2 Lectures and Tutorials1. A lecture is an oral course presentation conducted by a lecturer.2. A tutorial is an oral course presentation conducted by a tutor or lecturer to

complement the lectures and to enhance the students’ understanding of the subject matter.

1.2.3 Laboratory WorkLaboratory work is a practical approach to enable students to gain practical experience.

1.2.4 Student Research AttachmentResearch attachment is a collaboration between the University and other universities or research institute. This collaboration provides the research opportunities for the students to enhance the research experience as well as create a linkage between two research bodies.

1.2.5 E-Learning/Open and Distance Learning (ODL)E-Learning is an online learning method whereby students can access their course materials via the web.

1.2.6 Adjunct Lecturer/ProfessorAn adjunct lecturer/professor is an industrial expert appointed by the University to deliver lectures on topics related to the course content.


1.3 FINAL ASSESSMENT

1.3.1 ExaminerAnexaminerisalectureroranappointedqualifiedperson(internal/external)conducting academic assessment.

1.3.2 InvigilatorAninvigilatorisaqualifiedindividualappointedbytheUniversitytoinvigilatea particular examination.

1.3.3 GradeA grade is an assessment in a form of a letter signifying a student’s performance in a particular course.

1.3.4 Grade PointsA grade point is the point given to a course based on the grade obtained multiplied by the credit hours allocated to it.

1.3.5 Grade Point Average (GPA)A GPA obtained by a student at the end of a semester is calculated as follow:

GPA =Total of Grade Points Scored in the Semester

Total of Credit Hours Taken in the Same Semester

1.3.6 Cumulative Grade Point Average (CGPA)A CGPA is the grade point average obtained by a student based on all courses he/she has completed to date. The calculation is based on the following formula:

CGPA =Total of Grade Points Scored to Date

Total of Credit Hours Taken to Date

1.3.7 Final ExaminationFinal Examination is a compulsory component to be given to students who have registered for non-project based course(s). It is compulsory for students toattendthefinalexamination,failingwhich;thestudentswillbegivenan‘F’grade.

1.3.8 Incomplete GradeThe Incomplete grade will be given to a student who is not able to sit for the final examination or to complete a course due to reasons accepted by theUniversity.

1.1.9 Course Repeating Student who failed or not achieved the passing grade need to register for the course and sit for exam until succed with the pass grade before graduation or conducts research.

1.1.10 Course Re-sitA student with an Incomplete Grade (I) will be given an opportunity to re-sit the finalexamination.


1.1.11 Viva Voce ExaminationViva voce is an oral examination where the postgraduate student presents and defends their research thesis to selected examiners comprise of internal examiner, external examiner and chairman.

1.1.12 Completion of StudyStudent must fulfil all of the graduation requirements as specified by theprogramme and approved by the Senate for completion of study.

2.0 ACADEMIC PERFORMANCEA student’s academic standing is determined by the student’s academic performance for the particular semester. However, a student’s registration may be affected if any kinds of misconduct including cheating and plagiarism have been committed. The University considers all academic misconducts seriously as they affect the integrity of the University’s academic evaluation process.

2.1 Academic Misconduct

Academic misconduct includes cheating and plagiarism. Cheating implies dishonesty in fulfilling academic requirements. Some examples of cheating include copying,allowing other students to copy outside or during an examination. Plagiarism may involve presenting another person’s work, opinion or term as one’s own without proper acknowledgement, be it printed or electronic materials such as books, magazines, thesis or projects. If foundguilty, thestudentwillbegivenan ‘F’grade for thesaidcourseandmaybesuspended for a period of time or dismissed or any other penalty deemed necessary by the University.

2.2 Satisfactory PerformanceA student’s performance is considered satisfactory if he/she obtains a GPA and CGPA of 3.00 and above for Master by Coursework programme or obtain 65% and above for postgraduate by Research programme. If a student’s result is unsatisfactory, he/she will be placed on probation or dismissed from UTP.

2.2.1 PassStudent who obtains GPA between 3.00 and 4.00 for Master by Coursework Programme or obtain 65% and above for postgraduate by Research Programme.

2.2.2 Academic ProbationA student may be put on academic probation if he/she obtains a GPA or CGPA of 2.99 and below for any semester for Master by Coursework programme and if he/she obtains 64.99 % and below for Postgraduate by Research programme.


2.2.3 Academic DismissalA student will be dismissed under the following conditions: 1. Fail to complete the semester registration within the registration period.2. Fail to complete the Research Proposal Defense within given duration.3. Failtosubmitfinalhardboundthesiswithinstipulatedtime.4. Obtain 64.99% and below in the second attempt of Research Proposal

Defense.5. Obtain 64.99% in two (2) consecutive semesters in semester assessment.6. Obtain GPA or CGPA 2.99 and below in two (2) consecutive semesters.7. Obtain GPA or CGPA below than 2.50.8. Exceed the maximum duration of candidacy.

All decision on academic dismissal is at the discretion of the UEC & Senate.

2.3 Appeals for ReinstatementStudents under academic dismissal may appeal for reinstatement. The student is required to submit an appeal in writing to the Registry within one (1) week after the examination results are announced.

3.0 ACADEMIC ADMINISTRATIONEach student is required to register for every course taken up during the registration period and according to the number of credit hours allowed.

3.1 Change of Programme, Change of Study Mode and Deferment of Studies

3.1.1 Change of ProgrammeStudents may apply for a change of study mode upon the recommendation from the supervisor, endorsement from the Chair of Department and subject to approval from the Registrar, UTP.

3.1.2 Change of Study ModeStudents may apply for a change of study mode upon the recommendation from the supervisor, endorsement from the Chair of Department and subject to approval from the Registrar, UTP. (*International students are not allowed to study in part time mode unless the student has a valid Malaysian employment pass)

3.1.3 Deferment of StudiesDeferment of studies may be given for a maximum of two (2) semesters, either consecutive or otherwise throughout the candidacy period. 1. Students who are permitted to defer on medical grounds or valid reason

with supporting evidence. 2. All applications must be in written to the Registrar, UTP for approval.The deferred semester(s) is not considered as part of the candidacy period.


3.2 Semester RegistrationStudents are required to register during the prescribed registration period and comply withthecredithourrequirement.Studentswhofailedtoregisterafterweekfive(5)canbe barred from continuing their study for that particular semester.

Students with outstanding dues (Financial or GA Hours) may not be allowed to register for the new semester.

(*International students must have a valid visa for semester registration.) 3.2.1 Conditional Admission

Studentswith conditional admissiondue tonon-fulfilment of anyadmissionrequirementsshallbeplacedunder theProvisionalstatusuntilsatisfied theprescribed conditions.

3.2.2 Late RegistrationStudents who fail to register on the prescribed date must apply in writing to theRegistrationUnitofRegistrybeforeweekfive(5)subjecttothefollowingconsequences: 1. Late registration penalty will be imposed2. Allowance for GRA and GA recipients will be suspended3. Will not be allowed to undertake assessment (RPD, RCS Symposium,

Viva voce),4. Visa cancellation for international students

3.2.3 Academic Dismissal

Students who fails to register in any particular semester without reason will be automatically dismissed.

3.3 Add/Drop/Withdrawal of Courses

3.3.1 Add/DropStudents are allowed to add/drop courses within the first two (2) week ofsemester registration.

3.3.2 Withdrawal 3.3.2.1 Course Withdrawal

Students are allowed to withdraw from the courses latest by week eight (8). The course fee however, shall not be refunded.

3.3.2.2 Withdrawal from ExaminationStudents who have registered for courses but are unable to sit for the examination due to unavoidable circumstances may apply for withdrawal from the examination, subject to recommendation from the Chair of Department and approval by the Dean of Centre of Graduate Studies.

If the withdrawal is due to an illness or injury, the student must submit a medical certificateoralettercertifiedbytheUTP’spaneldoctor.Uponapproval,thestudent will be given an INCOMPLETE status and the student is required to repeat that particular course when it is next offered.


3.4 Appeal for Reinstatement/ReadmissionAn appeal for reinstatement/readmission is an application by a student who has been placed under dismissal status to continue study at the University.

The Academic Appeal Committee shall decide to reject or to grant for reinstatement or readmission. Reinstatement refers to the decision to continue study in the same programme whereas readmission refers to the decision to continue study in another programme.

3.5 Suspension PeriodA suspension period is a period in which a student is suspended from being a student of UTP due to disciplinary causes. The suspension period will be considered as part of the duration of study at UTP.

3.6 AttendanceThe minimum attendance requirement is eighty percent (80%) for each course.

3.6.1 Coursework ModeStudentswhofailtofulfilthisrequirementmaybebarredfromsittingforthefinalexamination.

3.6.2 Research ModeStudentswhofailedtofulfiltheattendancerequirementmayleadtoallowancesuspended and barred from registration.

(*For International students, application for student visa renewal may not be supported.)

3.7 Visa Application and RenewalAll international students must have valid student visa until completion of study (Senate Approval). For detailed information, the students may refer to the guideline from International Student Management Unit (ISMU).

3.8 Student ClearanceA student who has been approved for graduation, is required to submit the completed Clearance Form to Admission Unit, Registry. Failure to submit the form may result in action to be taken against the student.

(*International students are required to obtain release from ISMU on immigration matters within one (1) month after completion of study or before leaving Malaysia as per requirement from the Malaysian Immigration Department.)

3.9 Final Transcript and DegreeTheUniversityreservestherighttowithholdastudent’sfinaltranscriptordegreeifthestudent;1. DoesnotsubmitthedulycompletedClearanceFormtotheRegistrarOfficebefore

leavingtheuniversityaftercompletingtheirstudy;2. HasanyoutstandingfeestobepaidtotheUniversity;3. Does not comply with any other conditions imposed by the University.


4.0 ACADEMIC GRADUATION REQUIREMENTSIn order to graduate, students must complete a few courses and publication as required by the University including submission of final hardbound thesis for research modestudents.

4.1 Research Methodology CoursesResearch methodology is a compulsory course for all postgraduate students. Students are required to complete and pass the course before conducting the research.

UTP offers three (3) types of research methodology courses:

Table 1: Types of Research MethodologyCourse Code Course Name Credit

hours Programmes

SNB5032 Research Methodology 2 All Engineering, Science and Technology programmes

RAM5013Research Methodology in Social Science and Management Science

3 All Management and Humanities programmes

GAM5402 Business Research Methodology 2 MBA in Energy Management

4.1.1 SNB5032 - Research Methodology 4.1.1.1 Objectives

The objective of this course is to introduce the basic concepts and methods of scientificresearch.Thestudentswillbeguidedonissuessuchaspreparationof technical papers, preparation of thesis/dissertation, intellectual properties, ethical principles, research management and research planning inclusive of the preparation of a research proposal.

4.1.1.2 Learning OutcomesBy the end of the course, students are able to understand the research process includingtheidentificationofatopicandsupervisor,preparationofresearchproposalandfinalresearchreport.Studentwillhavesufficientunderstandingof research management, assessment and planning and also research ethics and intellectual property rights. Students will have basic understanding of data collection analysis that may be used in their research methodology.

4.1.1.3 SynopsisSeries of seminars on topics related to research preparations: manage and plan research activities, think creatively, setup experimental/model for theory verification,preparetocommercializeresearch,prepareresearchreportandcommunicate research output effectively.


4.1.1.4 Course Content

Table 2: Types of Course Content for SNB5032Module Description

Module 1 Philosophy and Overview of Research

Module 2 Research Proposal and Literature Review

Module 3 Data Collection and Analysis

Module 4 Research Management, Assessment and Planning

Module 5 Health Safety Environments (HSE)

Module 6 Research Ethic and Intellectual Property Right

4.1.1.5 FeeRegistration fee is RM 1500.00. The course fee waiver under GA, GRA & TFA Scheme will only be applicable once.

4.1.1.6 Passing RequirementThe passing requirement will be based on Table 1 below:

Table 3: SNB 5032 Passing RequirementResult Attendance Assessments Remark

Pass 80 % and above and 65% and above

Fail Less than 80% or Less than 65% Repeat all modules and/orRe-sit the assessment

Any reason for non-attendance must be informed in writing to the Dean, Centre for Graduate Studies (CGS) within 1 week after the course has ended.

4.1.2 RAM5013 - Research Methodology in Social Science & Management Science

4.1.2.1 General InformationThis course is only for Social Science and Management programme (PhD & MPhil) and Humanities programme (PhD & MPhil)

4.1.2.2 ObjectivesThe primary aim of this course is to provide students with the necessary exposure to the process of research, critical analysis of research, and special problems and issues in social science methodology along with the essential skills and knowledge to conduct postgraduate level research in the social and management sciences.


4.1.2.3 Learning OutcomesBy the end of the course, students are able to:1. Conduct an effective literature search including the identification of,

access to and use of a variety of secondary sources (e.g. books, journals, databases, websites etc.)

2. Recognise and utilize appropriate strategies for carrying out qualitative and / or quantitative research.

3. Produce an initial design for a research project and proposal. 4. Apply the appropriate methods to analyse primary and / or secondary data.5. Present research results via both written and oral reports.

4.1.2.4 SynopsisThis course is designed to introduce students to the essential concepts and methods of doing postgraduate research in management and social sciences encompassing the understanding and application of appropriate research designs, data analysis and report writing.


Table 4: Types of Course Content for RAM5013Module Description

Module 1 Fundamentals of research

Module 2 Qualitative methods in research

Module 3 Quantitative methods in research

4.1.2.6 FeeRegistration fee is RM 1 500.00. The course fee waiver under GA, GRA & TFA Scheme will only be applicable once.

4.1.2.7 Passing RequirementThe passing requirement will be based on Table 5 below: Table 5: RAM 5013 Passing RequirementResult Attendance Assessments Remark

Pass 80 % and above and 65% and above

Fail Less than 80% or Less than 65% Repeat all modules and/orRe-sit the assessment

Any reason for non-attendance must be informed in writing to the Dean, Centre for Graduate Studies (CGS) within 1 week after the course has ended.


4.1.3 GAM5402 - Business Research Methodology

4.1.3.1 General InformationThis course is only for MBA in Energy Management programme.

4.1.3.2 ObjectivesTo provide students with the opportunity to understand research method and analysis skills in a real business environment. The module provides students with the theoretical, practical and relevant concepts and techniques of business and management research that support decision making (including methods for presenting and analysing data). It is designed in such way that it enables students to learn how to write a research proposal and how to design, conduct, and evaluate research studies.

4.1.3.3 Learning OutcomesBy the end of the course, students are able to:1. Apply appropriate research method and analysis for specific research

objective and purpose in business setting.2. Formulate research questions and hypotheses.3. Generate quantitative methods of statistical analysis in decision-making

processes. 4.1.3.4 Synopsis

This module aims to extend and deepen students’ understanding on the different research designs and methodologies to prepare students for their own research projects in their business discipline. This module will assist students in identifying, discussing and formulating a research problem, selecting and applying appropriate research approaches and methods of inquiry and presenting their results. This module provides a learning curve for the MBA students to propose real value to the participating companies byapplyingthevarious‘tools’andskillslearnedintheclassroomtoimproveidentifiedbusinessoperations.


Table 6: Types of Course Content for GAM5402Module Description

Module 1 Introduction to business research and process

Module 2 Quantitative research design, methods and instruments

Module 3 Constructs, scale, measurement and hypothesis development

Module 4 Multivariate data analysis and hypothesis testing

Module 5 Labandfieldwork

4.1.3.6 FeeRegistration fee is RM1550.00. The course fee waiver under GA, GRA & TFA Scheme will only be applicable once.

4.1.3.7 Passing RequirementThe minimum pass mark is 65%.


4.1.4 ExemptionTheappealforcourseexemptionmustbeinwrittenandsubmittedwithcertifiedcopy of students’ academic transcript or any related document(s) to:

Registrar,RegistrarOffice,Level 1, Block F,Universiti Teknologi PETRONAS.

4.2 Publication Requirement (Research Mode Only)

4.2.1 IntroductionAll MSc/MPhil and PhD candidate by research programme must present the proof submission and acceptance journal articles based on research conducted during their candidature prior to graduation as follows:

Table 7: Types of Publication RequirementLevel of Study Number of Publication

Doctor of Philosophy

1. One (1) article accepted in journals indexed by ISI/ERA

2. One (1) article accepted in journals indexed by SCOPUS

3. One (1) article accepted in conference proceeding

OR

1. Two (2) articles accepted in journals indexed by ISI/ERA

2. One (1) article accepted in conference proceeding

Master One (1) article accepted in journals indexed by ISI/SCOPUS

(Disclaimer: This new publication requirement will be effective for January 2018 intake onwards.)

Table 8: The Eligibility of Allocation for Conferences ExpensesItem Amount

Travelling1. Flight Ticket: RM300.00 (return) subject to South-East Asia

regiononly;2. Other Public Transport (Bus, Ferry, Taxi, Train): As per receipt

Meal Allowance RM 20.00 per day (Subject to the number of conference’s day/s)

Accomodation Allowance RM 80.00 per night (Subject to the number of conference’s day/s)

Conference Fee Maximum RM 3,000.00 per conference


4.2.2 Submission for PublicationsThe process for submission of paper publication is as per Standard Operation Procedure (SOP). (Appendix 1)

4.2.3 Entitlement for Paper PublicationCentre for Graduate Studies may allocate Full Time Research student to publish their research work during their candidacy. The entitlement of paper publication is maximum RM 3,000.00 per publication which limit to the number/s of publication requirement as per Table 7.

4.2.4 Process Flow for Publication FeeThe process for payment of paper publication fee is as per Standard Operation Procedure (SOP).

4.3 Prerequisite CourseEvery postgraduate student are compulsory to enroll certain courses offered by University.

4.4 Fee Policy1. Students tuition fees shall be the responsibility of the student themselves whether

sponsoredbysponsoringbody,underuniversityfinancialassistantshipschemeetc.In theevent,sponsorsarenotable topayfor therequiredfees;anyoutstandingamount shall be borne by the student. The fees amount will depend on the approved rate published by UTP and UTP reserves the right to revise the tuition fee as and when deemed appropriate.

2. Student accepted to pursue for postgraduate studies in UTP is required to pay the stipulated fees upon registration.

3. It shall be a condition of registration that the student have made adequate arrangements for the payment of tuition fees and for maintenance during the period of study at the University.

4. Letter of sponsorship must be produce during registration.5. Candidates responsible to provide all the required information as may be necessary

for the University to secure payment from the body concerned.6. Studentswho have no sponsorswill be classified as self-supporting andwill be

responsible for the payment of their fees.7. The rate of fees to be charged is determined by UTP from time to time.8. The delays in the payments of fees, whether by students themselves or by a grant-

awarding body or other sponsor, and where those students cannot show reasonable cause and give a satisfactory assurance as to payment, they may be excluded from further study in the University.

Note: Failure to comply with any of the above, a candidate may not be allowed to undertake any of the required graduate such as semester assessments, Research Proposal Defence (RPD), Research Completion Seminar (RCS) and viva voce examination, barred from pre-registration, sitting for examination, viewing results and restriction to any university’s facilities including hostel, information resource Centre and IT facilities, whenever deemed appropriate.

3RESEARCH PROGRAMME

1.0 LIST OF PROGRAMMES

1.1 Master by Research• MSc in Chemical Engineering• MSc in Petroleum Engineering• MSc in Petroleum Geoscience• MSc in Civil Engineering• MSc in Mechanical Engineering• MSc in Electrical & Electronic Engineering• MSc in Information Technology• MSc in Science• M Phil in Management• M Phil in Social Science & Humanities

1.2 PhD by Research• PhD in Chemical Engineering• PhD in Petroleum Engineering• PhD in Petroleum Geoscience• PhD in Civil Engineering• PhD in Mechanical Engineering• PhD in Electrical & Electronic Engineering• PhD in Information Technology• PhD in Social Science & Humanities• PhD in Management• PhD in Science

2.0 CANDIDACY PERIODThe candidacy period for research program starts from the semester of the admission registration to the submission of Soft Bound Thesis. The duration of candidacy for each program is as shown in Table 1:


Table 1: Duration of Candidacy

Type Level Duration of Candidacy Programme

Full-timeMasters Min – 1 year

Max – 3 years PhD/MSc in Chemical EngineeringPhD/MSc in Petroleum EngineeringPhD/MSc in Petroleum GeosciencePhD/MSc in Civil EngineeringPhD/MSc in Mechanical EngineeringPhD/MSc in Electrical & Electronic EngineeringPhD/MSc in Information TechnologyMaster in Science

PhD Min – 2 yearsMax – 5 years

Part-timeMasters Min – 2 years

Max – 6 years

PhD Min – 3 yearsMax - 7½ years

Full-time

PhD

Min – 3 yearMax – 5 years Doctor of Philosophy in Science, Doctor of

Philosophy in Social Science and Humanities, and Doctor of Philosophy in ManagementPart-time Min – 4 years

Max - 7½ years

Full-timeMasters

Min – 2 yearMax – 3 years Master of Philosophy in Social Science and

Humanities, and Master of Philosophy in ManagementPart-time Min – 3 years

Max - 4 years

2.1 Extension of CandidacyA student who requires more than the stipulated maximum period to complete his/her study shall apply for an extension. Appeal for extension can be made to the Centre for Graduate Studies upon recommendation by respective Supervisor or Chair of Department before the candidacy ends. The appeal will be deliberated by the Graduate Studies Committee. The University reserves its right to approve or reject any application for extension.

2.2 Graduate On-Time (GOT)GraduateOn-Time(GOT)isbasedonafixedperiodwhichstartsfromdateofadmissionuntil the date of hardbound thesis submission. The followings are durations for Graduate On-Time (GOT) as shown in Table 2:

Table 2: Criteria of GOT based on MYRA Level GOT DurationPhD 42 Months

MSc/MPhil 24 Months

3.0 COURSE REGISTRATIONStudents requires to register courses offered by programs through online.


4.0 SUPERVISION

4.1 Appointment of SupervisorStudents shall submit application for Supervisor appointment within one (1) month upon registration via online - Application for Appointment/Change of Supervisor (UTP/CGS/005) to ensure smooth study progress. The supervisor’s appointment letter will be issued by the Centre for Graduate Studies (CGS) upon endorsement by the Chair of Department and approval by Dean of CGS. (Appendix III)

4.1.1 Eligibility of Supervisor/ Co-Supervisor/ Field Supervisor1. The supervisor of a postgraduate candidate for Master degree must

possessatleastthefollowingqualifications:• Master degree for main supervisor/co-supervisor • Minimumbachelordegreeand10yearsworkingexperienceforfield/

technical industry practitioner2. The supervisor of a postgraduate candidate for PhD degree must possess

atleastthefollowingqualifications:• PhD for main supervisor/co-supervisor• Minimumbachelordegreeand10yearsworkingexperienceforfield/

technical industry practitioner

4.1.2 Appointment of Supervisor/ Co-Supervisor/ Field SupervisorThe appointed supervisor may nominate a co-supervisor/field supervisor(if necessary) in consultation with Head of Department to assist in the supervision of the candidate. The co-supervisor may be another academician or may be an experienced practitioner whose area of expertise is relevant to the research topic of the candidate. In addition, The Dean of CGS may appoint aco-supervisor/fieldsupervisorasandwhennecessary.(Appendix II)

4.1.3 Application for Change of SupervisorStudent who requires a change from a current supervisor shall submit an online request - Application for Appointment/Change of Supervisor (UTP/CGS/005). (please refer Appendix III)

4.2 Roles and Responsibility Supervisors and Students

4.2.1 IntroductionThe methods used in supervising a postgraduate student may range from one which sees students as apprentices who require close supervision on a continuous basis, to one which sees students as essentially independent researchers who only require periodic guidance. Students normally will become more independent over the period of the research program. However, agreement and regular exchange on research work is important for supervisor andtheirpostgraduatestudentstomaximizethebenefitsoftheirundertakingand to minimize misunderstandings.

It is important for supervisor to assume the leadership role in the overall relationship with postgraduate students. It is also paramount for students to understand that they have a shared responsibility in maintaining open channelsofcommunication,andfindingoutforthemselfwhatmayberequiredto their success, and act accordingly. Having good wisdom of open and timely


communication between supervisors and students is crucial in creating good working relationships.

The understanding of student-supervisor role and responsibility, will create good working relationships across the University as a whole.

4.2.2 Establishing Student-Supervisor RelationshipIt is a requirement that all students by research programme must have a supervisor while doing research work and preparing for their thesis. Students areadvisedtostudyinthefieldofspecializationoftherespectivedepartmentto ensure that expertise exists within the department for their own areas of academic interest.

Sometimestherewillbeunforeseencaseswhenitmaybedifficultorimpossiblefor a student to have a supervisor on the research topic they are engaged in especially if the supervisor decides to leave the university permanently, or the student themselves decides to change the research topic or wish to change the supervisor. In such cases, students, department and the Dean, Centre for Graduate Studies have to work together to do what they can to ensure continuous supervision for students.

4.2.3 Expectations on Students

4.2.3.1 Intellectual ScopeA student undertaking a master’s degree by thesis must demonstrate that he/she is competent in research design and able to execute a substantial piece of research.ForPhD,thestudentmustbeabletomakeasignificantcontributionof a scholarly nature which is recognized as such by peers in the discipline in general.

4.2.3.2 Originality of Research WorkBoth PhD and Master thesis are expected to be of original contributions within the discipline concerned.

4.2.3.3 Incoming Student’s BackgroundIncoming master’s students are expected to have the required minimum qualification,someresearchskillstoenablethemtolearnhowtodesignandexecuteresearchintheirchosenfield.

Incoming PhD students should demonstrate that they are able to carry out substantial, original research and that they have the appropriate background toenablethemtomakeasignificantcontributiontoknowledgeandbecomeindependent researchers in their own right.

4.2.3.4 Nature of SupervisionThesis supervision for master’s students tends to provide more in terms of thedefinitionanddesignof theundertaking than inPhDprograms.PhDsupervision tends to expect more self-direction and critical thought in research undertakings than does the master’s program.


4.2.3.5 Research Topics and SpecializationThe research topic in which a student undertakes should correspond with the expertise of the appointed supervisor/co-supervisor available in the respective department.

The issue of intellectual property varies depending on the discipline, types of funding, and other such related matters. The overall guiding principle which should be considered in matters of intellectual property is that ownership and recognition of contribution should commensurate with intellectual leadership, actual and active involvement, self-reliance and innovation in the research undertaking.

All published works, including dissertations which are copyrighted by students which become part of the scholarly domain are governed by the general rules of copyright. This applies to thesis written in the context of contract research as in other areas. It is of considerable importance that supervisors/co-supervisors and students be acquainted with the copyright provision of fair dealing which allows for use of public works for personal use, research, criticism, etc.

4.2.4 Student’s Roles and ResponsibilitiesThe followings are some of the roles and responsibilities of a postgraduate candidate:1. Students should inform themselves concerning any policies, processes,

procedures, rules & regulations and standards as prescribed by the CGS, faculty, department and University.

2. Students are responsible for presenting in symposium and submitting research progress work and meeting contractual obligations in a timely fashion and for maintaining regular contact and meeting with supervisors.

3. Students shall maintain and record their research progress in their researchlogbookandsubmitthelogbookfortheirsupervisor’sverificationandvalidationontheresearchworkdata,findingandprogressduringtheirconsultation/meetings with their supervisors.

4. Should students have a reasoned ground for changing supervisor, they should submit a request using the prescribe form that is available at the CGS. The student must also state the reason/s for the changing of supervisor.

5. Students have the responsibility to act in a manner which conforms to basic principles of natural justice, academic integrity and professionalism and tomanage inconflictsituationswhichmayarise in the relationshipwith their supervisors.

6. Students should also show initiative and diligence in his/her studies, and must be aware of opportunities tomeet other researchers in the field,attend seminars, meetings and conferences as required.

7. Studentshouldalsotaketheinitiativeinraisingproblemsordifficultiesandshare responsibility for seeking solutions from the supervisor.

8. Students shall adopt at all times, safe working practices relevant to the field of research and adhere to the ethical practices appropriate to thediscipline.

9. Students under the Graduate Assistantship Scheme (GA)/Graduate Research Assistantship Scheme (GRA) are required to undertake a number of academic duties involving tutorials or weekly laboratory


demonstrations. The respective Chair of Department may require the student to perform other additional academic duties under this scheme.

10. Students should submit thesis, or draft publication materials, based on research work, to supervisors before submission for publication or viva voce examination.

11. Student should prepare the thesis for examination, including arranging for typing, proofreading and binding, and where appropriate consulting the Supervisor regarding matters of style and presentation.

12. Student should arrange for the thesis copies to be sent to CGS on time as per agreed schedule.

13. Students should take appropriate action based on comments on the evaluation reports of the examiners.

14. Students should adhere to all notices and directives pertaining to the research work given by the Supervisor, Faculty, department or CGS.

4.2.5 Supervisor’s Roles and Responsibilities1. Supervisors shall oversee the research undertakings of their postgraduate

student in a manner prescribed by CGS and respective departments.2. Supervisors and students should ensure mutually agreeable on their

expectations and supervisors should discuss with the student on the general nature of their working relationship early in the developmental stages of their collaboration.

3. Supervisors should be available to students on a reasonable basis for consultation and discussion of research progress and issues related to research work. During these meetings, supervisor is required to verify the student’slogbooktovalidatethedata/findingsacquiredontheresearchconducted.

4. Supervisor is expected to provide technical assistance, advice and guidance on the nature of research, the choice of the research topic, the planning of the research programme, and the research outcome.

5. Supervisors should provide timely comments on written material submitted by their students and this would include comments on the advisability of submitting thesis for examination.

6. Supervisor shall submit their students’ Research Progress Report/ Symposiumunderhis/hersupervisiontotherelevantofficeasandwhenrequired or as per prescribed schedule by CGS.

7. Supervisors should make appropriate arrangements for students when they go on sabbatical leave or are on extended absence.

8. SupervisorswithstudentsreceivingfinancialassistancesuchasGraduateAssistantship (GA), Graduate Research Assistant (GRA) etc. should make clearonthetermsandconditiononthefinancialassistancereceivedfromthe beginning of the student’s tenure at the university.

9. Supervisors should play an active role in seeking to ensure the availability of basic resources required for the student’s research work and progress.

10. Supervisors must advise students on their obligation to adhere to the existing copyright law or contract in writing and conducting their research work.

11. If a supervisor withdraws from supervising a student, this should be made in writing to the Dean of CGS and to the student.


12. The supervisor has the responsibility to act in a manner which conforms to basic principles of natural justice, academic integrity and professionalism and to act in a similar way in any situation which may arise in the relationship with the student.

13. Students should recommend candidates for the external and internal examiner(s) for endorsement from University Academic Committee (UAC).

5.0 POSTGRADUATE ASSESSMENT AND PROGRESS MONITORINGAll postgraduate students by research mode shall be evaluated on their research progress every semester i.e. January and July semesters. The research progress assessment is to ensure that all graduate students by research mode progress in meeting their agreed research milestone with their supervisors and within their period of candidacy.Three (3) types of monitoring systems to be implemented for candidates are as follows:1. Research Proposal Defence (RPD)

Candidates by research mode must satisfy a panel of assessors before being allowed to proceed with their research work. Candidates must complete their RPD within a given time period.

2. Semester assessment or known as Biannual Postgraduate Conference (BAPC) UTP has implemented the BAPC assessment format for all postgraduate candidates by research mode as its semester assessment. Student will be assessed every semester on their progress report, online submission of paper and oral presentation (symposium) twice in an academic year.

3. Research Completion Seminar (RCS)A PhD candidate must undergo RCS before being allowed to submit their Final Draft Thesis for Viva Voce examination. This is to ensure the quality of the thesis to be submitted and to guide candidates before viva voce examination proper.

5.1 Research Proposal Defence (RPD)

5.1.1 IntroductionA Research Proposal Defense (RPD) is a written description of a proposed scientificresearchtobeconductedwithintheperiodofacandidate’sgraduatestudy. All candidates are required to undertake the RPD within the allocated time given. Candidates are required to present the RPD to a Panel of Evaluators appointed by respective departments. Candidates who are unsuccessful in their RPD are given another opportunity to re-submit their RPD within the allocated time after their first attempt of RPD. Failing this, they may facetermination of candidature.

5.1.2 RPD SubmissionAll candidates are required to submit one (1) copy of the RPD report using the form “Submission for RPD/RCS – UTP/CGS/007” via online within the allocated deadline. The RPD must be endorsed by the candidate’s main supervisor prior to submission. Student will distribute the submitted RPD report to the nominated Panel of Evaluators two (2) weeks prior to the date of the RPD session.


5.1.3 RPD DeadlineCandidate under the research programme mode must undertake the RPD within the stipulated period given below. All candidates will be allowed a maximum of TWO (2) attempts to deliver a successful RPD. Failure to resubmit or unsuccessful RPD within the given period may cause an termination of candidature.

5.1.3.1 Full Time Students

1. Master ProgrammesAllmaster’s candidatesare required to successfully complete their firstRPDwithinthefirstsemesterofregistrationorsix(6)monthsfromdateofregistration.Theunsuccessfulcandidate in thefirstRPDmay-re-submitforthesecondRPDwithinthree(3)monthsfromdateoffirstRPD.Thepanel canonlybechangedunder specificcircumstances (e.g. transfer,retirement), with written approval from the Chair of Department.

2. PhD ProgrammesAllPhDcandidatesarerequiredtosuccessfullycompletetheirfirstRPDwithin the twelve (12) months from date of registration. Candidates who are unsuccessful in their firstRPDmay re-submit for the secondRPDwithin six (6) months from date of first RPD. The panel can only bechanged under specific circumstances (e.g. transfer, retirement), withwritten approval from the Chair of Department.

5.1.3.2 Part Time Students

1. Part Time Master ProgrammesAllmaster’scandidatesare required tosuccessfullycomplete their firstRPDwithinthefirstsemesterofregistrationortwelve(12)monthsfromdateofregistration.CandidateswhoareunsuccessfulinthefirstRPDmayre-submit for the second RPD for the second RPD within six (6) months fromdate of firstRPD. Thepanel can only be changed under specificcircumstances (e.g. transfer, retirement), with written approval from the Chair of Department.

2. Part Time PhD ProgrammesPhD candidates are required to successfully complete their first RPDwithin the twenty-four (24) months from date of registration. Candidates who are unsuccessful in their RPD may re-submit for the second RPD withintwelve(12)monthsfromdateoffirstRPD.Thepanelcanonlybechanged under specific circumstances (e.g. transfer, retirement), withwritten approval from the Chair of Department.

5.1.4 RPD Assessment SessionTheRPD assessment sessionwill be notified to the student by respectivedepartments.However,thestudentmustalsoconfirmwiththedepartmentonthe schedule for his/her RPD assessment session.


5.1.5 RPD Written SubmissionA RPD report must be submitted by students at the end of every semester.

5.1.6 Panel of ExaminersThe Panel of Examiners shall be nominated by the Chair of Department (COD). Themembersmust be selected from related field of the proposedresearch work.

5.1.6.1 Master ProgrammesThe RPD examinors shall consist of a minimum of three (3) members consisting of the chairman (Dean/HOD/Senior Academic Staff with PhD qualificationwith Associate Professor status, the main supervisor and one (1) from within department andmust be from related field of research.ThosewithMasterDegree must at least have 3 years of research experience.

5.1.6.2 PhD ProgrammesThe RPD examinors shall consist of a minimum of four (4) members consisting of the chairman (Dean/HOD/Senior Academic Staff with PhD qualificationand with Associate Professor status), the main supervisor, one (1) Internal Examiner from within Department and one (1) External Examiner from other Department/MOR/Cluster and must be from related field of research withminimumPhDqualification.

5.1.7 Evaluation Process

During the RPD evaluation session, the examiners members shall use the “RESEARCH PROPOSAL DEFENSE (EVALUATION FORM)” – UTP/CGS/52C. After the evaluation session, the Chairman shall submit consolidated evaluation results together with the copy of the student’s RPD report within one (1) week of the evaluation date to:• The department (one (1) copy)• CentreforGraduateStudiesOffice(one(1)copy)

5.2 Biannual Postgraduate Conference

5.2.1 IntroductionStudents by research mode (Full-Time and Part-Time) are to be assessed on their research progress every semester. Beginning Academic Year 2014 postgraduate assessments by research mode will be conducted in January and July semester. (Senate Meeting/2014/msutp84 (1-2014) 23 January 2014). Please refer to the Academic Calendar for Postgraduate by research mode.

The BAPC will enable postgraduate students to gain experience in presenting their research work in a formal conference environment. The assessment of postgraduate students by research mode will be held in conference style.

All postgraduate students are to submit their semester progress report through the prescribed online system and conduct oral presentation during the conference.


5.2.2 Tentative Activities for Biannual Postgraduate Conference (BAPC)5.2.2.1 Activities

1. Semester Registration2. 1stNotificationandInvitationforOnlineSubmissionofSymposiumPaper3. Online System Open for Paper Submission4. 2ndNotificationandInvitationforOnlineSubmissionofSymposiumPaper5. Closing of Online System for Submission of Paper6. Reviewing Submitted Paper by Respective Department7. Biannual Postgraduate Conference

5.2.3 Marking System and Assessment Grading

5.2.3.1 Marking System

Table 3: Type of Marking SystemNo Components Percentage (%)1 Paper Review 202 Presentation 203 Progress marks from supervisor 60

Total 100

5.2.3.2 Assessment GradingBased on the performance, a student is considered to be in any one of the academics standing as described below:

Table 4: Type of Assessment GradingAcademic Status Description

Pass Student who obtains 65% and above

Probation1. Student who obtains below 65%2. Failure to upload conference paper3. Failure to conduct the oral presentation

Dismissal Fail in two (2) consecutive semesters

5.2.4 Exemption from BAPCA PG student under the following academic progress may appeal for exemption from the Semester Assessment by filling the hardcopy form ofSemester Assessment Exemption Form and submit the duly completed form to respective academic department. The following are steps for the appeal:

1. Set and passed the research seminar before the online paper submission dateline,

2. Submitted the Final Draft Thesis for Viva Voce before the online paper submission dateline,

3. Set and completed the viva voce before the online paper submission dateline,


Note:• All PG candidates by research mode (Full-Time and Part-Time) must

submit their online paper submission, progress report and conduct oral presentation during the BAPC every semester.

• No exemption will be given to candidate who is in the process of writing their thesis.

• New intake is exempted by default. 5.2.5 Submission of Online Paper

Please submit a full paper indicating your topic, theoretical framework, research questions or hypotheses, methods, results and conclusions. The full paper should not exceed six (6) pages. Provide your full contact information including name, email, postal addresses, telephone number and academic affiliation for each author. You can download the format for the full paperfrom the IEEE website: http://www/ieee.org/conference_events/conferences/publishing/templates.html

The Online system will be opened for submission (please refer to the BAPC schedule) ONLY to submit your paper based on the respective program via Online system. The instruction on how to submit your paper will be informed to you in circulation email.

Failing to submit within the given time, you may be given the “F” Grade for the semester assessment which may put you under “Academic Probation” or “Academic Dismissal” status.

Please secure the endorsement from your supervisor before you submit the paper to the system and register their names as co-author. Please be advised that the online system will only allow active and registered students to upload their papers. Those who did not register will not be given excess to the system and will not be able to submit the paper and may be given the “Academic Probation” status due to no assessment. Obtaining the “Academic Probation” status may affect many things including the GA/GRA allowance, visa renewal and dismissal.

Note: Please refer to CGS email pertaining to the BAPC instruction

5.3 Research Completion Seminar (RCS)

5.3.1 IntroductionA Research Completion Seminar (RCS) is a process of evaluation on a PhD student’s written report/dissertation which describes the research conducted within the period of PhD candidacy graduate study. PhD candidates are required to undertake an RCS assessment before being allowed to submit their finaldraftthesisandsitforvivavoceexamination.Candidatesarerequiredtopresent RCS to a Panel of Examiners appointed by Dean of Centre for Graduate Studies. Candidates who are successful in their RCS may submit the form via onlineforsubmissionofthefinaldraftthesisforvivavoceexamination(Noticeof Thesis Submission for PhD/MSc candidate – UTP/CGS/006). Candidates whoareunsuccessful intheirfirstRCSmustre-sitforasecondRCSwithinthe allocated time.


5.3.2 RCS SubmissionAll candidates are required to submit RCS report using the form “Submission for RPD/RCS – UTP/CGS/007” via online. The RCS report will be provided to the Panel of Examiners two (2) weeks prior to the date of the RCS session.

5.3.3 RCS Assessment SessionThe notice for RCS assessment session will be sent to the student by Centre forGraduateStudies.However,thestudentmustalsoconfirmwithCentreforGraduate Studies on the schedule for his/her RPD assessment session.

5.3.4 RCS Written SubmissionRCS report in written for shall be submitted by candidates to their supervisor for endorsement before submitting to the COD for approval. The format for RCS report should follow the Thesis Guideline Format.

5.3.5 Evaluation Process

During the RCS evaluation session, the Panel members shall use the “RESEARCH SEMINAR (EVALUATION FORM)” – UTP/CGS/60B. After the evaluation session, the Chairman shall submit consolidated evaluation results to Centre for Graduate Studies. At the end of the RCS session the Panel of Evaluators shall nominate the internal and external examiner for the candidate for the actual viva voce examination using the Nomination of Examiners (UTP/CGS/012) via online form.

5.3.6 Panel of EvaluatorsThe Panel of Evaluators is nominated by the Chair of Department (COD). The membersmustbeselectedfromrelatedfieldoftheproposedresearchwork.

The RCS panel of Examiners shall consist of a minimum of three (3) panel members consisting of chairman (Dean/COD/Senior Academic Staff with PhDqualificationat leastwithAssociateProfessor status), one (1) InternalExaminer from within the Department and one (1) External Examiner from otherdepartmentsandmustbefromrelatedfieldofresearchwithminimumPhDqualification.SupervisorisinvitedasanobservertotheRCSbutnotasa panel member.

5.4 Viva Voce Examination

5.4.1 IntroductionThe viva voce oral examination is compulsory for a Master and Doctoral candidate. It is the most important assessment in deciding whether research work (thesis)hassatisfied thepanelofexaminersand that iseligible tobeoffered a postgraduate degree pending submission of the Final Hardbound Thesis and approval by Senate.

Normally the oral examination will take place at UTP and is conducted by a chairman and at least one external examiner and an internal examiner. The candidate’s supervisor may be present at the oral examination as an observer.


The oral examination is primarily intended to test the candidate’s awareness of thebackgroundof theresearch, thesignificanceof the thesis in thefieldstudied and, especially in the case of the PhD, the extent to which it contributes to existing knowledge. Its aim is to enable the examiners to clarify with the candidate any aspects of the research work which might be unclear in the thesis submitted. The oral examination may also take the form of a general discussion, and/or considered in greater depth in some sections of thesis which particularly interest the examiners, or in which they have found some problemswhichrequireclarification.Theoralexaminationisalsointendedtoassure the examiners that the thesis is the candidate’s own work.

The oral examination is a formal occasion. The examiners may have decided on a result before the oral examination takes place in some cases. However, thestudent’scapacitytodealadequatelywiththepointsraisedmightinfluencetheirfinaldecision.

PhD candidate MUST PASS RCS prior to the process of viva voce examination. TheVivaVoceExaminationprocessflowisavailableintheonlineformportal(Viva Voce Kit).

5.4.2 Thesis Submission1. A candidate must submit notice of submission of thesis via online form to

theCentreforGraduateStudiesusingthespecifiedformatleastthree(3)monthsbeforethesubmissionofthefinaldraftthesis.• Notice of Thesis Submission for PhD/MSc Candidate - (UTP/CGS/006)

2. The thesis submitted must follow the prescribed UTP Thesis Guideline.3. A PhD thesis must not exceed 100,000 words and a Master thesis must

not exceed 50,000 words. The number of words excludes quotations, translations,footnotesandend-notes,appendices,figuresandillustrations.Candidates who wish to exceed the maximum number of words permitted must have the permission of the University Academic Committee (UAC) through the Supervisor at least three (3) months before the thesis submission.

4. The thesis must be written in the English language. The abstracts must be in English and Bahasa Melayu translation of the abstract must be included.

5. Five(5)copiesoftheFinalDraftThesiscertifiedbythesupervisormustbe submitted (soft bound) to Centre for Graduate Studies for viva voce examination.

6. In the preparation of the thesis, the candidate must always refer to the latest guidelinesonUniversitythesisformatandotherspecificrequirementsasdecided by the University Academic Committee.

7. A candidate is not allowed to submit a thesis or part thereof which has been prepared for another degree without explicit written permission.

8. Thesis submitted to UTP whether successful or not will become the property of UTP. UTP reserves the right to make copies of the thesis in whole or in part.

9. A candidate must submit their thesis for viva voce examination before the end of their candidature.


5.4.3 Examiners for Thesis Evaluation

5.4.3.1 Panel Of Examiners1. The Panel of Examiners for Master candidate shall consist the following:

• One (1) external examiner, and • One (1) internal examiner, who is not the Supervisor or Co-Supervisor

of the candidate• Chairman

2. The Panel of Examiners for PhD candidate shall consist the following:• Two (2) external examiners, and • One (1) internal examiner, who is not the Supervisor or Co-Supervisor

of the candidate• Chairman

5.4.4 General Guidelines on The Selection of The External Thesis Examiners

5.4.4.1 Master Candidate1. The examiner from academia should at least possess PhD degree from

recognized higher education institutes. The examiner (from industry) should at least possess Master degree from recognized higher education institutes.

2. Priority is given to the examiner with an Associate Professorial position.3. The examiner is an expert in the research area with a minimum of 3 years’

experience.• Project leader/Management role.• Publications.

4. The examiner has at least 1 Master student who has graduated under his/her supervision. (Applicable for examiner from university).

5. The examiner as experienced as external examiner for Master viva voce.

5.4.4.2 PhD Candidate1. The examiner should at least possess PhD degree from recognized higher

education institutes.2. Priority is given to the examiner with a Professorial Position.3. The examiner is an expert in the research area with a minimum of 10

years’ experience.• Project leader/Management role• Publications.

4. The examiner has at least 1 PhD student who has graduated under his/her supervision. (Applicable for examiner from university).

5. The examiner has experience as external examiner for PhD viva voce.

5.4.5 Duties Of The Examiners1. The appointed examiners are required to:

• Evaluatethethesisofthestudentindependently;• Provide a comprehensive report and point out the syntactic and

semanticerrorsinthethesis;and• Provide an indication of the original contribution made by the

candidate. 2. The examiners are given a maximum of four (4) weeks and six (6) weeks

for Master and PhD respectively to examine the draft thesis.


5.4.6 Panel For Viva Voce Examination1. After the candidate has submitted the corrected thesis, arrangements will

be made for viva voce examination.2. Panel for viva voce examination Committee will consist of the following:

• The Chairman must not have had direct or formal involvement with the project or with the Candidate.

• For a Master Viva Voce, the Chairman shall be at least an Associate Professor /Senior Staff or an Academic Chair of Department at UTP.

• In the case of a PhD degree, the Chairman shall be a Professor/Associate Professor/ Chair of Department or Dean.

• For PhD candidate, at least one (1) External Examiner must be present during the viva voce examination. However, both External Examiners are required to submit thesis’ report prior to the viva voce session.

• Internal Examiner.The viva voce examination will consist of public presentation as well as closed door defense session. The presentation is open for public while the closed-door session is limited to only the panel of examiners. However, the chairman reserves the right to allow the supervisor and selected members to be in attendance as observers.

5.4.7 Report From The Panel Of ExaminersAfter receiving the Examiners’ reports and reviewing the performance of the candidate in the viva voce examinations, the panel of Examiners shall recommend one of the following:1. The candidate to be conferred the Degree subject to minimal corrections

inspelling,grammarandsyntaxonly.Student tosubmit thefinal thesiswithin 1 month.

2. The candidate be conferred theDegree subject tominormodifications(reformatting of chapters, revision of literature, improvement in the declaration of research objectives or statements, insertion of missing references, amendment of inaccurately cited reference, and other minor improvements including language) to the Thesis. Student is given up to 3 monthstosubmitthefinalthesis.

3. Thecandidateistomakemodificationsandcorrectionswhicharenotminorin nature (extensive revision of the entire thesis, major improvement in description methodology, statistical re-analysis of research data, removal of chapter(s), re-discussion of the result, improvements in language, excluding additional experimental works and/or data collection) to the Thesis. Student is given minimum 3 months and up to 6 months to submit thefinalthesis.

4. The candidate is to re-submit the Thesis to be re-examined after the candidate has made major modifications and corrections (extensiverewriting to the entire Thesis and require to include additional experimental work, data collection and discussion of obtained new result from the further studies). The candidate may require* to attend the oral (viva voce) examination again.

(*Examiners will determine the viva voce examination upon evaluation on the corrected thesis). Student is given minimum 6 months and up to 12 monthstosubmitthethesisforvivavoce/finalthesis,or

5. The candidate is not to be conferred the Degree and not allowed to resubmit the Thesis for re-examination. The candidate is deemed to have failed.


5.4.8 Submission Of Final Hard Bound ThesisThecandidate is required to submit their final hardbound thesis toCentrefor Graduate Studies within the given period agreed during the viva voce examination. Failing to submit the final hard bound thesis within the givenperiod, the candidate is deemed to have failed in their viva voce examination.

5.4.9 Extension Of Thesis Correction DurationThe candidate may submit their appeal with supporting documents to Centre for Graduate Studies for extension of thesis correction duration. The application will be deliberated and approved by the Graduate Study Committee. Maximum duration for extension of thesis correction duration is three (3) months.

6.0 UPGRADING MASTER TO PHDA supervisor may recommend upgrading a master student to PhD level based on the following criteria:

6.1 EligibilityTo be eligible, a Master’s candidate must meet the following requirements:1. Candidacy less than one year2. Distinctiveresearchprogressreport;and3. Published in SCOPUS/ISI/ERA or indexed journal publication.4. Obtained a minimum CGPA of 3.75 (Distinctive) during your undergraduate studies.

6.2 Application ProcessThe followings are the processes involved for an upgrade:1. The supervisor recommends an upgrade to the Deputy Chair of Department

(Postgraduates), who proposes it to the department.2. If recommended by the department, the COD shall propose an independent

evaluation panel for the purpose of examination/evaluation for the endorsement of the Dean of Centre for Graduate Studies.

3. The student prepares a submission containing an overview of the completed work and the proposed PhD research proposal

4. The evaluation panel shall evaluate the student and submit a collaborative report using the (UTP/PGS/50A) form.

5. The recommendation for the upgrade of level of study is subject to approval of the UTP Senate.

6.3 Members for The Upgrading Panel of AssessorsThe upgrading panel of Assessors shall consist of a minimum of three (3) panel members consisting of the chairman (Dean of Faculty), one (1) from another Department and one (1)expert fromrelatedfieldwithin theDepartment.Membersof thepanelmusthaveaminimumPhDqualificationwith academic standing of anAssociateProfessor andabove.

6.4 Written SubmissionThe candidate shall submit a written report of his/her Masters Research progress report and a PhD research proposal to justify the upgrade to Centre for Graduate Studies. Four copies (including one original copy) for Masters Research progress report and a PhD research proposal shall be submitted together with the upgrading application Form (UTP/CGS/050) to the Centre for Graduate Studies.


6.5 Oral PresentationDuring the evaluation process, the student will be allowed 20 (twenty) minutes of oral presentation to the upgrading panel of assessors and followed by proposal defence. The oral presentation should explore the research undertaken to date and the anticipated future directions of the PhD research work.

6.6 EvaluationThe date for evaluation by the panel of assessors shall be conducted within one (1) month upon submission of the application form to Centre for Graduate Studies.

6.7 Panel of EvaluatorsThe Chairman of the Upgrading Committee shall verify in writing in the form of a collaborative report using the assessment form (Assessment for Upgrading Level of Study from Masters to PhD Assessment (UTP/CGS/50A)) that the candidate:

1. Has in-depth and broad knowledge of research and theories pertaining to issues thatarefundamentaltothefieldofstudy;

2. Has conducted comprehensive, in depth and critically analysed literature review suitable for PhD level research.

3. Has formulated the problem and research hypothesis with clear objective and sound methodology.

4. Has demonstrated novelty in research with publishable results.5. Has presented feasible research plan within the candidacy period.6. The Panel shall submit consolidated a report to recommend for successful conversion

to PhD, or to continue the Master’s program. The upgrading evaluation report shall be submitted to the Centre for Graduate Studies within (1) week of the evaluation date.

7.0 FINANCIAL ASSISTANCE

7.1 Graduate Assistantship Scheme (GA) 7.1.1 Introduction

TheGraduateAssistantship(GA)Schemeisthefinancialassistancegiventodeserving postgraduate students of UTP that is offered in return for conducting research work and/or teaching services and/or academic related services. The GA allocation is limited. Therefore it should be considered as a prestigious award. The scheme is for On-Campus Full Time student by research only.

7.1.2 Categories Of The UTP GA Scheme

7.1.2.1 Category A – Full GA Scheme (GA-A)1. Recipients will receive a monthly stipend allowance and under the Tuition

Fee Assistantship scheme.2. In lieu of the Stipend Allowance received, you are required to perform

twenty-two (22) research days per month and to report the activities to your Supervisor. You are also required to submit the report via online (using the UTP/CGS/002 online form) to claim your monthly Stipend Allowance. Each activity performed must be authorized by your supervisor and to beendorsedbyyourHeadofDepartment.Thedullyfilledformmustbesubmitted before 15th of the month.


3. In lieu of the waived tuition fee you are required to undertake teaching duties as laboratory demonstrator or class tutor for 3 -4 hours per week or at least seventy-one (71) hours per semester (January & July semester) as instructed by your supervisor or your Chair of Department (COD). The activities must also be reported and recorded via online (using the UTP/CGS/002 online form). Duties performed such as marking of students’ test papers, assignments, quizzes, laboratory report etc., shall not be considered as additional GA hours in the workload calculation. Marking of students’ test papers, assignments, quizzes, laboratory report etc., is considered as part teaching duties of being a tutor or demonstrator.

4. Recipients may also be required to work beyond the above required academic related activities or individual research days with no extra allowance.

5. Recipient shall also perform any other duties and/or responsibilities as requested by your supervisor or COD provided that these duties are academic related activities.

7.1.2.2 Category B – Monthly Stipend Allowance Only (GA-B)1. Recipients will receive a monthly stipend allowance2. In lieu of the Stipend Allowance received, you are required to perform

twenty-two (22) research days per month and to report the activities to your Supervisor. You are also required to submit the report via online (using the UTP/CGS/002 online form) to the Centre for Graduate Studies OfficetoclaimyourmonthlyStipendAllowance.Eachactivityperformedmust be authorized by relevant your supervisor and to be endorsed by yourChairofDepartment.Thedullyfilledformmustbesubmittedbefore15th of the month.

3. Recipients will have to pay for the tuition fee.

7.1.2.3 Category C – Tuition Fee Assistantship Only (GA-C)1. In lieu of the waived tuition fee you are required to undertake teaching

duties as laboratory demonstrator or class tutor for 3 -4 hours per week or at least seventy-one (71) hours per semester (January & July semester) as instructed by your supervisor or your Chair of Department (COD). The activities must also be reported and recorded in the report via online (using the UTP/CGS/002 online form). Duties performed such as marking of students’ test papers, assignments, quizzes, laboratory report etc., shall not be considered as additional GA hours in the workload calculation. Marking of students’ test papers, assignments, quizzes, laboratory report etc., is considered as part teaching duties of being a tutor or demonstrator

2. Recipients may also be required to work beyond the above required academic related activities or individual research days with no extra allowance.

3. Recipient shall also perform any other duties and/or responsibilities as requested by your supervisor or COD provided that these duties are academic related activities.

Note:Universiti Teknologi PETRONAS reserves the right to add, amend or make any alterations to the GA terms and conditions as and when necessary. UTP also reserves the right to determine the amount of monthly subsistence allowance given to a GA recipient and shall depend on the availability of the GA fund.


7.1.2 EligibilityEligibility to be a recipient of the UTP GA scheme must:1. Be a registered Malaysian or International student pursing a Masters or a

PhDprogrammebyresearchoncampusatUTP;2. Notreceivinganyotherfinancialsupportorsalary/scholarship/fellowship/

GRA,andshouldnotbeinanytypeofemployment;3. Fulfil all Malaysian immigration rules and regulations for international

students.

7.1.3 GA Spouse PolicyUTP will allow ONLY one GA recipient in a family to be given the GA scheme. Spouse will not be eligible to apply and receive the same scheme. In the event that a recipient is married he/she shall have the duty to inform UTP and UTP shall have the right to terminate either spouse who is receiving the GA scheme.

7.1.4 Duration of Graduate Assistantship Scheme (GA)

Table 5: Duration of GA

Level of Study Maximum Duration for Funding Extension Appeal

Masters Eighteen (18) months Maximum 6 months

PhD Thirty six (36) months Maximum 6 months

Note: Any appeal for extension of GA will be considered on case to case basis.

7.1.5 Stipend Allowance (Monthly Allowance)All research activities shall be recorded and reported in the relevant GA claim form every month.

7.1.6 Termination of AllowanceGA allowance shall be automatically discontinued if the recipients fall in any of the following conditions/status:1. does not satisfy the panel during Research Proposal Defense (RPD) and

failed Research Methodology course.2. on“AcademicProbation”or“AcademicDismissal”;3. withdrawsfromcandidacy;4. placedunderacademicoruniversitysuspension;5. placedunderinvestigation;6. intercalateordeferment;7. underdisciplinaryaction;8. absentwithoutpriorapprovalordismissedbytheUniversity;9. instructed/requested by supervisor/COD/DCGS/GSAC/UAC to discontinue

GAscheme;10. gives misleading or false information for the purpose of securing the GA

scheme;11. two (2) months after a student has completed his/her viva voce.12. any other reasons deemed appropriate by the University.

Note: If in case a student who has fail in Research Methodology paper, he/she need to re-seat the paper. Should student get the “pass” result, the allowance shall be release from the month of getting senate approval.


7.1.7 Roles and Responsibilities of The RecipientThe GA shall be considered a “Prestigious Award” which is given to deserving students with high potential to promote and benefit the University throughresearch and the capability to produce quality publications, patents, products and etc. The expected roles and responsibilities of a GA recipient shall include, but not limited to, the following:1. Adheres to all University rules and regulations. 2. Discusses with the Supervisor the type of help considered most useful and

keeps to an agreed schedule of meetings. 3. Maintains the progress of the work in accordance with the stages agreed

with the Supervisor, including in particular the presentation of any required writtenmaterialinsufficienttimetoallowforcommentsanddiscussionsbefore proceeding to the next stage.

4. Discusses the progress towards, and impediments to maintain the agreed timetable with the Supervisor at regular intervals.

5. Adoptsatalltimes,safeworkingpracticesrelevanttothefieldofresearchand adhere to the ethical practices appropriate to the discipline.

6. Prepares the thesis for examination, including arranging for typing, proofreading and binding, and where appropriate consulting the Supervisor regarding matters of style and presentation.

7. Arranges for the thesis copies to be sent to the CGS on time as per agreed schedule.

8. Takes appropriate action based on comments on the evaluation reports of the examiners.

9. Adheres to all notices and directives pertaining to the research work given by the Supervisor, Programme Head or Dean, CGS. Shows initiative and diligence in his/her studies, and be aware of opportunities to meet other researchers in thefield,attendseminars,meetingsandconferencesasrequired.

10. Takes the initiative in resolving problems or difficulties and shareresponsibility for seeking solutions from the supervisor.

7.1.8 Research Progress Report and Symposium (BAPC)A GA recipient pursuing a postgraduate degree by research (thesis) shall submit their research progress report through online submission and conduct symposium during BAPC every semester. (Please refer to the semester assessment – BAPC). Failure to do so may cause the GA to be withdrawn or terminated.

7.1.9 Research Proposal Defense (RPD)GA recipient must successfully complete their RPD as required/prescribed or the GA will be withdrawn or terminated.

7.1.10 Calculation of GA Workload ClaimThe following are the guidelines for calculating the GA workload:1. Tutorial - As per tutorial hours but a maximum of two (2) hours per session.2. Laboratory Demonstrations - As per laboratory session but a maximum of

three (3) hours per session.3. Preparation of Tutorial & lab demonstrating activities - Not accounted. It is

considered as part of a tutor and demonstrator academic task.


4. Academic Administration Activities (seminars/BAPC/lecture series/etc.)– As agreed and approved by CGS

5. Individual research - Daily research activities based on actual days.6. GA hours claimed shall be based on actual teaching hours (tutorial &

demonstrations). Pre-dumping or carry forward of GA hours is not allowed. GA recipient will be required to pay the required semester tuition fee for the lack of GA hours performed.

7. Subsistence Allowance - Payment will be based on actual attendance days recorded.

7.1.11 Penalties

UTP, at its sole discretion may deduct the allowance of a GA Recipient if:1. The number of hours of teaching duties (tutorials/ Laboratory Demonstration/

Examination Invigilation) is less than seventy-one (71) hours per semester (January & July semester), or

2. The number of research days performed is less than 22 days per month.3. Pre-dumping/carry forward of GA hours is not permitted. The maximum

allowable GA hours per month is 15 hours4. All appeal pertaining to GA matters is at the discretion of Dean CGS/SM

CGS.

7.2 Graduate Research Assistance Scheme (GRA)

7.2.1 Graduate Research Assistantship SchemeThe Graduate Research Assistant (GRA) Scheme is introduced to drive Mission Oriented research in UTP and to support Project Leader (PL) in ensuring delivery of result for their secured research grants. Successful applicants will work under the supervision of the Project Leader (PL) for a postgraduate degree in UTP on full time on campus mode.

7.2.2 Eligibility Requirement1. FulfillsalltheUTPadmissioncriteria.2. Registered as a full time on-campus postgraduate student only.3. Shows research capability in the proposed research project.4. Able to carry out the work to be assigned by the Project Leader (PL).5. Applicant must be appointed as GRA by Universiti Teknologi PETRONAS

(UTP).6. The UTP GRA scheme is open to full time on-campus both local and

international postgraduate candidates.7. Academic requirement for Graduate Research Assistant (GRA) Scheme

Table 6: Type of Eligibility RequirementLevel Local Student International Student

MSc CGPA: minimum 3.00/4.00 and above or 5 years working experience

CGPA: 3.25/4.00 and above or equivalent from renowned university or 5 years working experience

PhD

Coursework: CGPA: 3.00/4.00 and above or equivalent from renowned university or 5 years working experienceResearch: Pass

Coursework: CGPA: 3.50/4.00 and above or equivalent from renowned university or 5 years working experienceResearch: Pass


7.2.3 Appointment Of GRA1. GRAs will be required to sign the Graduate Research Assistant Scheme

AgreementwithUTP;2. Tuition Fee Assistantship (TFA) can be given to the GRAs, based on the

policiessetbytheuniversity;3. Duration of GRA appointment:

Table 7: Appointment of GRA

Level of study

Maximum duration of GRA (Normal scheme)

Maximum Extension(exceeded duration)

MSc 2 years (24 months) 6 monthsPhD 4 years (48 months) 6 months

* The minimum and maximum duration shall be at least three (3) months and twelve (12) months. All applications for GRA appointment must be submitted at least one (1) month for normal GRA scheme and three (3) months for exceeding duration and revision allowance. * GRA Appointment date of appointment is 1st or 16th. Ending appointment date is 15th or end of the month. Backdated appointment OR redundant agreement is not allowed.

The Application For Ga/Gra Requisition/Extension/Reinstatement Form (UTP/CGS/009)mustbecompletedandsubmittedviaonlinewithcertifiedcopyofcandidate’s resume, academic transcript, professional certificates (if any),publications (indexed and impact factor), work experiences, student visa, UTP offer letter and account bank number.

7.2.4 Working HoursGRAs are required to provide the services during the following working hours:

Table 8: Type of Working HoursDay Working Hours Lunch Break

Monday – Thursday 8.00 am – 5.00 pm 1.00 pm – 2.00 pmFriday 8.00 am – 5.00 pm 12.30 pm – 2.30 pm

However, due to the nature of the Project, GRAs may be required to work beyond the above working hours at no extra allowance.

7.2.5 GRAs Duties and Responsibilities

The duties and responsibilities of a GRA may vary according to the nature of the research project in which they participate and the source of the funding. In general, research assistants help PI and PL on research projects and perform such research and related duties that may include:1. Comply with the University’s for Postgraduate Studies rules on

postgraduate studies, and to progress on research activities according to milestones set by the supervisor.

2. Comply with department related assignments such as jobs related to teaching and/or tutoring and/or lab demonstration and/or other administrative tasks as required by the department and Project Leader.


3. Assists with academic research.4. Performs routine clerical duties as instructed, if essential to the research

project activities of the PL/PI or project to which the GRA is assigned.5. Assists in administrative duties such as completing reports for budget,

project expenditures, in the maintenance of project records6. Assists with the editing and preparation of research manuscripts.7. Prepares research project articles, reports, and presentations.8. Assists with duties related to the preparation and production of academic

journals.9. Meets regularly with supervisor to discuss research assignments.10. Performs research work in archives, through interviews, online, or

whatever may be appropriate to assist the PI and PL.11. Prepares literature reviews.12. Gathers and performs analysis of data.13. Prepares materials for submission to agencies and foundations that fund

research.14. Assist PI and PL in project-related correspondence.15. Attends project meetings if requested by PI and PL.16. Assists in the acquisition of research project materials in campus facilities.17. Prepares research project articles, reports, and presentations.

7.2.6 Submission of Monthly Allowance ClaimGRAs are required submit their allowance monthly claim every month. Payment will be processed upon submission of UTP/CGS/002 Form via online by latest 20th of each month. Each activity performed must be authorized by relevant lecturers/supervisor and to be endorsed by the respective MOR director. Incomplete claim form will not be processed.

Graduate Research Assistant (GRA) Scheme Work Service Claim Duration (Payment schedule)

Table 9: GRA Scheme Work Service Duration

No. Monthly Claim Work Payment for the month of Payment

1. 16 December - 15 January January 1st week of February2. 16 January - 15 February February 1st week of March3. 16 February - 15 March March 1st week of April4. 16 March - 15 April April 1st week of May5. 16 April -15 May May 1st week of June6. 16 May - 15 June June 1st week of July7. 16 June - 15 July July 1st week of August8. 16 July - 15 August August 1st week of September9. 16 August - 15 September September 1st week of October

10. 16 September - 15 October October 1st week of November11. 16 October - 15 November November 1st week of December12. 16 November - 15 December December 1st week of January


7.2.7 ConfidentialityGRAs shall keep strictly confidential all data, documents, reports includingbut not limited to information on formulae, process, manufacturing methods, business affairs of ITPSB or the Project, or any other information obtained, collected or worked on during the provision of the Services. GRAs shall not, either during the Contract Period or after its expiration, disclose, utilise, or disseminate any information or data related to the Project or ITPSB to any third party except with prior written approval from ITPSB. PL can if required may request the GRA to sign the Non-Disclosure Agreement from to ensure confidentiality.

7.2.8 Termination of ContractThe GRA appointment may be terminated by the Project Leader (PL) on or beforeexpirationofthespecifiedtimeunderthefollowingconditions:1. incompetenceorneglectofdutyasdeterminedbythePL;2. misconduct;3. delinquencyinacademicworkasdeterminedbythePL;4. chronic physical or mental ailment or condition which impairs and

underminestheGRA’sperformanceofrequiredduties;5. resignation;6. nolongersatisfiesthecriteriaforbeingeligibleforappointment;7. Other employment during the tenure of the Graduate Research

Assistantship.

In addition, a GRA appointment can be automatically discontinued if a recipient under placed any of the following condition/status:1. Does not satisfy the panel during Research Proposal Defense (RPD) and

Research Methodology course.2. On“AcademicProbation”or“AcademicDismissal”;3. withdrawsfromcandidacy;4. placedunderacademicoruniversitysuspension;5. placedunderinvestigation;6. intercalateordeferment;7. absentwithoutpriorapprovalordismissedbytheUniversity;8. instructed/requested by the Project Leader/ MOR Director/ DCGS to

discontinue/suspendGRAallowance;9. gave misleading or false information for the purpose of securing the GRA

scheme;10. Any other reasons deemed appropriate by the University.

• GA hour claimed – shall be based on actual hours as a tutor or demonstrator. GAs are required to complete 71 GA hours every semester. Pre-Dumping/Carry – Forward of GA hours is not allowed.

• GRAs recipient is required to pay semester tuition fee for the lack of GA hours performed.


7.2.9 Guidelines for Supporting Allowance Request Above the Normal Rate

7.2.9.1 Approved GRA allowance

Table 10: Approved GRA Allowance Level of study

GRA Allowance (Normal rate)

GRA Allowance (Special scheme - Above normal rate subject for approval)

MSc RM1, 800.00 per month Up to RM2, 500.00 per monthPhD RM2, 300.00 per month Up to RM3, 900.00 per month

• A Top-Up Scheme allowance is open to all GRAs.• Application submission for the basic allowance and extra allowance

should be submitted at least 1 month and 3 months respectively before the expected date of appointment.

8.0 PLAGIARISM

8.1 Quality and Integrity of the Thesis/DissertationPostgraduate candidates of the Universiti Teknologi PETRONAS (UTP) are expected to produce original academic work. Students are reminded that consistency and accuracy of the submitted thesis/dissertation are important. Careful editing is required in order to ensure that thesis/dissertation is free of errors before submission for thesis/dissertation examination.

8.2 PlagiarismDefinitionofplagiarismbyOxfordDictionariesis“Thepractiseoftakingsomeoneelse’swork or ideas and passing them off as one’s own”. The University does not tolerate plagiarism. Students are recommended to use online web based plagiarism software such as Turnitin to check for the similarity index. Failure to do so will result in disciplinary action as stipulated to Handbook for Misconduct.

Postgraduate candidates of the Universiti Teknologi PETRONAS (UTP) are expected to produce original academic work. Students are reminded that consistency and accuracy of the submitted thesis/dissertation are important. Careful editing is required in order to ensure that thesis/dissertation is free of errors before submission for thesis/dissertation examination.

4COURSEWORK

1.0 INTRODUCTION

1.1 LIST OF PROGRAMMES1. Master of Business Administration in Energy Management2. Master of Science in Asset Management & Maintenance3. Master of Science in Drilling Engineering4. Master of Science in Electronics Systems Engineering5. Master of Science in Offshore Engineering6. Master of Science in Petroleum Engineering7. Master of Science in Petroleum Geosciences8. Master of Science in Process Integration9. Master of Science in Process Safety

2.0 THE DURATION OF CANDIDACY FOR MASTER

Table 1: Type of Duration of Candidacy

TypeDuration of Candidacy

Minimum Maximum

Full-Time One (1) year Three (3) years

Part-Time One (1) year Four (4) yearsNote: This duration of candidacy is only applicable for all programs except Master of Business Administration in Energy Management, Master of Science in Drilling Engineering, Master of Science in Petroleum Geosciences and Master of Science in Offshore Engineering.

2.1 Project & DissertationProject/Dissertation is the final component in the coursework programme. Studentsmust complete project/dissertation within two (2) consecutive semesters. A student who fail to complete the project/dissertation within the stipulated time will be given Fail status.

2.2 Graduation Requirements (Standardize)In order to graduate with Master of [Standard] degree, students are required to:1. Obtain a minimum cumulative grade point average (CGPA) of 3.0, 2. Obtain a minimum grade of D for all modules3. Pass with minimum of B grade for the dissertation/industrial-based project/Capstone

Project.4. Satisfy all requirements as approved by Senate.


3.0 MASTER OF BUSINESS ADMINISTRATION IN ENERGY MANAGEMENT

3.1 IntroductionThe ever-increasing energy demand and the threat of fast depleting energy resources in recent times have caused concerns on sustainable energy supply worldwide. Under these circumstances, the oil, gas and energy industry domestically and globally face with the urgent need for managers and professionals who are not only competent in managing their businesses but who are also visionary leaders capable of driving their energy businesses in a sustainable manner in tandem with challenging environment. The offering of a Master of Business Administration in Energy Management (MBA-EM) programme is expected to become a very apt solution to develop visionary leaders for the energy industry.

The MBA-EM programme is 5 trimesters, 50 credit hours, 20 months programme with a comprehensive curriculum design. The programme comprises 15 modules with nine Business Core modules, five Energy Management Specialisation modules andon Management Consultancy Management sub-module, and Capstone Consultancy Report).

The MBA-EM programme will expose students to a wide range of real work challenges and will enrich student’s learning experiences through case studies. Apart from lectures, the MBA-EM programme offers variety of learning approaches such as seminar, case studies and consultancy based projects-all of which are targeted to authenticate and enhance the classroom learning experiences.

Inordertoprovidegreatervalueandglobalexposuretothestudents,allthefiveenergymanagement specialization modules will be delivered by experienced visiting professors from renowned international universities. Programme is well-suited for top corporate talent candidates, technical managers, engineers, regulators, and professionals serving the energy sector who aim to enhance their business managerial capability.

3.2 Programme Objective1. Business Administration in Energy Management specialists with insights to articulate

complex industry problems and solutions.2. Industry leaders with integrity towards sustainable development through continuous

improvement and innovation for the betterment of society.

3.3 Programme Outcomes1. Demonstrate continuing advanced knowledge in Business Administration in Energy

Management and have the capabilities to further develop or use these in new situations or multi-disciplinary context.

2. Analyze and evaluate critically problems in Business Administration in Energy Management particularly in situations with limited information and to provide solutions through application of appropriate tools and techniques.

3. Appraise available information and research evidence in Business Administration in Energy Management and apply it in the engineering context.

4. Plan and perform research undertakings in Business Administration in Energy Management professionally, ethically and responsibly.\

5. Reporttechnicalfindingsinbothwrittenandoralforms.6. Recognize the needs for continuing professional development in Business

Administration in Energy Management


3.4 Programme Curriculum StructureEachstudentisrequiredtocompletefifteen(15)moduleswithnine(9)businesscoremodules, five (5) energymanagement consultancy projectmodule. The programmecurriculum structure is shown in the below table:

Table 2: MBA-EM Curriculum StructureMBA-EM CURRICULUM STRUCTURE

Category Module Cr Hr

BUSINESS CORE MODULE

1. GAM 5013 Organizational Behaviour 32. GAM 5023 Operating Management 33. GAM 5113 Accounting for Decision Making 34. GAM 5123 Strategic Marketing 35. GAM 5133 Energy Economics 36. GAM 5213 Corporate Finance 37. GAM 5223 Corporate Ethics, Social Responsibility & Governance 3

8. GAM 5313 Competitive Strategy Management 39. GAM 5323 Project Management 3

ENERGY MANAGEMENT SPECIALIZATION

MODULES

10. GAM 5033 Energy Value Chain 311. GAM 5043 Energy Management 312. GAM 5143 Energy Technology & Innovation 313. GAM 5233 Low Carbon Economy and Sustainability 3

14. GAM 5243 Energy Regulations and Policies 3MANAGEMENT

CONSULTANCY PROJECT 15. GAM 5418 Management Consultancy Project 8

Total Credit Hours 50

3.5 Specialization ModulesThe programme offers Energy Management Specialization with the following modules:1. Energy Value Chain2. Energy Management3. Energy Technology and Innovation4. Low Carbon Economy and Sustainability5. Energy Regulations and Policies6. Students have to complete all the above modules in the MBA-EM programme.

3.6 Enrolment ModeStudents may choose to study the MBA in Energy Management programme either on a full-time, on-campus or on weekends, off-campus delivery mode. For the on-campus delivery mode, classes will be conducted in UTP campus at Tronoh, Perak. Whilst for the off-campus mode, classes will be held at UTP teaching facilities in Kuala Lumpur.

3.7 Graduation RequirementsIn order to graduate with MBA in Energy Management degree, students are required to:1. Obtain a CGPA of 3.00 or better2. Pass all modules3. Satisfy all requirements as approved by Senate


3.8 Business Core ModulesCOURSE CODE : GAM 5013COURSE NAME : Organizational Behaviour & Human Resource ManagementNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Associate organizational behavior theories and models to issues that are relevant in

workplace environment.2. Analyze the workplace issues and formulate solutions to address the opportunities and

problems in managing an organization.3. Develop the reasoning and analytical skills in working with people in an organization.4. Predict critical factors to what constitutes successes and failures of organizations in the

dynamically changing workplace environment.

SYNOPSIS:The dynamicity of changes in the current world business environment is affecting all aspects of peoples’ behaviors in organizations. The increasing globalization of business and diversity of the workforce, the proliferation of ethical controversies and scandals in organizations, have enforce reasons for managers today to master the many different aspects of organizational behavior. Thus, it is imperative for managers to be fully equipped and capable of managing people to ensure the perform their jobs, play their roles as effective and ethical member of the organization that will contribute to the success of the organizations.

COURSE CODE : GAM 5023COURSE NAME : Operations ManagementNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describeandexplain thefieldof operationsmanagement inanorganization, the roleof

operations in2. Supporting the business strategy, and process involving operations management and

practicesofoperationsmanagementinindustry;3. Apply theoretical concept to the analysis and evaluation of operations management

situations;4. Apply quantitative analysis such as linear programming and decision trees in analysis and

evaluationofoperationsmanagementsituations;5. Analysis and evaluation by performing simulations using spreadsheet to arrive at feasible

solutionsandrecommendationtotheoperationsmanagementproblems;6. Synthesize and evaluate key operational elements within an organization which contribute

to enhancement the productivity of an organization.

SYNOPSIS:Overview on Operations Management, Forecasting, Designing of Goods and Services, Process Strategy and Capacity Planning, Decision Making Tools, Location Strategies, Layout Strategies, Maintenance and Reliability, Transportation and Assignment problems and Project.


COURSE CODE : GAM 5113COURSE NAME : Accounting for Decision MakingNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Explorethetermsassociatedwithmanagerialaccounting;2. Apply the concepts, rationale, measurements, and reporting models as currently practiced

inmanagerialaccounting;3. Evaluatecompany’sperformancefromthefinancialstatementanalysis;4. Designandinterpretseveraldifferentperformancemeasuresspecifictobusinessoutcomes;5. Propose optimal business solutions by using costing and accounting tools.

SYNOPSIS:This course examines the generation and use of an organization’s financial information fordecision making and encompasses both financial accounting and management accountingtopics. The course concentrates on accounting systems in general, construction and analysis of financialstatements,costing,performancemeasurement,andaccountingfordecisionmaking,planning and control.

COURSE CODE : GAM 5123COURSE NAME : Strategic MarketingNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Applytheknowledgeandskillsofmarketingmanagementintorealmarketplace;2. Plan and organizing firm’s marketing activities in product, place, price and promotions

towardsprofitabilityandsustainablecompetitiveadvantages;3. Analyzeandapplythevariouscomponentsoftheservices;4. Marketingmixforcustomersatisfactions;5. Evaluatetheapplicabilityofstrategicmarketingtoarangeofbusinesscontexts;6. Learnhowtoconducte-commercetoprofitablydelivermorevaluesandbuildingrelationship

towards targeted customers.

SYNOPSIS:Marketing is the core of all business. To outperform the competition requires solid marketing knowledge and precision in marketing decision making. The organization’s positioning and the positioning of its products and services depend on the formulation and implementation of aggressive marketing strategies.

The students will understand how to utilize the elements of the marketing mix (product strategy, pricing, advertising and promotion, and distribution) and enhance problem-solving and decision making abilities in these operational areas of marketing. Students will be given assignments and cases study so that it may develop the ability marketing principles into real situations and also developing effective strategic marketing plans.


COURSE CODE : GAM 5133COURSE NAME : Energy EconomicsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Explaintherelevanteconomicconceptsthatunderlineenergyproductionandenduse;2. Predicthowlocal,regional,andglobalinstitutionsaffectenergymarketsandenergyprices;3. Assess issues in historical and contemporary public policy related to energy economics in

theregionandglobally;4. Evaluate knowledge in energy economics to analyses and make rational decisions to resolve

issuesfacedinspecificenergyindustries.

SYNOPSIS:This course examines economic theories, empirical perspectives, and political economy of energy supply and demand. It discusses various economic aspects of local, national, and global markets for current, emerging and renewable energy sources. This course also examines public policies affecting energy markets including taxation, price regulation and deregulation, energy efficiency,andcontrolofemissions.

COURSE CODE : GAM 5213COURSE NAME : Corporate FinanceNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Evaluate the relevant financial tools used inmaking investment and corporate financing

decisions;2. Appraisetherationaleofmergerandacquisitionactivities;3. Evaluateagencytheory,modelsofcapitalassetpricing,andmarketefficiencytheory;4. Evaluate capital structure policy and cost of capital, dividend policy, investment risk, returns.

SYNOPSIS:Thissubjectemphasizesontheoreticalandpracticalaspectsofcorporatefinanceintheformationofcorporatefinancialpolicies.ThissubjectisalsoanextensiontoFinancialManagement.Specialtopics including capital structure policy and optimum dividend, agency theory, models of capital assetpricing, theextensionofcapitalbudgeting,corporatefinancing, interactionsoffinancialdecisions and investments will also be elaborated.

COURSE CODE : GAM 5223COURSE NAME : Corporate Ethics, Social Responsibility & GovernanceNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Applytheethicalconceptsandprinciplesthatarerelevanttoresolvingbusinessdilemmas;2. Explain the core principles underlying fairness, accountability and transparency in

governanceandhowtheseareappliedincorporationsandmanagement;3. Apply the theories, frameworks & models of ethics, social responsibility and good governance

inmanagingcompaniesinthecompetitivebusinessenvironment;4. Discuss the major issues and developments in business ethics, corporate social responsibility

and good Governance globally and locally.

SYNOPSIS:This subject focus on the concepts and principles of ethics, social responsibility and good governance practices. It provides the business framework that guides social responsibility and good governance practices in ensure business sustainability.It seeks to inspire young leaders to become responsibility citizens, entrepreneurs and business leaders.


COURSE CODE : GAM 5313COURSE NAME : Competitive Strategy ManagementNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Plan the range of decisions implicit in strategic management planning and using a variety of

analyticframeworksformakingsuchdecisions;2. Formulate and explain the process of strategic analysis, strategic choice and strategic

implementationasembodiedinstrategicmanagementprocess;3. Prepare and report upon a strategic analysis of an organization at the business strategy

level;4. Assess theoretical concepts to the analysis and evaluation of strategic situations.

SYNOPSIS:This subject integrates and applies knowledge gained in previous units for the purpose of evaluating complex business problems and formulating policies and strategies for their solutions. It seeks to develop the knowledge of key strategic management strategies.

A conceptual framework for the subject is developed covering both the domestic and global perspectives. Integration of existing knowledge in all areas of business is an important part of the strategic management process.

COURSE CODE : GAM 5323COURSE NAME : Project ManagementNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. SynthesizethedifferentcomponentsinvolvedinEnergyprojectmanagement;2. Design cost effective energy projects based on application of Project Management concepts,

practices&approaches;3. Assemble a range of analytical tools and techniques to identify, evaluate, interpret, implement

andcontrolprojectoutputsfromafinancialperspective;4. Construct and organize the inter-related components of project management in order to

make informed decisions when leading projects.

SYNOPSIS:This course is designed to equip students with the tools and techniques in project management in the energy industry.

This course will give students the opportunity ti understand and apply the components in project management i.e. integration, scope, time, cost, quality, resource, risk, procurement and HSE. Students will also be able to apply relevant tools and techniques to manage energy projects in a cost effective manner.


3.9 Energy Management Specialization ModuleCOURSE CODE : GAM 5033COURSE NAME : Energy Value ChainNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Interpretthefundamentalsofenergyvaluechain;2. Evaluate the various aspects of energy value chain i.e. market fundamentals, trading and

location;3. Assessthetradinginstrumentsandpricingmechanismsforenergyvaluechain;4. Assess the transportation and logistics involved across the energy value chain and their

impact;5. Preparethequalityassuranceacrosstheenergyvaluechain;6. Conclude the emissions trading and its relevance to the conservations of the environment.

SYNOPSIS:The course provides a comprehensive introduction to the supply value chain and trading of energy resources. It also exposes students to the transportation and logistics aspects of the energy value chain. The basics of emissions trading from a market approach are also highlighted in the course.

COURSE CODE : GAM 5043COURSE NAME : Energy ManagementNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Conclude the objectives and functions of, and commercial relationships between companies

andorganizationsintheenergysupplychain;2. Evaluatethesignificanceofmarketinganditsrelatedissuestoenergyorganizations;3. Interpret the broad principles and practical implementation of legal and commercial

obligationsintheenergyindustry;4. Assess the risks associated throughout the energy value chain.

SYNOPSIS:Energy management involves the legal and commercial considerations in the energy industry. Students will be introduced to the nature and functions of energy companies and other organizations involved in the related financial, commercial and contractual activities of theenergy industry.


COURSE CODE : GAM 5243COURSE NAME : Energy Regulations and PoliciesNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Evaluatethedevelopmentofenergysourcesfromahistoricalperspective;2. Interprettheissuesinvolvedinenergylawandpolicy;3. Conclude the sources of international energy law, jurisdiction, responsibility and liability of

subjects;4. Evaluatetheinternationalorganizationsinvestmentsagreements;5. Comparethemajorregionalandinternationaltradelaws;6. Evaluate the arbitration and resolutions of landmark disputes in the energy industry.

SYNOPSIS:The principal aim of this course is to provide an introduction to the main law and policy issues relating to the energy sector in the major energy producing regions and countries. Students will be able to learn the international regulations governing the contracts for the entire energy value chain.

COURSE CODE : GAM 5143COURSE NAME : Energy Technology & InnovationNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Generate the main conceptual frameworks which have shaped research and practice on

energytechnologyandinnovation;2. Evaluatetherolesofmarketsandregulationsinshapinginnovation;3. Propose practical steps for energy companies to adopt and adapt based on innovation

insightsgainedacrosstheglobalenergyindustry;4. Developinnovationideasintheenergyindustrybasedonidentifiedissues/challenges.

SYNOPSIS:Technology and innovation drive the energy industry like no other industry. Hence, it’s only apt that students get insights into the latest development in the energy technology and innovation.

They will understand what drives energy technology and innovation and how they shape the subsequent research and practice. Finally, students will be able to explore emerging technologies and innovations.


COURSE CODE : GAM 5233COURSE NAME : Low Carbon Economy and SustainabilityNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Interpret the implications of climate change to the economies at local, national and

internationallevels;2. Assess the roles that incentives and economics instruments play in achieving desired

economicsgoals;3. Concludethecomplexitiesinvolvedineffectingchangeineconomicsystems;4. Propose the actions companies must take, and the opportunities they offer, in meeting the

economic challenges of climate change.

SYNOPSIS:Sustainability of energy sources is key in ensuring the survival of the energy industry and the environment. Hence, the dire need to promote a low carbon economy across the globe.In the course, students will understand the impact and implications of climate change to the energy industry and the global economy. Students will know what it takes to address the global climate change from the economic perspective.

3.10 Management Consultancy Project (MBA Capstone Project)COURSE CODE : GAM 5416COURSE NAME : Management Consultancy ProjectNO. OF CREDIT : 6 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:Consultancy Management (2 credits)

1. Formulate a consultancy proposal and translate this into a feasible consultancy project2. Influencethestakeholdersandgetbuy-in3. Execute, track and evaluate the consultancy project4. Develop a comprehensive consultancy report5. Defend and present the consultancy findings and recommendations coherently to the

client’s management team

Capstone Consultancy Project (4 credits)Generate quantitative methods of statistical analysis in decision-making processes.

SYNOPSIS:All the skills and knowledge gained from the energy management courses need to be practiced and applied in a real-world business context.Student groups will be assigned to various energy organizations to identify business issues and undertake consultancy projects.The purpose of this course is to develop business consultancy skills and apply them to resolve issues relating to energy management in the respective energy organizations.

COURSE CODE : SNB5032COURSE NAME : Research MethodologyNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Evaluate appropriate researchmethod and analysis for specific research objective and

purpose in business setting.2. Formulate research questions and hypotheses


4.0 MASTER OF SCIENCE IN ASSET MANAGEMENT & MAINTENANCE

4.1 IntroductionA master programme in Asset Management and Maintenance program addresses concerns of aging assets and maintenance culture amongst plant personnel. The target group that needs to be equipped with new knowledge and competencies in Asset Management and Maintenance are engineers and managers from petrochemical plants, refineries,offshoreplatforms/pipelines,powersectors,publicandprivateinfrastructuresand manufacturing organizations.

The program aims to produce leaders who are able to manage and maintain assets in the most economical, professional, creative, and reliable ways with the state-of-the-art technology, locally and globally.

Graduates with an MSc in Asset Management and Maintenance degree will enhance their employment and industrial career prospects in the management and maintenance of assets with the incorporation of the mechanical and civil engineering aspects.

4.2 Programme Objective1. Asset Management and Maintenance specialists with insights to articulate complex

industry problems and solutions.2. Industry leaders with integrity towards sustainable development through continuous


4.3 Programme Outcomes1. Demonstrate continuing advanced knowledge in Science in Asset Management

and Maintenance and have the capabilities to further develop or use these in new situations or multi-disciplinary context.

2. Analyze and evaluate critically problems in Science in Asset Management and Maintenance particularly in situations with limited information and to provide solutions through application of appropriate tools and techniques.

3. Appraise available information and research evidence in Science in Asset Management and Maintenance and apply it in the engineering context.

4. Plan and perform research undertakings in Science in Asset Management and Maintenance professionally, ethically and responsibly.

5. Reporttechnicalfindingsinbothwrittenandoralforms.6. Recognize the needs for continuing professional development in Science in Asset

Management and Maintenance.

4.4 Programme Curriculum StructureEach student is required to complete four (4) core modules, four (4) technical elective modules, 2 management elective modules, Research Methodology and 1 project and dissertation. The programme curriculum structure is shown in the below table.


Table 3: MSc Asset Management & Maintenance Curriculum StructureMSc ASSET MANAGEMENT & MAINTENANCE

CURRICULUM STRUCTURE

Category Course Cr Hr

Core Modules

1. EMM5013 Principles of Appraisal, Repair and Maintenance 32. EMM5033 Asset Life Study 33. EMM5023 Reliability Assessment of Structures 34. EMM5063 Plant Asset Maintenance Management 3

Technical Elec-tives

5. EMM5083 Corrosion Engineering 3

6. EMM5073 Failure Analysis and Risk-based Inspection 3

7. EMM5093 Reliability Assessment of Pipelines 38. EMM5103 Deepwater Maintenance 3

Management Electives

(Choose 2)

9. SNB5012 Operations Management 210. SNB5022 Strategic Management 211. SFB5012 Engineering Economy 2

University Requirements 12. SNB5042 Research Methodology 2

Dissertation 13. EMM511C Industrial Based Project 12

4.5 Core ModulesCOURSE CODE : EMM5013 MODULE : Principles of Appraisal, Repair and MaintenanceNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Discuss different maintenance policies for structure and plant2. Identify the Structural and Equipment Assessment Techniques3. Apply the methodology of Structural and Equipment Testing4. Design the repair techniques

SYNOPSIS:The course covers maintenance policy, condition survey, testing, evaluation analysis, repair and strengthening.


COURSE CODE : EMM5023 MODULE : Reliability Assessment of StructuresNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Demonstrate the concepts of Reliability of Structures2. Determine the Level of Certainty of Structural Performance3. Perform the Reliability Based Design4. Calibrate the Code based on Reliability5. Determine the Fatigue Reliability of Structures6. Plan the Probability and Risk Based Inspection

SYNOPSIS:The course covers the basics of structural reliability including the uncertainty and certainty modelling, component and system reliability, reliability based design & code calibration, fatigue reliability and probability & risk based inspection.

COURSE CODE : EMM5033 MODULE : Asset Life StudyNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Explain the principles of economic and service life of the assets, life cycle costing, decision

rules for Life Cycle Costing (LCC) and replacement2. Perform LCC analysis on the assets3. Perform replacement analysis

SYNOPSIS:The course covers asset life cycle analysis, engineering cost and estimates, life cycle costing, replacement decisions, sensitivity analysis, economic risk analysis.

COURSE CODE : EMM5063MODULE : Plant Asset Maintenance ManagementNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil MODULE OUTCOMES:1. Explain the principles of asset Integrity, reliability and availability.2. Explain the principles of asset maintenance management, option and related costs3. Apply the planning cycle and analysis for asset maintenance management4. Apply the inventory principles in asset maintenance and maintenance planning cycle

SYNOPSIS:This course covers asset and maintenance management concept, asset and utilization, asset integrity, reliability and availability, associated costs in maintenance management, maintenance management and concept, asset management and maintenance process, inventory control and maintenance, quality and safety in maintenance.


4.6 Technical ElectivesCOURSE CODE : EMM5073MODULE : Failure Analysis and Risk-based InspectionNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Explain the principles of failure analysis and to reduce the risk of failures.1. Find the optimum solution of a problem.2. Understand how to run an optimal maintenance business process to examine equipment.3. Toprovideaflexibletechniqueabletocontinuouslyimproveandadopttochangingrisks.4. Justify appropriate analysis and inspection to safeguard assets/material integrity.

SYNOPSIS:This course covers introduction to failure analysis and prevention, materials selection for failure prevention, manufacturing aspects of failure and prevention, structural life assessment methods, tools and techniques in failure analysis, case studies in failure analysis, and Risk-Based Inspection.

COURSE CODE : EMM5083MODULE : Corrosion EngineeringNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Explain the various corrosion mechanisms & prevention methods2. Describe various corrosion forms3. Explain different corrosion testing methods 4. Justify appropriate corrosion prevention methods for any corrosion case given5. Describe different degradation of materials

SYNOPSIS:This course covers corrosion principles & theory, forms of corrosion, corrosion prevention, corrosiontesting,andcorrosioninspecificenvironments.

COURSE CODE : EMM5093 MODULE : Reliability Assessment of PipelinesNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Identify the causes and types of pipeline failures2. Carry out pipeline design 3. Specify the appropriate materials4. Select the appropriate route5. Perform the reliability analysis6. Assess the pipeline integrity

SYNOPSIS:The course covers fundamentals of pipeline engineering, pipeline safety, failure causes, pipelinedesigncriteria,materialselection&specifications,pipelinerouting,reliabilityanalysis,and pipeline integrity management methods.


COURSE CODE : EMM5103MODULE : Deepwater MaintenanceNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Explainvariousformsofdeepwaterfacilitiesandsystems,includingfloatingvesselsand

offshore structures2. Demonstrate the types of deepwater maintenance.3. Benchmark and select the most appropriate facilities and systems installation mode(s),

and maintenance practice(s)

SYNOPSIS:The course covers overview of deepwater technology, deepwater facilities and systems, deepwater fundamentals, deepwater maintenance, and deepwater simulation projects.

4.7 Management Elective CourseCOURSE CODE : SNB5022 MODULE : Strategic ManagementNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Identify the range of decisions implicit in strategic management planning and using a variety

ofanalyticframeworksformakingsuchdecisions;2. Describe and explain the process of strategic analysis, strategic choice and strategic

implementationasembodiedinstrategicmanagementprocess;3. Perform and report upon a strategic analysis of an organisation at the business strategy

level;4. Identifykeystrategyimplementationandevaluationissuesfacedbyanorganisation;5. Applytheoreticalconceptstotheanalysisandevaluationofstrategicsituations;6. Discussbusinessplanningconceptsinastrategiccontext;7. Discuss corporate level strategy concepts.

SYNOPSIS:This capstone subject in the degree integrates and applies knowledge gained in previous units for the purpose of evaluating complex business problems and formulating policies and strategies for their solution. It seeks to develop knowledge of key strategic management concepts as well as basic skills in the formulation, implementation and evaluation of management strategies. A conceptual framework for the subject is developed covering both the domestic and global perspectives, Integration of existing knowledge in all areas business in an important part of the strategic management process.


COURSE CODE : SNB5012 MODULE : Operation ManagementNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describeandexplain thefieldofoperationsmanagement inanorganization,processes

involvingoperationsmanagementandpracticesofoperationmanagementinindustry;2. Applytheoreticalconceptsanalysisandevaluationofoperationsmanagementsituations;3. Apply quantitative analysis such as linear programming and decision trees in analysis and

evaluationofoperationsmanagementsituations;4. Perform simulations using spreadsheet on operations management analysis and evaluation

toarriveatfeasiblesolutionstotheoperationsmanagementproblems;5. Identify key operational elements within an organization which contribute to enhancement

the productivity of an organization.

SYNOPSIS:Overview on Operations Management, Forecasting, Designing of Goods and Services, Process Strategy and Capacity planning, Decision Making Tool, Location Strategies, Maintenance and Reliability, Transportation and Assignment problems and Project.

COURSE CODE : SFB5012 MODULE : Engineering EconomyNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil MODULE OUTCOMES:1. Describe the monetary side of engineering, the basic concepts of engineering economy

and its underlying principles.2. Discuss and apply the various methodology of engineering economy and their application

that will assist in making rational decision or solution to engineering problems that will be encountered in practice.

3. Discuss and solve problems related to the advanced topics such as interests, depreciation, income taxes, effect of inflation, tools for evaluating alternatives, capital financing,replacement analysis and project risk and uncertainty

SYNOPSIS:This course will cover the fundamental concept of engineering economics and its principles, methodology and application of the various methods as well as discussion on issues related to the economic of various engineering projects.

4.8 University RequirementCOURSE CODE : SNB5032COURSE NAME : Research MethodologyNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Determinetheresearchprocessincludingtheidentificationofatopicandsupervisor2. Prepareresearchproposalandfinalresearchreport.3. Determine research management, assessment and planning and also research ethics and

intellectual property rights. 4. Understand basic modeling and simulation, experiments and instrumentation that may be

used in their research methodology.

SYNOPSIS:The course covers Fundamentals of Research Methodology and Applied Sciences.


4.9 Dissertation ProjectCOURSE CODE : EMM511CMODULE : Industrial Based ProjectNO. OF CREDIT : 12 creditsPRE-REQUISITE : Research Methodology

MODULE OUTCOMES:1. Identify an acceptable research/development/design topic/product2. Analyze and describe the technical limits of the problem and produce a realistic plan

towards project completion3. Demonstrate an in-depth understanding of the context of the investigations4. Obtain and evaluate the relevance and quality of information and data from related

literatures5. Apply current design techniques and integrate key technologies appropriate to the problem

under investigation6. Propose and investigate various implementation strategies and select the appropriate or

best solution7. Perform adequate tests using software and/or hardware to validate and justify the chosen

approach8. Produce a written, structured technical report on the project9. Present the performed work in an oral technical presentation

SYNOPSIS:The module allows each student to work independently on an industry-based project under the supervision of a faculty member and/or a supervisor from the industry. The student is expect-ed to review the subject, propose an experimental / analytical plan and follow that through to feasibility study, investigation, design / simulation, test and implementation. Each student must prepareacomprehensivetechnicalreport,presentanddemonstratefindingsandresultsoftheproject work.

5.0 MASTER OF SCIENCE IN DRILLING ENGINEERING

5.1 IntroductionA master programme in Drilling Engineering deals with the application of recent advances in drilling technologies and analysis techniques such as well constructions, geomechanics,drillingfluidandcementing,wellcompletion,casingdesign,hydraulics,project management and economics, well engineering and well intervention in order to understand and optimise the drilling technique with technical knowledge and safety in place.

The MSc in Drilling Engineering program in UTP is unique as it is the only program of its kind offered inMalaysia. In addition, being affiliated to PETRONAS, UTP hasgood access to supports of the program such as through adjunct lecture scheme, co-teaching from industrial instructors and also external examiners for individual projects. This program has industrial based project which exposed to the real data of industries to become competent drilling engineer.

The program would provide the MSc in Drilling Engineering graduate with enhanced knowledge and skills that meets industrial demands in the area of Drilling Engineering suchasinoilandgasindustries,academia,R&Dscientificbodiesandfurtherstudies.


5.2 Programme ObjectiveThe programme educational objective of the programme is to produce drilling Engineering specialists with insights to articulate complex industry problems and solutions. The program also aims to produce industry leaders with integrity towards sustainable development through continuous improvement and innovation for the betterment of society.

5.3 Programme Outcomes1. Demonstrate continuing and advanced knowledge in drilling engineering and have

the capabilities to further develop or use these in new situations or multi-disciplinary context.

2. Analyze and evaluate critically problems in drilling engineering, particularly in situations with limited information and to provide solutions through application of appropriate tools and techniques.

3. Appraise available information and research evidence in drilling engineering and apply it in the engineering context.

4. Plan and perform research undertakings professionally, ethically and responsibly.5. Reporttechnicalfindingsinbothwrittenandoralforms.6. Recognize the needs for continuing professional development in drilling engineering.

5.4 Programme Curriculum StructureEach student is required to complete 44 credit hours consisting of 10 core modules, 1 module for national requirement, 1 module for University requirement and 1 module for individual project. The programme curriculum structure is shown in the below table.

Table 5: Msc in Drilling Engineering Curriculum StructureMSc IN DRILLING ENGINEERING


Category Module Cr Hr

Core

1. DAM 5253 Well Construction 32. DAM 5263 Geomechanics 33. DAM 5273 Drilling Fluids & Cementing 34. DAM 5283 Casing Design & Tubular 35. DAM 5293 Hydraulics & Drillstring Design 36. DAM 5293 Well Completion 37. DAM 5303 Well Engineering 1 38. DAM 5313 Project Management & Economics 39. DAM 5323 Well Intervention & Workover 310. DAM 5333 Well Engineering 2 3

University

Requirement11. Data Analytics

2

National

Requirements12. SNB5032 Research Methodology

2

Individual Project 13. DAM 534A Individual Project 10


5.6 Enrolment Mode The programme offered is only for full-time basis, based at Universiti Teknologi PETRONAS where all the lectures are held on the campus.

5.7 Graduation Requirements In order to graduate with Master of Science in Drilling Engineering degree, students are required to:

1. Obtain a minimum cumulative grade point average (CGPA) of 3.0,2. Pass the dissertation project requirement,3. Satisfy all the requirements as approved by Senate.

5.8 Core ModulesCOURSE CODE : DAM 5253 Well Construction COURSE NAME : Well ConstructionNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describe and explain the function of primary rig components and primary drilling.2. Explain and describe the well control systems.3. Produce a conceptual design for well integrity.4. Describe basic concept of MPD design and control.

SYNOPSIS:This module provides a broad understanding of the essential principles of Well Construction. The module delivers knowledge of the topics into deeper understanding of Wells and Well Systems through themediumof course and fieldwork.Key themes includeWell control design,WellIntegrity, Introduction to drilling and Operation management including logistic, drilling organizing & people, HSE, MPD application and techniques.

COURSE CODE : DAM 5263 COURSE NAME : GeomechanicsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Identify and differentiate types of formation rocks and pressure.2. Apply fundamental geological concept into drilling program.3. Examine wellbore stability and stress analysis.4. Identify the essentials of geomechanics in conventional & unconventional hydrocarbon.

SYNOPSIS:This module plays a major role in understanding the wellbore stability, formation pressure, structural geology and stress analysis. The presence of the wellbore and the pressure of the drilling fluid induce changes in the stress state or in the rock.As a result, the rock aroundthe borehole may fail if the redistributed stresses are greater than the rock strength. This course addressed subject on structural geology, formation rock, leak off test, application of geomechanics in unconventional hydrocarbon, formation pressure, wellbore stability, fracture gradient and stress analysis.


COURSE CODE : DAM 5273 COURSE NAME : Drilling Fluids & CementingNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1.Discussthebasicprinciplesofpolymerchemistryandclaychemistry towardsdrillingfluidperformance2.Analyzetheoptimaldrillingfluidandsuitablewastemanagementtechniquesforanticipatedwell conditions3. Design cement slurry that satisfy well requirements4. Analyze various techniques and tools for cement job evaluation

SYNOPSIS:The course begins with evaluating the drilling performance and continue with clay chemistry and inhibition,polymerchemistry,filtrationproperties,Completion,ReservoirDrill-in,WorkoverandPacker Fluid and drilling waste management. Later, the student will be exposed with cementing including the cement additives, cement job, cement evaluation and horizontal cementing.

COURSE CODE : DAM 5293 COURSE NAME : Hydraulics & Drillstring DesignNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Apply advanced knowledge to analyse the problems related to drilling hydraulics, BHA & Drill string design, and real time monitoring and optimization. 2. Design Drill String, Hydraulics and BHA associated with each type of trajectory. 3. Evaluate and optimize the drilling parameters during real-time operations. 4. Prepare project report in both written and oral forms.

SYNOPSIS:The objective of this course is to provide the student with an advanced knowledge needed to design and analyze drilling hydraulics. The students will learn hydrostatics of single and multiphasesystems;drillingfluid rheology;calculationandoptimizationof frictionalpressurelossesinthecirculatingsystem;optimizingbithydraulics;evaluatingholecleaningperformance;and predicting swab/surge pressure changes. The graduates will be able to design drill string and bits to prevent drill string failure. In addition, students will be able to evaluates torque and drag associated with each trajectory, operating limits to prevent buckling, and pressure drops for different pipe sizes to select the best drill pipe option.


COURSE CODE : DAM 5293 COURSE NAME : Well CompletionNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1.Explainmaincomponentsofatypicalnaturalflowingorartificialliftedproductionsystem2. Discuss and design different types of well completion methods and equipment3. Design suitable well stimulation techniques for damaged wells4. Evaluate possibility of sand production and propose suitable sand control techniques.

SYNOPSIS:This course provides the completion system with theoretical background in each section. The completion practices and equipment are designed along with perforating techniques for both onshoreandoffshore.Formationdamageandtreatmentarealsointroduced.Theuseofartificiallift is discussed. Stimulation, fracturing and sand control techniques are explained.

COURSE CODE : DAM 5303 COURSE NAME : Well Engineering 1NO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Design the well trajectory to meet well objectives and evaluate for anti-collision.2. Analyze the well trajectory requirement and develop appropriate directional drilling and deviation control programs.3.Evaluateanddesigneternalbarriersforwellabandonmentthatfulfilsindustrystandardsandregulations.4. Produce a comprehensive well design document using engineering approaches through systematicwelldesignworkflow.

SYNOPSIS:This module teaches the students to master the subjects of well trajectory, anti-collision, directional drilling and deviation control, well abandonment, well control and managed pressure drilling integrate these subjects with all the lesson learnt from the previous modules to produce a comprehensive well design document that meets the industry standards and regulations. The givenmasteryisexpectedtobeappliedinaspecificprojectthatallowsthestudentstohaveafirsthandexperienceinapplyingasystematicworkflowtoproduceandpresentacomprehensivewell design document using actual case studies.

COURSE CODE : DAM 5313 Project Management & Economics COURSE NAME : Project Management & EconomicsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Apply advanced knowledge using appropriate tools and techniques to meet the project requirements.2. Evaluate risk and environmental impact of drilling projects in compliance with regulatory requirements and industry standards.3. Analyse project economics and supply chain management of a drilling project.4. Prepare project report in both written and oral forms.

SYNOPSIS:The student will learn project economics and management principles and able to apply this knowledge in managing drilling project. Student will learn on how to apply the critical project andriskmanagementconceptsthatarerequiredtorundrillingprojectsinasafe,efficient,cost-effective, and environmentally-friendly manner. The student will also learn concepts of project financeandadministration,andsupplychainmanagement.


COURSE CODE : DAM 5323 COURSE NAME : Well Intervention & WorkoverNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describe the well intervention techniques and workover 2. Describe the technique for workover operation3.Discusswellheadmaintenance,hydraulicworkoverunitandfishingoperation.4. Discuss other well intervention methods and new technologies in well intervention and workover.

SYNOPSIS:This module provides fundamental information regarding well intervention and workover. The student will be equipped with subject slickline, e-line and coil tubing operation. The module will deliver also workover operation, wellhead maintenance hydraulic workover unit, intervention toolsandfishingoperation.Tofurtherenhancestudentcapability,themoduleisequippedwithother well intervention methods and new technologies in well intervention.

COURSE CODE : DAM 5333 COURSE NAME : Well Engineering 2NO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describe the fundamental principles of advance well design for HPHT, deepwater, ERD, horizontal and multilateral wells. 2. Able to design for advance well scenario under HPHT, deepwater, ERD, horizontal and multilateral conditions.3. Describe the mechanism of stuck pipe prevention.4. Identify the procedure to mitigate and recovery of stuck pipe prevention.

SYNOPSIS:This module elaborates about advanced well design and stuck pipe prevention. The student will be teaching to master well design of HPHT well, deepwater well, ERD, horizontal and multilateral wells. The student will further equip with mechanism and procedure to mitigate and recovery of stuck pipe.

5.9 National RequirementCOURSE CODE : SNB5032COURSE NAME : Research MethodologyNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1.Determinetheresearchprocessincludingtheidentificationofatopicandsupervisor2.Prepareresearchproposalandfinalresearchreport.3. Determine research management, assessment and planning and also research ethics and intellectual property rights. 4. Perform basic modeling and simulation, experiments and instrumentation that may be used in their research methodology.



5.10 Individual ProjectCOURSE CODE : DAM5534ACOURSE NAME : Individual ProjectNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil SYNOPSIS:The module introduces the principles and techniques involved in managing well engineering and construction operations by developing the students’ knowledge and understanding of the theory and practice of drilling and well engineering operations.

6.0 MASTER OF SCIENCE IN ELECTRONICS SYSTEMS ENGINEERING

6.1 IntroductionA master programme in Electronics System Engineering Programme is tailored to train young graduates and professionals with advanced design in integrated circuit design and applications and entrepreneurship skills to enable them to perform R&D and commercialization activities and move up the value chain from the manufacturing era to the design era of the electronic industry.

Besides providing in-depth knowledge of specific subject areas, this programme isalso intended to expose the graduates and engineers with a range of analytical and research skills that would be of long-term value. Graduates with an MSc in Electronic Systems Engineering degree will enhance their employment and career prospects in the telecommunication, computers, and electronics and semiconductor industry. The degree is also a good starting point for a career in research and academia.

6.2 Programme Objective

1. Science in Electronics Systems Engineering specialists with insights to articulate complex industry problems and solutions.

2. Industry leaders with integrity towards sustainable development through continuous improvement and innovation for the betterment of society.

6.3 Programme Outcomes1. Demonstrate continuing advanced knowledge in Science in Electronics Systems

Engineering and have the capabilities to further develop or use these in new situations or multi-disciplinary context.

2. Analyze and evaluate critically problems in Science in Electronics Systems Engineering particularly in situations with limited information and to provide solutions through application of appropriate tools and techniques.

3. Appraise available information and research evidence in Science in Electronics Systems Engineering and apply it in the engineering context.

4. Plan and perform research undertakings in Science in Electronics Systems Engineering professionally, ethically and responsibly.

5. Reporttechnicalfindingsinbothwrittenandoralforms.6. Recognize the needs for continuing professional development in Science in

Electronics Systems Engineering.


6.4 Programme Curriculum StructureEach student is required to complete 5 core modules, 3 technical elective modules, 2 management elective modules and 1 project and dissertation, and Research Methodology. The programme curriculum structure is shown in the below table.

Table 6: MSc Electronic Systems Engineering Curriculum Structure

MSc ELECTRONIC SYSTEMS ENGINEERINGCURRICULUM STRUCTURE

Category Course Cr Hr

Core Modules

1. EEM5013 Advanced Engineering Mathematics for System Analysis and Design

2. EEM5023 Advanced Digital Systems Design

3. EEM5073 Modern Communication & Networking Systems

4. EEM5043 Advanced Embedded Systems

5. EEM5053 VLSI Systems Design

3

333

3

Specialisations

(Choose 1 Option)

Option A

Advanced Circuit Design

• EEM5063 Advanced Analog Integrated Circuit Design

• EEM5033 RF Circuit Design3

Option B

Sensors & Intelligent Systems

• EEM5083 Sensors & Systems

• EEM5093 Intelligent Systems3

Choose any 1

1. EEM5113 Semiconductor Fabrication Technology2. EEM5123 Communication System Design3. EEM5133 Image Processing and Computer Vision4. EEM5143 Advanced Computer System Architecture

3

Management Electives

(Choose 2)

1. SNB5012 Operations Management

2. SNB5022 Strategic Management

3. SNB5032 Multinational Business and Finance

4. SFB5012 Engineering Economy

3

Dissertation EEM520C R&D Project 3


6.5 Core ModulesCOURSE CODE : EEM5013 MODULE : Advanced Engineering Mathematics for System Analysis and DesignNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Find the optimum solution of a problem.2. Use the different estimators.3. Model the non-deterministic signals.4. Use MATLAB in the engineering applications.

SYNOPSIS:Essential topics in engineering mathematics, including optimization and its application to engineering, discrete-time random processes, estimation theory and modeling of engineering systems and operations using selected techniques from mathematics, statistics, and stochastic processes.

COURSE CODE : EEM5023 MODULE : Advanced Digital Systems DesignNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Writebehavioralmodel,dataflowmodel,hierarchical-structuralmodel,gate-levelmodel,

and register-transfer level (RTL) model of digital systems using hardware design language (HDL).

2. Design, simulate, test, and synthesize digital systems using Electronic Design Automation (EDA) tools on Field Programmable Gate Array (FPGA) and other programmable and re-configurabledevices.

SYNOPSIS:Thefundamentalconceptsofdigitaldesign.It introducesthedigitalsystemsdesignflowandincludes HDL (Verilog, VHDL or other languages), different level of modeling, simulation, testing, Electronic Design Automation (EDA) tools, and programmable devices.

COURSE CODE : EEM5073 MODULE : Modern Communication & Networking SystemsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Acquire a strong background in the network architecture, protocols and principles of

modern communications techniques and systems, and apply the knowledge to simulate typical networks.

2. Design typical communication systems.

SYNOPSIS:A comprehensive coverage of the principles and techniques in the modern communication and networking systems. Students will be guided through a systematic lecture on the technical background, architecture, protocols and new directions in modern communication techniques and networks.


COURSE CODE : EEM5043MODULE : Advanced Embedded SystemsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Analyze the issues involved in designing a computer system.2. Accurately evaluate the performance of a given system.3. Designamicroprocessorsystemtoperformaspecifiedtask.

SYNOPSIS:An in-depth overview of important topics ranging from microcontrollers and Operating System design to PCB Layout and manufacturing guidelines. The course is also intended for graduate students in Electrical and Computer Engineering, as well as the Embedded System professional.

COURSE CODE : EEM5053MODULE : VLSI Systems DesignNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Design and analyse VLSI system building blocks. 2. Design a memory sub-system.3. Design, layout, extract, simulate and tape out ready for fabrication by the IC foundries.

SYNOPSIS:The analysis and design of digital integrated circuits building blocks using CM OS technology. The course emphasizes on design, and requires extensive use of a circuit layout CAD tool, and SPICE for simulations.

6.6 Technical ElectivesCOURSE CODE : EEM5063MODULE : Advanced Analog Integrated Circuit DesignNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Analyse device speed and power performance metric. 2. Design and simulate current source and bias network.3. Designamplifierfromspecificationtobiascurrentandtransistorsize.

SYNOPSIS:The analysis and design of analog integrated circuits building blocks using CM OS technology. The course emphasizes on design, and requires extensive use of a circuit layout CAD tool, and SPICE for simulations.


COURSE CODE : EEM5033MODULE : RF Circuit DesignNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Analyze and design RF circuits with the focus on IC implementation.2. Designtunedbroadband,lownoiseamplifier,oscillator,andtransceivercircuits.3. Use intuitive design methods to complement analytical tools and to evaluate it by both hand

calculations and computer simulations.

SYNOPSIS:The design and analysis of radio-frequency circuits at the transistor level, with a focus on IC implementations, mainly in CMOS. Narrow band and broadband high-frequency amplifiersincluding a variety of bandwidth-extension tricks. Design of front-end circuits. Classical control concepts, phase noise, oscillators, phase-locked loops and frequency synthesizers. RF power amplifiersandtransceiverdesign.

COURSE CODE : EEM5083MODULE : Sensors & SystemsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describe the working principles of various types of sensors and transducers used in

measurement systems, such as motion, displacement, force, pressure, acceleration, temperature,andflowmeasurements.

2. Design, construct and implement a range of sensors and transducers, such as potentiometric, LVDT, optical encoders, turbine meters, hot-wire anemometers for a particular application.

3. Design electronics for sensor interfacing, signal condition, and recovery of weak signal from the noise, for various types of measurement systems.

4. Design and build a measurement system for monitoring of physical/chemical/biological parameters that have application in the process industries and biomedical engineering.

SYNOPSIS:Advanced techniques for designing of measurement systems. This includes the design of electronics for sensor interfacing and pre-processing of signals for various measurements such asdisplacement,force,pressure,temperatureandflow.

COURSE CODE : EEM5093MODULE : Intelligent SystemsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describe the general overall structure of neural network (NN), genetic algorithm (GA) and

fuzzy logic.2. Design a NN model for use in a particular application.3. Design a GA for a particular application, e.g. optimization. 4. Construct a hybrid GA-NN model for a particular application.5. Develop a fuzzy logic system to solve a particular problem.6. Design a fuzzy-NN learning model.

SYNOPSIS:The theoretical aspects of neural networks, genetic algorithms and fuzzy logic techniques and in relation to the systems design and implementation. At the end of the course, students are able to analyse, conceptualise, design and implement an intelligent system using any of the techniques.


COURSE CODE : EEM5113MODULE : Semiconductor Fabrication TechnologyNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil MODULE OUTCOMES:1. Describe the theoretical and practical aspects of the major steps in device fabrication with

an emphasis on integrated devices.2. Perform basic fabrication processes such as oxidation, photolithography, etching, impurity

doping by diffusion process, and metallization.3. Design and simulate BJT and CMOS transistor and characterize their electrical properties

using simulation tools.

SYNOPSIS:Basic processes involved in IC fabrication: crystal growth to lithographic process of pattern transfer. The practical aspect would cover the major steps of a planar process used extensively in IC fabrication: oxidation, photolithography, etching, impurity doping by diffusion process, and metallization.Electricaltestingofthefinalproducttoensurequality,andconformanceofproducttospecifications.

COURSE CODE : EEM5123MODULE : Communication System DesignNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Design various subsystems on MATLAB/SIMULINK2. Simulate networks on OPNET3. Develop some systems in hardware language e.g. Verilog

SYNOPSIS:The application of knowledge of communication systems/ subsystems to designing and simulating and translating them for hardware realization.

COURSE CODE : EEM5133MODULE : Image Processing and Computer VisionNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Apply image processing and computer vision techniques to applications related to image

communications and machine vision.2. Design practical systems for image communication and vision inspection systems.

SYNOPSIS:Theory, principles and techniques of image processing and computer vision, which includes imageacquisitionanddisplay,imagefilteringandsegmentation,imageanalysisandtransforms.The practical aspects of the course would cover the problem solving using the techniques and in a simulation. The design project would entail implementation of solutions on real-time DSP systems.


COURSE CODE : EEM5143MODULE : Advanced Computer System ArchitectureNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Analyze the issues involved in designing a computer system.2. Design a complete computer system.

SYNOPSIS:Issues pertaining to computer system architecture: measuring performance, instruction sets and improving CPU performance - pipelining, memory hierarchies, storage systems and I/O systems.

6.7 Management Elective CourseCOURSE CODE : SNB5022 MODULE : Strategic ManagementNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil







COURSE CODE : SNB5012 MODULE : Operations ManagementNO. OF CREDIT : 2PRE-REQUISITE : Nil


involvingoperationsmanagementandpracticesofoperationmanagementinindustry;2. Apply theoretical concepts to the analysis and evaluation of operations management






COURSE CODE : SFB5012 MODULE : Engineering EconomyNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describe the monetary side of engineering, the basic concepts of engineering economy








intellectual property rights. 4. Perform basic modeling and simulation, experiments and instrumentation that may be used

in their research methodology.


6.9 Dissertation ProjectCOURSE CODE : EEM520CMODULE : R&D ProjectNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Identify an acceptable research/development/design topic/product, and produce a realistic

plan towards project completion.2. Analyze and describe the technical aspects of the problem.3. Apply current design techniques and utilize key technologies appropriate to the problem.4. Performthenecessaryverification/validationofthedesignsystem.5. Produce a well written standard technical report of a research project in an MSc thesis.6. Presenttheresultsandfindingsinaprojectviva.

SYNOPSIS:The module allows each student to work independently on an industry-based project under the supervision of a faculty member and a supervisor from the industry. The student is expected to review the subject, propose an experimental / analytical plan and follow that through to feasibility study, investigation, design / simulation, test and implementation. Each student must prepare a comprehensivetechnicalreport(MScthesis),presentanddemonstratefindingsandresultsofthe project work.


7.0 MASTER OF SCIENCE IN OFFSHORE ENGINEERING

7.1 IntroductionOffshore industry is a relatively recent Industry that has rapidly expanded during the last 60 years. Challenges in the industry arise such as has never been encountered before, particularly in offshore engineering. These challenges can only be synthesized and solved by upgrading and enhancing the knowledge related to offshore engineering.

The oil and gas industry plays a significant role inMalaysia’s economy. The nationlargely derives these resources from offshore reserves. It is predicted that there will be a shortage of talent in Malaysia in the oil and gas industry. This complexity is due to the large segments of workforce approaching retirement and the lack of skilled graduates from Malaysian universities. Malaysian universities have limited exposure in offshore engineering, as the focus is on general engineering in major disciplines (e.g. Civil, Mechanical, and Electrical Engineering). Exposure is only gained through on the job training, requiring companies toinvestasignificantamountintimeandmoney.Inordertofillintheskillgapandlackof talent, it is necessary to develop graduates who are trained and versed in various offshore engineering areas.

The pedagogical goal of the MSc Offshore Engineering Programme is to educate students to be able of taking a leadership role in superior technical knowledge and application required in the offshore industry.

7.2 Programme Objective1. Offshore Engineer specialists with insights to articulate complex industry problems

and solutions.2. Industry leaders with integrity towards sustainable development through continuous


7.3 Programme Outcomes1. Demonstrate continuing and advanced knowledge in Offshore Engineering and have

the capabilities to further develop or use these in new situations or multi-disciplinary contexts.

2. Analyze and evaluate critically problems in Offshore Engineering particularly in situations with limited information and to provide solutions through the application of appropriate tools and techniques.

3. Appraise available information and research evidence in Offshore Engineering and apply it in the engineering context.

4. Plan and perform research undertakings in Offshore Engineering professionally, ethically and responsibly.

5. Reporttechnicalfindingsinbothwrittenandoralforms.6. Recognize the needs for continuing professional development in Offshore

Engineering.


7.4 Programme Duration

Table 7: Duration of CandidacyType Duration of Candidacy

Full time 16 months (4 semester)

Part time 28 months (7semester)

7.5 Programme Curriculum StructureEach student is required to complete seven (7) core modules, two (2) technical elective modules, one (1) research project, and Research Methodology module. The programme curriculum structure is shown in the below table.

Table 8: MSc Offshore Engineering Curriculum StructureMSc OFFSHORE ENGINEERING

CURRICULUM STRUCTURECategory Module Cr Hr

Core

1. VBM5113 Wave Hydrodynamics

2. VBM5123 Structural Dynamics

3. VBM5143 Meteorology and Oceanography

4. VBM5153 Design of Fixed Offshore Structures

5. VBM5163 Offshore Foundations

6. VBM5173 Risk, Reliability & Integrity of Offshore Structure

7. VBM5183 Offshore Project Management

3

3

3

3

3

3

3

Technical Electives

(Choose 2)

8. VBM5313 Offshore Engineering Materials

9. VBM5313 Geotechnics & Geohazards

10. VBM5323 Advanced Theory of Elasticity and Plasticity

11. VBM5333 Finite Element Method for Offshore Structures

12. VBM5343 HSE Management in Offshore Engineering

13. VBM5353 Offshore Pipelines

14. VBM5363 Design of Floating Offshore Platforms

15. VBM5373 Coastal Engineering & Sediment transport

16. VBM5383 Offshore Positioning

17. VBM5393 Subsea Technology

3

3

3

3

3

3

3

3

3

3University

Requirements 18. SNB5032 Research Methodology 2

Dissertation Project19. VBM5213 Research Project I

20. VBM5227 Research Project II

3

7


7.6 Core ModulesCOURSE CODE : VBM5113 COURSE NAME : Wave HydrodynamicsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Evaluate suitable wave theories for the relevant offshore engineering application 2. Integrate and assess wave-structure behavior performance 3. Develop and interpret appropriate empirical models based on laboratory results to suit

current offshore engineering application

SYNOPSIS:Thiscoursecoversfluidmechanics,wavemechanics,wavetheoriesandwaveforces.Also,this course covers use of various transducers for static and dynamic measurements, model testsinwavetankandwaveflume&analysisofresponses.

COURSE CODE : VBM5123 COURSE NAME : Structural DynamicsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Assess appropriate dynamic equations methodology. 2. Assess the performance of offshore structures due to dynamic impacts such as

environmental, seismic, boat impacts, ballast and vibrations. 3. Generate the design criteria to be incorporated into design consideration

SYNOPSIS:This course will discuss structural dynamics of offshore structure, i.e. Dynamic Loads, Single Degree of Freedom (SDOF) Systems, Multi Degree of Freedom (MDOF) Systems and Earthquake Response of Linear Systems and its related concept. Assessment on uncertainty of concept parameters and its effect on design output also will be discussed.

COURSE CODE : VBM5143 COURSE NAME : Meteorology and OceanographyNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Develop meteorology and oceanography criteria for offshore structures design2. Generate meteorology and oceanography data collection requirements3. Analyze and interpret meteorology and oceanography phenomena from data collection

campaign

SYNOPSIS:This course will discuss Metocean conditions which have conventionally been one of the prerequisite considerations in the design of installations, rigs and pipelines as well as the operations of vessels, helicopters, ROVs and divers. It deals with the complexities of meteorological and oceanographic effects on the offshore conditions as well as its combined effects. As such, failuretocomprehendthesefactorswillresultinoverdesignthatwillcausefinancialoverrunsor potential structural disaster as a result of inadequate metocean considerations. This course will delve into the interpretation and analysis of operational metocean results to be utilized in identifying weather windows as well as forecast of weather conditions for operations.


COURSE CODE : VBM5153 COURSE NAME : Design of Fixed Offshore StructuresNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Analyzeanddesignfixedoffshoreplatformsusingappropriatetoolsandstandards2. Propose practical innovative solutions to meet industry requirements3. Generate working drawings for the design of offshore platforms

SYNOPSIS:This course covers introduction to Jacket platforms, GBS & Jack-up platforms, various steps in thestructuraldesignofoffshoreplatformcomponents,overalldesignoffixedplatformsusingsoftware, solutions for industry requirements and preparation of working drawings at various stages of design.

COURSE CODE : VBM5163COURSE NAME : Offshore FoundationsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Plan soil investigation program, interpret soil exploration data and deduce design

parameters from soil exploration report. 2. Select, analyze and present offshore foundations design and mooring anchors. 3. Quantify the effect of uncertainty during foundation design.

SYNOPSIS:This course will discuss design of offshore foundation, i.e. pile foundation, suction pile, spud can and shallow foundation and its related design parameters. Assessment on uncertainty of design parameters and its effect on design output also will be discussed.

COURSE CODE : VBM5173 COURSE NAME : Risk, Reliability & Integrity of Offshore StructureNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. To evaluate and interpret risk categorization of existing offshore structures2. To perform structure integrity assessment on offshore structures and justify for continued

service3. Analyze and interpret current reliability status meeting minimum criteria in accordance to

the codes and standards4. Propose and justify best mitigation option to enhance the reliability status of the structures

SYNOPSIS:This course will discuss deterministic and probabilistic design and assessment procedures, particularly methods of probabilistic reliability analysis. Assessment on the system strength and fatigue of a platform will also be discussed.


COURSE CODE : VBM5183COURSE NAME : Offshore Project ManagementNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. To differentiate and evaluate various phases and deliverables in offshore project lifecycle to

support project management decision-making processes2. Develop and justify an effective execution plan for the various project phases.3. To develop and propose project execution methodology and processes in accordance to

required quality, cost and schedule

SYNOPSIS:Projectmanagementtailoredforspecificnicheslikethatofoilandgasisahighlysortafterskillset among graduates today. Interested candidates, who enroll in this course, will be on a platform for them to get exposed to and gain holistic insights, views and knowledge of the oil and gas industry as a whole via specially designed academic delivery modules and systematic evaluationsintheformofquizzes,assignments,casestudiesandthelike.AsafirstcourseinOil and Gas project management, it will serve as a bridge between engineering technicalities and the more subjective knowledge of managing projects in the oil and gas industry. This is expected to give students the appropriate skillset that can be built upon joining the industry which will facilitate their becoming of competent specialist Oil and Gas Project leaders.

7.7 Technical ElectivesCOURSE CODE : VBM5313COURSE NAME : Geotechnics & GeohazardsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Select appropriate geotechnical / geophysical exploration techniques and plan exploration

campaignforspecificoffshorestructures.2. Appraise potential geohazards based on regional geology, geotechnical and geophysical

investigationresults;andformulateriskmitigationapproach.3. Evaluate effects of uncertainty due to limited soil investigation on site geotechnical model.

SYNOPSIS:This course will discuss salient aspects of site investigations, soil testing and geohazards related to offshore structures. The course emphasizes on the impact of the behaviors of structure to be designed on soil testing and soil modeling. Furthermore, soil exploration campaign is also treated as risk mitigation process as part of geotechnical risk management process.

COURSE CODE : VBM5323COURSE NAME : Advanced Theory of Elasticity and PlasticityNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Apply the theory and assess the behavior of linearly elastic and elasto-plastic structure in

offshore structures2. Apply the theory of buckling and failure mechanism of linearly elastic and elasto-plastic

structure in offshore structures

SYNOPSIS:Theory of Elasticity is the branch of Solid Mechanics which deals with the stress and displacements in elastic solids produced by external forces or changes in temperature. The purposeofstudyistocheckthesufficiencyofthestrength,stiffnessandstabilityofstructuralelements.


COURSE CODE : VBM5133 COURSE NAME : Offshore Engineering MaterialsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Evaluate the characteristics of materials for offshore applications.2. Assess suitability of unconventional materials. 3. Assess issues and challenges for material selection.

SYNOPSIS:This course covers introduction to materials in offshore applications, metallic materials, non-metallic materials and failure of materials and structures.

COURSE CODE : VBM5333COURSE NAME : Finite Element Method for Offshore StructuresNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Work out basic problems using FE principles 2. Solve FE problems related to offshore structure applications 3. Analyzeoffshorestructuresthroughtheapplicationofgenericfiniteelementtools

SYNOPSIS:Thiscoursegivesanintroductiontofiniteelementsinengineeringthatconsistoffundamentalconcepts and the basic element formulations. It also gives the applications for problems related tofixandfloatingoffshorestructuresandendswithtypicalproblemssolvedbyusinggenericFE tools.

COURSE CODE : VBM5343COURSE NAME : HSE Management in Offshore EngineeringNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Evaluate the required HSE Risk Management at various stage of exploration and Production

Cycle 2. Interpret and prioritize requirement of Malaysian and International standards related to

exploration and production 3. Differentiate the use of required risk assessment tools (HAZID, HEMP (including HAZOP),

EIA, JHA) in various stages of the project life cycle 4. Propose HSE strategies for each aspect of E& P lifecycle 5. Develop and evaluate HSE risk management documentation and recommend improvement

in the risk management in E & P.

SYNOPSIS:The objective of this Course is to enable students to gain knowledge and skills in key HSE Risk Management applicable to the offshore exploration and production cycle and to equip them with the relevant competencies to assess the relevant hazards, estimate and evaluate the acceptability of the risk posed by various activities and the controls required to ensure safe planning and execution of activities in the exploration and production at offshore facilities.


COURSE CODE : VBM5353COURSE NAME : Offshore PipelinesNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Design offshore pipelines2. Route the pipelines for both deep sea and shore approach routing 3. Evaluate and select various pipeline installation and construction methods 4. Interpret pipeline risks, types of accidents, and repair methods.

SYNOPSIS:This course covers pipeline design, route selection, installation and construction methods, its risks, accidents and repair.

COURSE CODE : VBM5363COURSE NAME : Design of Floating Offshore PlatformsNO. OF CREDIT : 3PRE-REQUISITE : Nil

MODULE OUTCOMES:1. Analyzeanddesignfloatingoffshoreplatformsusingappropriatetoolsandstandards2. Propose solutions to meet industry requirements 3. Generateworkingdrawingsforthedesignoffloatingoffshoreplatforms

SYNOPSIS:This course covers introduction to floating platforms, various steps in the structural designoffloatingoffshoreplatformcomponents,overalldesignoffloatingplatformsusingsoftware,solutions for industry requirements and preparation of working drawings at various stages of design.

COURSE CODE : VBM5373COURSE NAME : Coastal Engineering & Sediment transportNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Analyzethepropertiesandinfluenceofenvironmentalfactorstothecoastalprocesses2. Evaluate factors affecting and the impact of development to the coastal area 3. Formulate sediment budget and shoreline response.4. Compare and evaluate various coastal protection structures.

SYNOPSIS:This course covers the fundamental principles and concepts of ocean and coastal engineering. It provides better understanding to the influencing environmental parameters that affect therespective coastal processes. This knowledge will be used to formulate sediment transport and budget in the coastal area which will lead to the development of appropriate coastal protection & structures. The course will also expose the students to the basic components of coastal hydraulic study and to relate the importance of such environmental concerns in the design and construction of coastal structures.


COURSE CODE : VBM5383COURSE NAME : Offshore PositioningNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Assess and propose appropriate offshore positioning method2. Assess and propose offshore positioning integrity and quality in offshore applications 3. Develop strategies for monitoring deformation and tolerances of offshore structures

SYNOPSIS:This course will cover aspect of geodesy applicable in offshore positioning, the latest instrumentation involved and the associated quality measure and quality assurance relevant in offshore positioning. Application of precise offshore positioning for monitoring an offshore platform deformation will also be presented.

COURSE CODE :VBM5393COURSE NAME :Subsea TechnologyNO. OF CREDIT :3 creditsPRE-REQUISITE :Nil

MODULE OUTCOMES:1. Planthesubseafielddevelopment2. Design the manifolds, wellheads, trees and ROV intervention 3. Propose suitable umbilical systems, risers and pipelines

SYNOPSIS:This course covers various aspects of subsea production systems, equipment, manifolds, wellheads and tress, subsea umbilical system, risers and pipelines.


MODULE OUTCOMES:1. Identify and formulate research problems. 2. Synthesize literature review in their research proposal. 3. Evaluate appropriate modeling and simulation, design experiments and instrumentation

that may be used in their research. 4. Prepare and defense research proposal.

SYNOPSIS:Series of seminars on topics related to research preparations: manage and plan research activities, think creatively, setup experimental/model for theory verification, prepare tocommercialise research, prepare research report and communicate research output effectively.


7.9 Dissertation ProjectCOURSE CODE : VBM5213COURSE NAME : Research Project INO. OF CREDIT : 3 creditsPRE-REQUISITE : Research Methodology

MODULE OUTCOMES:1. Identify an acceptable research/development/design/project topic2. Analyze and describe the technical limits of the problem and produce a realistic plan

towards research work/project completion3. Demonstrate an in-depth understanding of the context of the investigations4. Obtain and evaluate the relevance and quality of information and data from related


under investigation6. Propose and investigate various implementation strategies and select the appropriate or

best solution7. Perform adequate tests using software and/or hardware to validate and justify the chosen

approach8. Produce a written, structured dissertation on the research work/project9. Present the performed work in an oral technical presentation

SYNOPSIS:This course is 100% course work and is based on industrial data collection, literature survey, conventional and non-conventional methods required to conduct experimental and/or numerical simulationstudiestoproducevaluabletechnicalfindings.

COURSE CODE : VBM5227COURSE NAME : Research Project IINO. OF CREDIT : 7 creditsPRE-REQUISITE : Research Methodology

MODULE OUTCOMES:1. Identify an acceptable research/development/design/project topic2. Analyze and describe the technical limits of the problem and produce a realistic plan

towards research work/project completion3. Demonstrate an in-depth understanding of the context of the investigations4. Obtain and evaluate the relevance and quality of information and data from related


under investigationPropose and investigate various implementation strategies and select the appropriate or best solution

6. Perform adequate tests using software and/or hardware to validate and justify the chosen approach

7. Produce a written, structured dissertation on the research work/project8. Present the performed work in an oral technical presentation

SYNOPSIS:This course is 100% course work and is based on industrial data collection, literature survey, conventional and non-conventional methods required to conduct experimental and/or numerical simulationstudiestoproducevaluabletechnicalfindings.


8.0 MASTER OF SCIENCE IN PETROLEUM ENGINEERING

8.1 IntroductionEngineering is an interdisciplinary field that applies engineering principles andquantitative methods in exploiting subsurface oil and gas reserves. At UTP, the MSc courseinPetroleumEngineeringoffersqualifiedanddedicatedgraduateswithalearningexperienceandindustryrelevantresearchandfielddevelopmentprojectsrelatedtotheneeds of the multibillion dollar petroleum industry. This is achieved through a programme of taught MSc degree course which offers 11 technical modules and 2 management electives. There is a high degree of computer usage for project, teaching and on-line support. High performance workstations are able to provide powerful graphics and processing capability enabling students and high caliber staff to tackle complicated problems of the petroleum industry.

Graduates with an MSc in Petroleum Engineering degree will enhance their employment and career prospects in the global oil and gas industry. The degree is also a good starting point for a career in research and academia.

8.2 Programme Objective1. Science in Petroleum Engineering specialists with insights to articulate complex


improvement and innovation for the betterment of society

8.3 Programme Outcomes1. Demonstrate continuing advanced knowledge in Science in Petroleum Engineering

and have the capabilities to further develop or use these in new situations or multi-disciplinary context.

2. Analyze and evaluate critically problems in Science in Petroleum Engineering particularly in situations with limited information and to provide solutions through application of appropriate tools and techniques.

3. Appraise available information and research evidence in Science in Petroleum Engineering and apply it in the engineering context.

4. Plan and perform research undertakings in Science in Petroleum Engineering professionally, ethically and responsibly.


Petroleum Engineering.

8.4 Programme Curriculum StructureEach student is required to complete 8 core modules, 2 management elective modules and 1 Final Development Plan,1 Individual Project and Research Methodology. The programme curriculum structure is shown in the below table.


Table 9: MSc Petroleum Engineering Curriculum StructureMSc PETROLEUM ENGINEERING


Schedule Category Course Cr Hr Status

Phase 1

(Week 1 -10)Technical Modules

1. PAM5113 Petroleum Geoscience

2. PAM5143 Formation Evaluation

3. PAM5123 Reservoir Engineering 1 (Basic Reservoir Engineering)

4. PAM5153 Well Test Analysis (Reservoir Engineering 2)

5. PAM5173 Reservoir Simulation (Reservoir Engineering 3)

6. PAM5164 Production Technology

7. PAM5133 Drilling Engineering

8. PAM5183 Petroleum Economics

3

3

3

3

3

4

3

3

Core

Core

Core

Core

Core

Core

Core

Core

Management / Business Electives

(Choose 2 only)




12. SNB5062 Multinational Business and Finance

13. SBB5022 Business Communication

2

2

2

2

2

Elective

Elective

Elective

Elective

ElectivePhase 2

(Week 11 – week 14) PAM5216 Field Development Project 6 Core

Phase 3

(Week 15 – Week 18)

PAM5226 Individual Research Project 6 Core

SNB5032 Research Methodology 2 UR

TOTAL 43


8.5 Core ModulesCOURSE CODE : PAM5113 MODULE : Petroleum Geoscience NO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describe the Earth layering structures with different properties base on density and

composition.2. Visualize the plate tectonic concept in relation to basin development, mountain ranges and

structures.3. Differentiateandclassifythreemainrockcategoriesandtheirsignificantreservoirrocks.4. Describe the differences between clastic, organic and chemical sedimentary rock.5. Illustrate the petroleum system in term of source rock, migration, reservoir, trap and seal. 6. Describe the seismic acquisition, processing and interpretation7. Apply material balance equation for various reservoir engineering calculations8. Describevariousmodelsofwaterinfluxcalculations9. Evaluate applications of immiscible displacement concepts in reservoir engineering

calculations.

SYNOPSIS:The module introduces geological concepts to the students, then concentrates on the material closely associated with petroleum reservoir rocks, including the environment of deposition, volumetric calculations and uncertainty of data.

COURSE CODE : PAM5143 MODULE : Formation Evaluation NO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Identify and priorities, from the log header, the bore hole conditions and tool characteristics

which are relative to the logging operation.2. Differentiate between the main relevant rock types.3. Distinguish between single phase liquid, single phase gases and mixed these two phases. 4. Describe the procedure and tools used to interpret logs5. Describe in general terms how the lithology can be interpreted6. Describing porosity logs7. Describe the techniques and assumptions used for deriving minerals.8. Determine the saturation of a rock using various techniques.

SYNOPSIS:The module addresses formation evaluation by well logging. There is an overview of the techniques and operation, followed by a discussion of the main attributes of the reservoir and fluidandtheircharacteristicsignals.


COURSE CODE : PAM5123 MODULE : Reservoir Engineering 1 (Basic Reservoir Engineering)NO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Identifyclassificationsofreserves2. Calculate reservoir pressure gradients and characterize the reservoir3. Calculatebasicreservoirrockandfluidpropertiesfromtestdata4. Identifyphasediagramsforfivetypesofreservoirfluids5. Applyflowthroughporousmediaconceptsforgeneratingreservoirpressureprofile.6. Apply concepts in material balance equation, immiscible displacement for optimization of

reservoir performance.

SYNOPSIS:ReservoirEngineering1discusses thebasic rockandfluidpropertiesof typical oil andgasreservoirs.Itexaminesmaterialbalanceandfluiddiffusivityapproachestoreservoirfluidflowandvolumes.Itinvestigateswaterinfluxandimmiscibledisplacementmechanisms.

COURSE CODE : PAM5153 MODULE : Well Test Analysis (Reservoir Engineering 2)NO. OF CREDIT : 3 creditsPRE-REQUISITE : Reservoir Engineering 1

MODULE OUTCOMES:1. Todescribethebasicequationflowoffluidinporousmediacausedbyapotentialdifference

in relation with physical principles of conservation of mass, equation of motion, and equation of state.

2. To comprehend the analysis of transient pressure responses in wells by learning the principles,applicabilityandlimitationsofthevarioustechniquesofbuild-upandflowtests.

3. Understandtheimportanceofdifferentiatingamongdifferentsolutionoftheflowequation,their assumptions and the applications in terms of the outer and inner boundary.

4. Toidentifyvariousflowpatternsduringthetestandhowthetypecurvescanbeusedtoimprove pressure transient analysis.

5. To describe various forms of natural drive mechanism, characteristic and performance.6. To apply material balance equation for various reservoir engineering calculations7. Todescribevariousmodelsofwaterinfluxcalculations8. To evaluate applications of immiscible displacement concepts in reservoir engineering

calculations.

SYNOPSIS:Thismodule reviewsfluidflow inporousmediaandexamines theanalyticalsolutions to thediffusivity equation. It then takes the analytical solutions relevant to well testing and develops the classical solutions, examines their limitations and shows examples of their use. The module examinestheuseofpressureandflowmeasurementsinreservoirmanagement.


COURSE CODE : PAM5173 MODULE : Reservoir Simulation (Reservoir Engineering 3)NO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Selecttheappropriatesimulationmodelforaspecificreservoirandagivenoil/gasrecovery

process.2. Identify the main components of workflow for the simulation model (basic equations,

discretization, solution procedure, input/output)3. Identify, prepare, and screen the data needed to perform a simulation run 4. Interpret simulation results and relate the effect of input parameters on reservoir performance 5. Choose operating strategies to optimize oil/gas recovery

SYNOPSIS:This module develops an approximate solution to the diffusivity equation and discusses different numerical solution techniques. It discusses the uncertainty and errors associated with numerical solutions and shows the type of data required, resolution and up scaling required.

COURSE CODE : PAM5164 MODULE : Production Technology NO. OF CREDIT : 4 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Understand and appreciate the production system from reservoir to surface2. Design suitable bottomhole completions systems 3. Understand the design principles of different perforation systems4. Understand the techniques available to diagnose well problems and recommend solutions5. Designanartificialliftsystembasedonpumpingandgasliftingtechniques6. Assess the degree of formation damage present in a formation7. Design acidising and hydraulic fracturing treatments 8. Understand and be able to select appropriate methods to enable sand control9. Understand the processes and equipment used in produced water handling

SYNOPSIS:This module introduces the production system from reservoir to surface as a series of pressure drops and discusses the theoretical background to the flow regimes found in each section.The completion practices and equipment are developed along with perforating techniques and methods of determining well/ reservoir problems. Remedial solutions are developed along with the techniques of delivering these solutions.

Themodulealsoreviewstheflowsystemfromreservoirtosurfacethenexaminesthemajorareasofinteresttoproductionengineers.Theuseofartificiallift(includinggaslift)isdiscussedand the design requirements worked through. The main areas concerning the reservoir are formation damage, acidising and hydraulic fracturing. The module also discusses problems associated with water treatment and disposal, along with an overview of field productionoperations.


COURSE CODE : PAM5133 MODULE : Drilling EngineeringNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describe the basic components and the function of each component in the rotary well

system.2. Describethefunctionofdrillingfluidandoptimizingthehydraulicsofthecirculationsystem.3. Discuss the subsea well control system.4. Design of casing and cementing.5. Design directional drilling and conducting well survey.

SYNOPSIS:Thismoduleexaminesthedrillingoperationasawholethenidentifiesthekeyareas:equipment,operations, formation pressures, well control, casing design and well trajectory.

COURSE CODE : PAM5183 MODULE : Petroleum EconomicsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describegeneralfinancialaspectofthepetroleumindustry2. Listandexplaincashflowconceptinprojectevaluation3. Defineandcalculatemoneyoftheday,constantmoneyandcostescalation4. DefineandcalculateNetPresentValue,Internalrateofreturn,MaximumCapitalOutlay

and cost per barrel5. List and describe the various methods of taxing petroleum revenues6. List and describe Concession System and Production Sharing Contract7. EvaluatePetroleumProjectEconomicunderdifferentpetroleumfiscalsystem8. Construct decision tree analysis and solve it.

SYNOPSIS:Themoduleintroducesthefinancialframeworkwithinwhichpetroleumprojectsarejudged.Themodule presents different techniques to measure costs and uses these along with statistical methods of quantifying risk to determine the ranking order for project development.


8.6 Management Elective ModulesCOURSE CODE : SNB5022 MODULE : Strategic ManagementNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil





















COURSE CODE : SBB5022 MODULE : Business CommunicationNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Apply the principles and practices of professional written and oral communication skills to

communicate effectively at interpersonal level and in teams.2. Demonstrate good interpersonal skills and effective communication in various professional,

business, social and cultural settings.3. Applyeffectivenegotiationstrategiesandconflictmanagementinbusinesscommunication4. Conduct effective technical and non-technical presentations for audience with different

backgrounds.

SYNOPSIS:The course covers principles of business communication and provides insights into real world business communication situations. It emphasizes on developing interpersonal skills, communicating effectively in teams and across different cultures. Students will learn how to write short business messages, short reports and proposals effectively. It also helps students master business presentation skills. This course also includes “invited speaker” sessions where experienced speakers from the targeted businesses are invited to share their experiences with the students.


COURSE CODE : SNB5062MODULE : Multinational Business & FinanceNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describe the various elements involved in international Business from different perspectives.2. Apply the principles and rules of strategic and operational managements to International

Business.3. Analyze the comparative financial structure and organizational design and operational

systems of International Business and their relationship to performance.4. To formulate the structural and behavioral pattern and trend of International business

SYNOPSIS:Thiscourseisanintroductorycourseonthemanagementofbusinessandinternationalfinance.It touches upon the international structure of business and environment to prepare students for international service and operations. This course also discusses how traditional business functionsareinfluencedbyculture,geographyandtechnology.






8.8 Dissertation ProjectCOURSE CODE : PAM5216 MODULE : Field Development ProjectNO. OF CREDIT : 6 creditsPRE-REQUISITE : All core disciplines in MSc Petroleum Engineering

MODULE OUTCOMES:1. Interpret and evaluate given dataset to estimate potential hydrocarbon in place.2. Analyze given dataset to develop plan to produce the hydrocarbon.3. Assess economic feasibility of the plan4. Demonstrate understanding of overall FDP workflow through written report and oral

presentation.

SYNOPSIS: The module integrates the learning outcomes of the taught modules. The main aim is to produce a field development plan based on real data.Themain learning outcomes are expected toenhance cognitive and core skills: team working, developing problem solving strategies etc.


COURSE CODE : PAM5226 MODULE : Individual Research ProjectNO. OF CREDIT : 6 creditsPRE-REQUISITE : Research Methodology

MODULE OUTCOMES:1. Analyze the problem and propose relevant solutions.2. Propose relevant methodologies to approach the problem.3. Execute proposed methodologies to come out with relevant results.4. Demonstrate understanding of the problem and its solution through written report and oral

presentation.

SYNOPSIS:The module allows each student to work on a piece of research independently. The student is expected to review the subject, propose an experimental/ analytical plan and follow that through to planning the work, schedule and report.

9.0 MASTER OF SCIENCE IN PETROLEUM GEOSCIENCES

9.1 IntroductionPetroleumGeoscienceisaninterdisciplinaryfieldthatappliesgeoscienceprinciplesandquantitativemethodsinthesearchanddevelopmentofcommercialoilandgasfields.It includes interpreting, predicting and managing risks and uncertainties in exploration and exploitation of hydrocarbon resources. At Universiti Teknologi PETRONAS, the MSc Petroleum Geoscience Programme is tailored to train young graduates and professionals from the industry in the full range of approaches, methods and techniques to explore and evaluatenewoilandgasfieldsandtocharacterizereservoirs.

Graduates with an MSc in Petroleum Geoscience degree will enhance their employment and career prospects in the global oil and gas industry. The degree is also a good starting point for a career in research and academia.

9.2 Programme Objective1. Science in Petroleum Geosciences specialists with insights to articulate complex



9.3 Programme Outcomes1. Demonstrate continuing advanced knowledge in Science in Petroleum Geosciences


2. Analyze and evaluate critically problems in Science in Petroleum Geosciences particularly in situations with limited information and to provide solutions through application of appropriate tools and techniques.

3. Appraise available information and research evidence in Science in Petroleum Geosciences and apply it in the engineering context.

4. Plan and perform research undertakings in Science in Petroleum Geosciences professionally, ethically and responsibly.


Petroleum Geosciences.


9.4 Programme Curriculum StructureEach student is required to complete 13 core modules, 2 management elective modules and 1 Industry Project. The programme curriculum structure is shown in the below table.

Table 10: MScPetroleum Geoscience Curriculum StructureMSc PETROLEUM GEOSCIENCE

CURRICULUM STRUCTURESchedule Category Course Cr Hr Status

Month 1 - 12

Technical Modules

QAM5112 Fundamentals of Petroleum Geology

QAM5213 Plate Tectonics, Structural Geology and Basin Evolution

QAM5223 Well Logging and Formation Evaluation

QAM5233 Advanced Sedimentology

QAM5243 Advanced Stratigraphy

QAM5313 Seismic Technology

QAM5323 Seismic Interpretation

QAM5413 Reservoir Characterization and Geological Modelling

QAM5423 Reservoir Engineering QAM5123 Geochemistry, Petroleum System & Basin Modelling

QAM5132 Basin Analysis and Evaluation

QAM5142 Prospect Maturation and Petroleum Economics

QAM5152 Petroleum System Field Work

2

3

3

3

3

3

3

3

3

3

2

2

2

Core

Core

Core

Core

Core

Core

Core

Core

Core

Core

Core

Core

Core


SBB5022 Business CommunicationSNB5052 Project Management

22

ElectiveElective

Month 13 - 16 QAM551A Industry Project 10 Core

Total 49


9.5 Core ModulesCOURSE CODE : QAM5112 MODULE : Fundamentals of Petroleum GeologyNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Apply basic petroleum geochemistry concepts and integrate basic geologic and geophysical

data in interpreting petroleum systems. 2. Conduct independent mapping and interpret sedimentology data for the generation of

geological sections and models.3. Analyze geological and geophysical data for the identification of possible hydrocarbon

plays. 4. Analyze data in the context of basin analysis and recommend exploration strategies.

SYNOPSIS:This module provides the fundamentals of petroleum geology with topics relating to the structure and geodynamics of the earth, processes of weathering and erosion affecting the earth, and formation of the various rock types and geological structures. The module also introduces the basics on geochemistry of a petroleum system and the various exploration techniques that are applied to discover and characterize a petroleum system.

COURSE CODE : QAM5213 MODULE : Plate Tectonic, Structural Geology and Basin Evolution NO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Construct evolution of geological structures in relation to plate tectonics. 2. Determine different types of basins structures encountered in oil and gas exploration.3. Interpret geological maps and geo-seismic sections to identify hydrocarbon traps.4. Develop a geologic framework for describing stages of basin evolution in South East Asia.

SYNOPSIS:This module addresses basin formation in the framework of plate tectonics and structural analysis. It provides an overview of the architecture of the different types of sedimentary basins, and includes exercises of seismic interpretation to correctly reconstruct the geometry of various traps. The course and related exercises will focus on two areas with a high oil and gas potential: South East Asia and the Arabian plate.


COURSE CODE : QAM5223 MODULE : Well logging and Formation EvaluationNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Interpret the geological logs at the well site by the Quick-Look-Method to discriminate the

hydrocarbon bearing zones and estimates the petro physical parameters, such as water saturation and porosity.

2. Quantitatively interpret well logs using commercial software for the petro physical parameters and log motifs of the formation

3. Usetheknowledgetointegrateingeologicalworkflowsforbasinanalysisandreservoircharacterization.

4. Calibratelogs,carryoutfaciesanalysisandrocktypedefinitionanddescription.

SYNOPSIS:This module provides the fundamental basics of drilling, well site geology and the conventional geological and petro physical log interpretation. Log data acquisition and tools principles will be presentedinordertohighlightthesignificanceoftherecordedparametersandtheimpactofuncertainties on the evaluation results. Both rapid evaluation of formation (“Quick Look”) and quantitative log interpretation will be practiced.

COURSE CODE : QAM5233 MODULE : Advanced SedimentologyNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Interpret the depositional environment of sedimentary rocks from cores, well logs and other

availabledata;andthedistributionofporosityandpermeabilityinareservoirasafunctionof the depositional and digenetic processes and facies.

2. Predict the lateral and vertical distribution of clastic and carbonate reservoirs based on the interpretation of the depositional environment.

3. Integrate the sediment logical interpretation in terms of textures and porosity types that will reflectinternalheterogeneitiesofreservoirs.

SYNOPSIS:This module aims to give students a detailed knowledge of clastic and carbonate depositional environments (continental, shallow marine, deep marine) and associated sedimentary architecturesandheterogeneities,asencounteredbothon thefield,well logsandcores. Itwill allow students to understand the formation of HC reservoirs, from deposition to burial and digenetic transformations. The analysis of the evolution of porosity and permeability in sedimentary rocks is also included.


COURSE CODE : QAM5243 MODULE : Advanced StratigraphyNO. OF CREDIT : 3 creditsPRE-REQUISITE : QAM52303 Advanced Sedimentology

MODULE OUTCOMES:1. Illustrate rock units in facies associations and system tracks.2. Build regional geological models and static reservoir models.3. Predict the areal and vertical distribution of rock types in a basin.4. Predictthedistributionandheterogeneityofreservoirsatafieldscale.

SYNOPSIS:This module covers the techniques to reconstruct the depositional evolution of sedimentary units, establish a rock unit framework and determine the internal geometry of clastic and carbonate deposits. It leads students to determine the key factors determining the petro physical properties of rocks at basin and reservoir scales to build geological models. The students will also conduct afieldtriptoSabahandSarawak.

COURSE CODE : QAM5313 MODULE : Seismic Technology NO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Use the principle of seismic methods and identify the various waves on seismic recordings.

They will distinguish the different choices of array and spread used in surface and well seismic surveys and of the successive processing sequences applied to the seismic data.

2. Design acquisition and processing sequence applied to the seismic data.3. Modelacousticandelasticwave-fieldpropagation.4. Apply basic techniques in seismic imaging processing.

SYNOPSIS:The module addresses imaging of subsurface by the seismic method. There is an introduction of wave propagation and an overview of the acquisition techniques and of the different of processing sequences with practical exercises. A particular attention is paid to the signal processing tools. Signal processing exercises are done with the help of a CD ROM.

COURSE CODE : QAM5323MODULE : Seismic InterpretationNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Apply newly acquired or improved skills to interpret 2D and 3D seismic on paper sections

and workstations.2. Construct structural pattern at basin and reservoir scale. 3. Carry out seismic quantitative interpretation for reservoir characterization and hydrocarbon

prediction through AVO and 4D seismic attributes interpretations.

SYNOPSIS:The first part will introduce the basis of seismic interpretation applied to structural analysisof sedimentary basin. Application of methods and tools will focus on a 3D survey over an oil fieldintheBaramDelta.Thesecondpartaimsatpresentingtheprincipleofcommonlyusedgeophysical methods (AVO/AVA, seismic inversion, and seismic attribute) for characterizing reservoirs.


COURSE CODE : QAM5413MODULE : Reservoir Characterization and Geological ModellingNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Implement integrated reservoir characterization methodologies to determine volumes of

oil-in-place.2. Integrate the effects of uncertainties on parameters and working hypothesis in economic

evaluation of the reservoirs.3. Efficiently use industrial software in reservoir characterization and reservoir modelling,

such as Petrel.

SYNOPSIS:This Module comprises of reservoir characterization and modelling routinely used in the in-dustry. The presentation will illustrate the stochastic and volumetric modelling, volumetric and uncertainties calculations. Geomodelling tools are used to assist in data integration among seismic production and well logs. New perspective in reservoir characterization and modelling is highlighted.

COURSE CODE : QAM5423MODULE : Reservoir EngineeringNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Characterisetherockandfluidthatgovernthestateoffluidflowinaporousmedium.2. Interpret well test in terms of reservoir geometry and boundaries.3. Differentiatebetweendifferentmechanismsofoilrecovery,fielddrainageandattributes.

SYNOPSIS:This module provides fundamental knowledge of reservoir engineering: rock characterization, reservoir fluid characterization, production mechanisms, field development strategy andintroduction to reservoir simulation. At the end of the course, the students will have a practical/ industry oriented knowledge to describe the behavior of a reservoir and understand the principles of reservoir engineering.

COURSE CODE : QAM5123MODULE : Geochemistry, Petroleum System and Basin ModellingNO. OF CREDIT : 3 creditsPRE-REQUISITE : QAM51102 Fundamentals of Petroleum Geology

MODULE OUTCOMES:1. Evaluate geochemical data for petroleum assessment of basin.2. Characterise and map the distribution of potential source rocks.3. Delineate oil and gas kitchens through time and space.4. Determine secondary migration pathways and volume and type of hydrocarbon being

trapped through time.5. Construct and interpret basin models.

SYNOPSIS:Thiscoursewillfocusfirstlyonthefundamentalsoforganicgeochemistryappliedtotheformationand to the analysis of oil and gas in sedimentary basin and to the assessment of petroleum systems. The second part will be devoted to the theory and practice of basin modelling using commercial software’s.


COURSE CODE : QAM5132MODULE : Basin Analysis and EvaluationNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Definedifferentpetroleumplaytypesandmaptheextentoftheplays2. Evaluate the risk associated with the plays 3. Apply the principles of high-resolution sequence stratigraphy, geopressure and thermal

regime to discriminate reservoirs.4. Evaluate prospects, identify their risk factors.

SYNOPSIS:The module addresses the basin analysis/basin evaluation as a tool for the choice of the acreage in the exploration process. It integrates data from structural geology, geochemistry, basin modelling, seen in previous modules and stratigraphic aspects seen within this module. Each chapter is illustrated by some examples and exercises.

COURSE CODE : QAM5142MODULE : Prospect Maturation and Petroleum EconomicsNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Carryoutinvestmentprofitabilitystudiesincludingallaspectsoffiscalterms.2. Determine risks in exploration account.3. Analyse the economic criteria of investment.4. Formulate recommendations to management on the basis of economic evaluations.

SYNOPSIS:The first part of this course in capital budgeting deals with the selection and valuationof investment projects within the upstream petroleum industry. It borrows elements from microeconomics, finance theory and oil taxation. The second part course presents allexploration, development and production techniques involved in the upstream business. With the support of a computer-assisted game, the tools used in the upstream petroleum industry will be introduced and manipulated, in order to acquire the vocabulary and the understanding of the techniques. Participants are invited to play roles in a business unit team, each of them will have the opportunity to get familiarised with different positions of an exploration/production company. At each step of the game, uncertainties in the techniques and in the business, will be introduced andassessed.Uncertaintyisalsopartofthefinalevaluationofthebusinessunitperformance.

COURSE CODE : QAM5152MODULE : Petroleum System Field WorkNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Illustrate the effective petroleum traps and their geologic controls.

SYNOPSIS:Thelocationsofthefieldworkshallbedeterminedaftercarefulcheckontheavailabilityofthepetroleum system parameters. Students shall analyse and interpret the data collected and present and document for assessment.


9.6 Management Elective ModulesCOURSE CODE : SNB5052 MODULE : Project ManagementNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Synthesize the different components involved in Project Management2. Design cost effective projects based on application of Project Management concepts,

practices & approaches3. Identify, evaluate, interpret, implement and control project outputs from a financial

perspective using the analytical tools and techniques 4. Construct and organize the inter-related components of project management in making

decisions when leading projects

SYNOPSIS:This course is designed to equip students with the tools and techniques in project management. This course will give students the opportunity to understand and apply the components in project management i.e. project life-cycle; strategy, structure and culture of project management;project selection; project leadership; scopemanagement; riskmanagement; cost estimationand budgeting; scheduling; resourcemanagement; project evaluation and control. Studentswill also be able to apply relevant tools and techniques to manage projects in a cost-effective manner.

COURSE CODE : SBB5022 MODULE : Business CommunicationNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Apply the principles and practices of professional written and oral communication skills to

communicate effectively at interpersonal level and in teams.2. Demonstrate good interpersonal skills and effective communication in various professional,

business, social and cultural settings.3. Applyeffectivenegotiationstrategiesandconflictmanagementinbusinesscommunication4. Conduct effective technical and non-technical presentations for audience with different

backgrounds.

SYNOPSIS:The course covers principles of business communication and provides insights into real world business communication situations. It emphasizes on developing interpersonal skills, communicating effectively in teams and across different cultures. Students will learn how to write short business messages, short reports and proposals effectively. It also helps students master business presentation skills. This course also includes “invited speaker” sessions where experienced speakers from the targeted businesses are invited to share their experiences with the students.







9.8 Dissertation ProjectCOURSE CODE : QAM551AMODULE : Industry ProjectNO. OF CREDIT : 10 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Analyseprojectsproposalswithrespecttospecificobjectives.2. Designwork-flowofanindividualprojectwiththeend-resultinmind.3. Effectively carry out and evaluate best practice of project tasks.

SYNOPSIS:The projects are provided by the industry in topics among others are: Basin evaluation, Reservoir modelling, Seismic Technology, prospect maturity and non-seismic technique. The total duration of the project is 4 months with months of project proposal and examination and preparation of finalreportondissertation.

10.0 MASTER OF SCIENCE IN PROCESS INTEGRATION

10.1 IntroductionProcess Integration is a systematic design methodology that addresses issues related to energyefficiency,wasteminimizationandanefficientuseofrawmaterials.Currentlytheconceptual design stage is greatly facilitated by the use of simulations, either in a design of a new plant or in conducting improvement studies in an existing.

However, the simulation approach suffers from lack of synthesis capability and inability to provide an overall contextual overview of the entire plant. This drawback at the conceptual design stage will have serious consequences in determining the environmental impact, economic viabilityandsafety featuresof thefinal designandKnowledgeofProcessIntegrationisessentialinarrivingatbetterdesignsthatwillmeetthecallsforefficiencyintheuseofenergy,efficiencyintheuseofmaterialsandreductionofemissions.The MSc in Process Integration is an internationally recognized degree that will allow graduates to enhance their career opportunities in industry, research establishments or the academia.


10.2 Programme Objective1. Science in Process Integration specialists with insights to articulate complex



10.3 Programme Outcomes1. Demonstrate continuing advanced knowledge in Science in Process Integration


2. Analyze and evaluate critically problems in Science in Process Integration particularly in situations with limited information and to provide solutions through application of appropriate tools and techniques.

3. Appraise available information and research evidence in Science in Process Integration and apply it in the engineering context.

4. Plan and perform research undertakings in Science in Process Integration professionally, ethically and responsibly.


Process Integration.

10.4 Programme Curriculum StructureEach student is required to complete 6 core modules, 4 modules for each specialization, 2 management elective modules and dissertation projects. The programme curriculum structure is shown in the below table.

Table 11: MSc Process Integration Curriculum Structure

MSc PROCESS INTEGRATIONCURRICULUM STRUCTURE

Category Course Cr Hr Status

Core Modules

1. EIM5022 Modelling

2. EIM5042 Process Safety

3. EIM5052 Optimisation

4. EIM5012 Heat Integration

5. EIM5032 Cogeneration and Site Utility System

6. EIM5414 Design Projects

7. EIM5228 MSc Dissertation

2

2

2

2

2

4

8

Core

Core

Core

Core

Core

Core

Core


(Choose 2 only)




4. SNB5062 Multinational Business Finance

2

2

2

2

ME

ME

ME

MEUniversity

Requirement 1. SNB5032 Research Methodology 2 UR, P/F


Specializations Group - Choose only 1 (one) from any of the following groups

Environmental Process Design

1. EIM5173 Cleaner Production

2. EIM5183 Environmental Design for Atmospheric Emissions

3. EIM5193 Environmental Design for Aqueous Emissions

4. EIM5153 Synthesis of Reaction and Separation System

3

3

3

3

TE

TE

TE

TE

Advanced Chemical

Process Design

1. EIM5153 Synthesis of Reaction and Separation System

2. EIM5133 Advanced Distillation Design

3. EIM5163 Design of Fine and Speciality Chemicals

4. EIM5143 Operability and Control

3

3

3

3

TE

TE

TE

TE

RefineryDesignand Operation

1. EIM5113RefineryandPetrochemicalProcesses

2. EIM5123RefineryOptimisation

3. EIM5133 Advanced Distillation Design

4. EIM5143 Operability and Control

3

3

3

3

TE

TE

TE

TE

TOTAL 38NoteUR: University RequirementME: Management ElectiveTE : Technical ElectiveP/F: Pass or Fail

10.5 Core ModulesCOURSE CODE : EIM5022 MODULE : Modeling NO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Apply the concepts and techniques to build mathematical models for physical and chemical

systems.2. Perform sensitivity analysis on and evaluate the mathematical models of physical and

chemical systems for use in process design.3. Use thermodynamic models to simulate and predict the behaviour of chemical systems.

SYNOPSIS:OverviewonModelingConcept;MathematicalModeling,ModelBuilding,DevelopingConstitutiverelations by experiment and correlation, Sensitivity and simulation Analysis, Chemical Modeling, Pressure-Volume-Temperature, Phase equilibrium and thermodynamic properties, Liquid phase no ideality.


COURSE CODE : EIM5042 MODULE : Process Safety NO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Identify the major hazards and assess the risk encountered in the process industries.2. Apply suitable mitigation measures to eliminate or minimize such hazards.

SYNOPSIS:Overview on Safety, Toxic Hazards, Release Modeling, Fire and Explosion, Pressure Relief System,ReactorSafety,Storage,HazardIdentification,RiskAssessment.

COURSE CODE : EIM5052 MODULE : OptimisationNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Formulate different types of optimization problem.2. Apply the optimization methods for optimum synthesis and design of chemical processes.

SYNOPSIS:Overview on Optimisation Basics, Theory and Methods, Model Building, Applications.

COURSE CODE : EIM5012 MODULE : Heat IntegrationNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Perform energy targeting for heating and cooling utilities required by a chemical process

using basic techniques developed in Pinch Technology.2. Designing optimal Heat Exchanger Network to achieve the targeted energy consumption

by a chemical process.3. Apply extended techniques developed in Pinch Technology for designing optimal process

flowsheetorforretrofittingexistingprocessforimprovement.4. Assess the economic implications of implementing various design solutions developed.

SYNOPSIS:Introduction to Heat Integration, Energy Targets, Pinch Design Methods, Capital Cost Targeting, Automated Design, Integration of Heat Engine and Heat Pumps, Integration of Reactors and Separators,ProcessModifications,DataExtraction.

COURSE CODE : EIM5032 MODULE : Cogeneration and Site Utility Systems NO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Calculate and design the elements in site utility systems.2. Identify cogeneration potentials within site utility systems.3. Apply the concepts, techniques to design, cogeneration and site utility systems in process.4. Assess the economic implications of implementing various design solutions developed.

SYNOPSIS:Introduction to Cogeneration and Site Utility Systems, Furnaces, Steam Systems, Site CompositeCurves,Optimizing Steam levels, Top LevelAnalysis, SiteRetrofit,GasTurbineIntegration, Driver selection, Site Power to Heat Ratio, Refrigeration Systems.


COURSE CODE : EIM5414 MODULE : Design Projects NO. OF CREDIT : 4 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Apply the process integration knowledge in designing and revamping of a process plant

SYNOPSIS:Practical Aspects – applying process design tools in the design projects.

10.6 Technical Electives

10.6.1 Environmental Process Design SpecialisationCOURSE CODE : EIM5173 MODULE : Cleaner ProductionNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Apply the methodologies for the analysis and mitigation of environmental impacts.2. Discuss the environmental issues in the process industries.

SYNOPSIS:Introduction,WasteIdentificationandMinimisation,LifeCycleAssessment,MaterialsRecycling,Legislative and Economic Aspects of Cleaner Production, Industrial Ecology.

COURSE CODE : EIM5183 MODULE : Environmental Design for Atmospheric EmissionsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Identify different types of atmospheric emissions, the sources and the impacts on the

environment2. Apply an integrated approach for the minimization of atmospheric emissions of particulates,

volatile organic compounds (VOC) and greenhouse gases from chemical processes and sites

SYNOPSIS:Introduction, Remediation Processes, Control of VOC, Emissions, Control of Nox, Emissions, Control of Flue Gas Emissions.

COURSE CODE : EIM5193 MODULE : Environmental Design for Aqueous EmissionsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Design processes to minimize aqueous waste, with particular emphasis on how to reduce

at source, reuse, recycle and regenerate water within a chemical site.2. Designeffluenttreatmentsystems

SYNOPSIS:WastewaterMinimisation,EffluentTreatmentSystemDesign,WasteMinimisation.


COURSE CODE : EIM5153 MODULE : Synthesis of Reaction –Separation SystemsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Choose the most appropriate reactor and separator2. Synthesize and optimise systems involving reaction and separation3. Perform preliminary economic evaluation on the reactor and separation system4. Reduceprocesshazardsviaintensificationandattenuationofhazards

SYNOPSIS:Process Economics, Choice of Reactor, choice of Separator, Synthesis of Reaction-Separation Systems, Reactive Distillation, Economic trade-offs, reducing Process Hazards.

10.6.2 Advanced Chemical Process Design SpecialisationCOURSE CODE : EIM5153 MODULE : Synthesis of Reaction –Separation SystemsNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Choose the most appropriate reactor and separator2. Synthesize and optimise systems involving reaction and separation3. Perform preliminary economic evaluation on the reactor and separation system4. Reduceprocesshazardsviaintensificationandattenuationofhazards

SYNOPSIS:Process Economics, Choice of Reactor, choice of Separator, Synthesis of Reaction-Separation Systems, Reactive Distillation, Economic trade-offs, reducing Process Hazards.

COURSE CODE : EIM5133 MODULE : Advanced Distillation DesignNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describe the mathematical model of a distillation column and the thermodynamic properties

required.2. Performthedesignofdistillationcolumn–simpleandcomplexconfiguration.3. Determinetheoptimalsequencingofdistillationcolumns(simpleandcomplexconfiguration)

toundertakespecifiedseparationtaskinvolvingmulticomponentmixture.4. Perform energy analysis based on thermodynamic approach of distillation system for

process improvement.5. Perform the analysis required for the synthesis and design of an azeotropic distillation

system.6. Assess the economic implications of the developed solutions for the distillation design.

SYNOPSIS:Distillation Design, Column Sequencing, Thermodynamic Analysis of the Distillation Column, CrudeOilDistillationDesign,RetrofitDesignofDistillationSystems,RepresentationofTernaryMixtures, Azeotropic Distillation, Azeotropic Distillation Sequence Synthesis.


COURSE CODE : EIM5163 MODULE : Design of Fine and Speciality Chemicals ProcessesNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Perform synthesis of integrated solutions to the problems related to fine and specialty

chemicals manufacturing2. Implementoptimizationtechniquesforthemanufacturingoffineandspecialtychemicals

SYNOPSIS:Introduction, Batch Unit Operations, Bioprocess Technology, Batch Process Synthesis, Scheduling of Batch Processes, Batch Plant Engineering, Environmental Protection.

COURSE CODE : EIM5143 MODULE : Operability and ControlNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Model simple and moderately complex dynamic systems2. Select an appropriate control strategy and design the key parameters for that strategy3. Apply the control concepts and principles into design projects

SYNOPSIS:Introduction,ControlConfigurations,UnitOperationControl,ControlofCompleteProcesses,Dynamic Behaviour, Feedback Controller Design, Model Based Control, MIMO Systems, Operability and Continuous Process.

10.6.3 RefineryDesignandOperationSpecialisationCOURSE CODE : EIM5113 MODULE : RefineryandPetrochemicalProcessesNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describe various process technologies used in petroleum refining and downstream

petrochemical processes.2. Designanintegratedpetroleumrefiningandpetrochemicalprocessestomaximizeprocess

efficiency.

SYNOPSIS:CrudeOilandRefineryProducts,CrudeOilDistillation,OctaneProcesses,Hydroprocessing,Heavy End Processes, Light End Processes, Lube Oils, Sulphur Recovery, Petrochemical Processes,RefineryIntegration,HydrogenIntegration.


COURSE CODE : EIM5123 MODULE : RefineryOptimisationNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Performsystematicanalysisofrefineryoperations.2. Implementoptimizationtechniquesforrefinerydebottlenecking.

SYNOPSIS:RefineryProcessesandOperation,GeneralSystemRepresentationandSimulation,Modelingof Large Systems, Rigorous Models vs Simple Models, Advanced Mathematical Programming, Applications.

COURSE CODE : EIM5133 MODULE : Advanced Distillation DesignNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describe the mathematical model of a distillation column and the thermodynamic properties

required.2. Performthedesignofdistillationcolumn–simpleandcomplexconfiguration.3. Determinetheoptimalsequencingofdistillationcolumns(simpleandcomplexconfiguration)

toundertakespecifiedseparationtaskinvolvingmulticomponentmixture.4. Perform energy analysis based on thermodynamic approach of distillation system for

process improvement.5. Perform the analysis required for the synthesis and design of an azeotropic distillation

system.6. Assess the economic implications of the developed solutions for the distillation design.

SYNOPSIS:Distillation Design, Column Sequencing, Thermodynamic Analysis of the Distillation Column, CrudeOilDistillationDesign,RetrofitDesignofDistillationSystems,RepresentationofTernaryMixtures, Azeotropic Distillation, Azeotropic Distillation Sequence Synthesis.

COURSE CODE : EIM5143 MODULE : Operability and ControlNO. OF CREDIT : 3 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Model simple and moderately complex dynamic systems2. Select an appropriate control strategy and design the key parameters for that strategy3. Apply the control concepts and principles into design projects

SYNOPSIS:Introduction,ControlConfigurations,UnitOperationControl,ControlofCompleteProcesses,Dynamic Behaviour, Feedback Controller Design, Model Based Control, MIMO Systems, Operability and Continuous Process.


10.7 Management Elective ModulesCOURSE CODE : SNB5022 MODULE : Strategic ManagementNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil





















COURSE CODE : SNB5062MODULE : Multinational Business & FinanceNO. OF CREDIT : 2 creditsPRE-REQUISITE : Nil

MODULE OUTCOMES:1. Describe the various elements involved in international Business from different perspectives.2. Apply the principles and rules of strategic and operational managements to International

Business.3. Analyze the comparative financial structure and organizational design and operational

systems of International Business and their relationship to performance.4. To formulate the structural and behavioral pattern and trend of International business

SYNOPSIS:Thiscourseisanintroductorycourseonthemanagementofbusinessandinternationalfinance.It touches upon the international structure of business and environment to prepare students for international service and operations. This course also discusses how traditional business functionsareinfluencedbyculture,geographyandtechnology.







10.9 Dissertation ProjectCOURSE CODE : EIM5228MODULE : MSc DissertationNO. OF CREDIT : 8 creditsPRE-REQUISITE : Final Semester Standing with minimum CGPA 3.00

MODULE OUTCOMES:1. Apply the research methods through carrying out a major project of independent research.2. Demonstrate the applications of methods and tools acquired from the process integration

modules carrying out a project.

SYNOPSISLiterature Review, Project Planning and methodology, students will select their projects from a list offered.


11.0 MASTER OF SCIENCE IN PROCESS SAFETY

11.1 IntroductionThe programme has been designed to accommodate the ever-increasing demand and ashortageofprocesssafetyprofessionalsinMalaysiaandalsoinAsiaPacificregion.The recent statistics in this region show a tremendous development of Major Hazard Installations indicating the requirement for more industrial practitioners who could manage process safety hazards. The main objective of this programme is to deepen understanding and equip the students with advanced skills and expertise in process safety, loss prevention and risk assessment. Therefore, by working closely with the Process Safety professionals, centres and institutions, we have jointly developed a distinguished and leading MSc Process Safety programme in this region.

11.2 Programme ObjectiveThe objective of the programme is to produce graduates who are able to apply process safety knowledge and manage risk towards prevention, mitigation and response of major accidents and losses in process installation

11.3 Programme OutcomesThe aim of offering an MSc in Process Safety is to provide graduates and practicing engineers with advanced knowledge for safer design and operation of processing plant topreventmajoraccidentsspecificallyfire,explosionandtoxicrelease.Therefore,upongraduation the candidates shall be able to:

1. Apply advanced knowledge and skills in process safety for safer design and operation at all asset lifecycle stages

2. Investigate, analyse and solve process safety issues based on interpretation of available data and synthesis of relevant information including lesson learned from previous major accidents

3. Utilize a range of tools, techniques and methodologies to identify, manage, and control process safety issues

4. Comprehend professional responsibilities and identify technical and legal requirements for process safety practices

5. Communicate effectively on process safety activities as individual, member or a leader in a team with the engineering community and society at large

11.4 Programme Curriculum StructureEach student is required to complete 5 core modules, 3 elective modules, 2 management elective modules and industrial/research based projects. The programme curriculum structure is shown in the below table.


Table 11: MSc Process Safety Curriculum Structure

MSc PROCESS SAFETY CURRICULUM STRUCTURE

Category Course Cr

Hr

Status

Core Modules 1.

2.

3.4.5.6.

CAM5114 Principles of Process Safety ManagementCAM5123 Principles of Hazard Analysis & Risk ManagementCAM5133 System Safety EngineeringCAM5144 Safe Design & OperationCAM5153 Human FactorsCAM51710 Industrial/Research Based Project

4

3

343

10

Core

Core

CoreCoreCoreCore

Elective Modules 1.2.3.4.5.

6.

7.

CAM5213 Fire & Explosion EngineeringCAM5223 Industrial Hygiene EngineeringCAM5233 Quantitative Risk AssessmentCAM5243 Process Plant Integrity & ReliabilityCAM5253 Incident Prevention & Emergency ManagementCAM5263 Environmental Risk & Impact AssessmentEMM5083 Corrosion Engineering

33333

3

3

ElecElecElecElecElec

Elec

Elec

Management /Business Electives

(Choose 2 only)

1. 2. 3.

SFB5012 Engineering EconomySNB5052 Project ManagementSNB5022 Strategic Management

222

MEMHMH

TOTAL 40


11.5 Core ModulesCOURSE CODE : CAM5114MODULE : Principles of Process Safety ManagementNO. OF CREDIT : 4 credits NO. OF REQUISITE : Nil

MODULE OUTCOMES:1. Implement PSM in workplace based on regulatory and standards requirements 2. Conduct audit for improvement of PSM3. Assess process safety performance through leading and lagging indicators

SYNOPSIS:The course focuses on Process Safety Management (PSM) in the workplace. The course cover topics learning from incidents, need to manage safety, regulations on PSM, PSM elements, planning and implementing. The course will also include the measure audit and review, safety management systems in major hazards, process safety performance measurement and safety leadership to enhance PSM in processing industries.

COURSE CODE : CAM5123MODULE : Principles of Hazard Analysis & Risk ManagementNO. OF CREDIT : 3 credits NO. OF REQUISITE : Nil

MODULE OUTCOMES:1.Describeprinciplesofhazardidentificationandriskassessment2.Applyappropriatetechniquesforhazardidentificationandriskanalysis.3. Evaluate risk assessment to manage risk.

SYNOPSIS:The course is explaining about hazard analysis and risk assessment and its application to the processing industries. The course covers topics on hazards, risk, risk analysis, probability and reliability, hazard analysis and awareness, PHA tools (HAZOP, HAZID, FMEA etc.), bow-tie diagrams, the principle of risk management. The course will also include the consequence analysis, risk contributors, risk values, risks, communication and safety culture to enhance process safety in processing industries


COURSE CODE : CAM5133MODULE : System Safety EngineeringNO. OF CREDIT : 3 credits NO. OF REQUISITE : Nil

MODULE OUTCOMES:1. Analyse system, subsystem, operating and support hazard analysis

2. Detect and diagnose faults using FTA, ETA, FMEA, FMECA3. Evaluate risk based on LOPA assessment and case study on SIS.

SYNOPSIS:

This course is aimed to enhance students’ knowledge of the introduction to system safety engineering, safety performance measurement, preliminary hazard analysis, fault detection and diagnosis. The course also covers topics on the subsystem hazard system, system hazard analysis and operating and support hazard analysis. The analysis for failure modes and effects and LOPA are also will be discussed.

COURSE CODE : CAM5144MODULE : Safe Design & OperationNO. OF CREDIT : 4 credits NO. OF REQUISITE : Nil

MODULE OUTCOMES:1. Apply strategies for safe design and operation 2. Implement suitable Inherently Safer Design alternatives at different asset lifecycle stage3. Formulatesafedesignstrategiestopreventlossofcontrolleadingtorelease,fire,explosion

or runaway reaction4. Design strategies for pressure protection and disposal system.

SYNOPSIS:This course is aimed to enhance students’ knowledge of the designs for process safety strategies, a layer of protection and inherently safer design strategies. The course also covers topics on the pressure relief system and sizing and relief piping and disposal system. The designs to prevent fireandexplosion,dustexplosionandrunawayreactionarealsowillbediscussed.


COURSE CODE : CAM5153MODULE : HUMAN FACTORSNO. OF CREDIT : 3 credits NO. OF REQUISITE : Nil

MODULE OUTCOMES:1. Assess human factors that contribute to major accidents2. Use appropriate human factor approaches to prevent accidents3. Assess and improve safety culture in workplace.

SYNOPSIS:

Thecourseisexplaininghowhumanfactorsinfluenceshumanbehaviourinawaywhichcanaffect process safety performance at all levels of an organisation. The course covers topics on human factors’ key issues, factors affecting human performance and systematic approaches in predicting and reducing human error. The course will also include case studies to assess human error in the process industry and propose human error prevention techniques to enhance process safety.

COURSE CODE : CAM51710MODULE : Industrial/Research Based ProjectNO. OF CREDIT : 10 credits NO. OF REQUISITE : Nil

MODULE OUTCOMES:1. Apply the knowledge and skills on process safety aspects to solve the project independently2. Communicate effectively on process safety issues through written and presentation of the

project.

SYNOPSIS:The module allows each student to work independently on an industry-based project under the supervision of a faculty member and/or a supervisor from the industry. The student is expected to review the subject, propose an experimental or analytical plan and follow that through to feasibility study, investigation, design / simulation, test and implementation. Each student must prepareacomprehensivetechnicalreport,presentanddemonstratefindingsandresultsoftheproject work.


11.6 Elective ModulesCOURSE CODE : CAM5213MODULE : Fire & Explosion EngineeringNO. OF CREDIT : 3 credits NO. OF REQUISITE : Nil

MODULE OUTCOMES:1. Assessfireandexplosionhazards2. Implementfireandexplosionpreventionandprotectionsystems3. Formulatefireandexplosionprotectionmanagementsystems.

SYNOPSIS:This course is aimed to enhance students’ knowledge of the fundamental theory of firesandexplosionand firehazardanalysis. It also covers topicson fire riskassessment, protection and prevention strategies, the installation, inspection, testingandmaintenanceoffireandexplosionprotections.

COURSE CODE : CAM5223MODULE : Industrial Hygiene EngineeringNO. OF CREDIT : 3 credits NO. OF REQUISITE : Nil

MODULE OUTCOMES:1. Explain the legal and standard of health and safety in Malaysia and the international

standards.2. Assess the health hazards to prevent possible injuries and illness3. Apply safety principles on new and existing design related to industrial hygiene.

SYNOPSIS:Thiscoursecoversthefollowingtopics:buildingandfacilities;ergonomics,materialhandlingandstorage;machineguarding;welding;electricalhazardsandnoise.


COURSE CODE : CAM5233MODULE : Quantitative Risk AssessmentNO. OF CREDIT : 3 credits NO. OF REQUISITE : Nil

MODULE OUTCOMES:1. Identify relevant principles for quantitative risk assessment2. Perform quantitative risk assessment according to the regulations and standard

requirements3. Apply appropriate methods and processes for risk control and reduction.

SYNOPSIS:This course provides the opportunity to learn about risk, the applications of risk involved with industrial activities, and how to practice risk-informed decisionmaking and risk management. Because engineering is a decision-making enterprise, a decision-making way of thinking is used throughout the course.

COURSE CODE : CAM5233MODULE : Process Plant Integrity & Plant ReliabilityNO. OF CREDIT : 3 credits NO. OF REQUISITE : Nil

MODULE OUTCOMES:1. Classify, synthesize and detect failures2. Evaluate and implement reliability models in design and operation3. Strategize and develop reliable maintenance program.

SYNOPSIS:This course is aimed to enhance students’ knowledge on system failure prediction, failure rate data and synthesis of failure, types of uncertainty, reliability concept and theory. The course also covers topics on the failure distribution, mean time between failure, structural reliability and availability modelling. The strategy for equipment critically, assessment and maintenance also will be discussed.


COURSE CODE : CAM5253MODULE : Incident Prevention & Emergency ManagementNO. OF CREDIT : 3 credits NO. OF REQUISITE : Nil

MODULE OUTCOMES:1. Classify the types and level of emergencies 2. Develop emergency response planning system 3. Perform incident investigation.

SYNOPSIS:Thiscoursecoversthefollowingtopics:naturalandman-madeemergenciesanddisaster;managingandplanning,controlling,financialriskinmajoraccidenthazard;fireemergencyresponse;communicationandevacuationprocedure;emergencyoperationandmanagement;emergencyplanandpreparedness;incidentinvestigationanduseofincidentstatistics

COURSE CODE : CAM5263MODULE : Environmental Risk & Impact AssessmentNO. OF CREDIT : 3 credits NO. OF REQUISITE : Nil

MODULE OUTCOMES:1. Apply appropriate methods and processes for managing containment and spills of

hazardous waste2. Assess hazardous waste site emergencies and apply techniques to handle and response

to the situations3. Perform Environmental Impact Assessment according to the regulations and standard

requirements

SYNOPSIS:This course explains about the container and spill management and containers of hazardous waste. The course also covers topics on the clean-up of spills and hazardous waste site emergencies. The environmental control, noise and environmental impact assessment are also will be discussed.


COURSE CODE : CAM5083MODULE : Corrosion EngineeringNO. OF CREDIT : 3 credits NO. OF REQUISITE : Nil

MODULE OUTCOMES:1. Explain the various corrosion mechanisms & prevention methods2. Describe various corrosion forms3. Explain different corrosion testing methods 4. Justify appropriate corrosion prevention methods for any corrosion case given5. Describe different degradation of materials.

SYNOPSIS:This course covers corrosion principles & theory, forms of corrosion, corrosion prevention, corrosiontesting,andcorrosioninspecificenvironments.

11.7 Management Elective Modules

COURSE CODE : SNB5052MODULE : Project ManagementNO. OF CREDIT : 2 credits NO. OF REQUISITE : Nil

MODULE OUTCOMES:1. Synthesize the different components involved in Project Management2. Design cost effective projects based on application of Project Management concepts,

practices & approaches3. Identify, evaluate, interpret, implement and control project outputs from a financial

perspective using the analytical tools and techniques 4. Construct and organize the inter-related components of project management in making

decisions when leading projects.

SYNOPSIS:This course is designed to equip students with the tools and techniques in project management in the energy industry.This course will give students the opportunity to understand and apply the components in project management i.e. integration, scope, time, cost, quality, resource, risk, procurement and HSE. Students will also be able to apply relevant tools and techniques to manage energy projects in a cost effective manner.


COURSE CODE : SNB5012MODULE : Engineering EconomyNO. OF CREDIT : 2 credits NO. OF REQUISITE : Nil




3. Discuss and solve problems related to the advanced topics such as interests, depreciation, incometaxes,effectof inflation, tools forevaluatingalternatives,capitalfinancing,replacementanalysisandprojectriskanduncertainty

SYNOPSIS:This course will cover the fundamental concept of engineering economics and its principles, methodology and application of the various methods as well as discussion on issues related to the economics of various engineering projects.

5STUDENT AFFAIRS

1.0 HEALTH, SAFETY AND ENVIRONMENTThe University adopts and practices health, safety and environment policies provided by the law. Before being offered admission to the University each candidate is required to fulfillallhealthrequirementsasperGuidelinesforMedicalExaminationandInsuranceissued by The Malaysian Ministry of Education.

Any candidate who is found to have any of the diseases/disorders that prohibits registrationduringaverificationprocessbyUTP’sHealthCentrewillnotbeadmittedtothe University. International students will be required to return to his/her home country at his/her own expense.

UTP students are obliged to comply with all government and University laws and regulations with regard to Health, Safety and Environment.

It is the responsibility of each student:

To take precautions to safeguard one’s own health and safety, as well as others. This may be affected as a result of one’s actions or ignorance.To support the University’s personnel in implementing the relevant laws and regulations.To wear and/or use proper/required clothing and safety equipment to avoid any risk against health and safety.To obey all instructions and follow all health and safety procedures prescribed by the University.To report to any University personnel immediately of any case of accident, dangerous occurrence, poisoning and infectious disease.To avoid disturbances or misuse of equipment for health and safety precautions.

Students who fail to comply with the above laws and rules may be suspended for a specifiedperiodof timeordismissedoranyotherpenaltydeemednecessaryby theUniversity.

2.0 FACILITIES

2.1 Facilities and ServicesFacilities and services are provided by the University to fulfill academic and non-academic requirements e.g. lecture theatres, laboratories, and information technology and sports facilities.


3.0 INTERNATIONAL STUDENTSThe University is providing services and organizing programmes that support the development and welfare for the international students such as immigration regulatory advising and processing, cultural adjustment, social enrichment, and assistance with practical matters related to living in Malaysia. For detailed information, the students may refer to the International Student Welcome Guide.

4.0 COUNSELING

4.1 Counselling ServicesThis unit is responsible to provide counselling services and assist students in personal growth and development. Students may access to our services voluntarily by walk-in, appointment, e-mail, and via phone or being referred by any University departments.(NOTE: Students may refer to the UTP website for further details.)

5.0 CO-CURRICULLUM ACTIVITIES

5.1 Sports & RecreationThis unit is responsible in management and co-ordination of UTP sports activities. This includes the organizing, managing and coordinating games and competition internally or externally, planning and training of UTP sport teams and providing the required sport equipment. In addition, this unit is responsible in managing and overseeing the UTP sport complex facilities and sport equipment. All facilities and services are opened to students and staff of UTP.

The sports activities sports is divided into two (2) categories which is Sports for Excellence and Sports for Fun.

Sports for excellence is to enhance and develop sport to the highest level and outstanding achievement, while sport for Fun is focusing more on UTP sports activities in order to create a vibrant campus environment. Among the activities that have been conducted are running, kayaking and Frisbee.

6.0 POSTGRADUATE STUDENT COUNCIL (PGSC)Postgraduate Students Council (PGSC) provides a platform for students, Centre for Graduate Studies (CGS) and the administration of UTP to interact.

6.1 VisionA platform between students, Centre for Graduate Studies (CGS), and the administration of UTP via the Postgraduate Students Council (PGSC) of Universiti Teknologi PETRONAS (UTP).


6.2 Mission1. As a medium of interaction between post-graduate students, Centre of Graduate

Studies (CGS) and the administration of UTP via the Postgraduate Student Council (PGSC) of Universiti Teknologi PETRONAS,

2. To enhance the unity of postgraduate students of Universiti Teknologi PETRONAS towards a healthy lifestyle and academic achievement,

3. To provide a welfare support for postgraduate students of Universiti Teknologi PETRONAS

7.0 STUDENT DISCIPLINARY RULES AND REGULATIONSStudents must abide to the rules and regulations stated in the *Student Disciplinary Rules and Regulations”.

APPENDIXAPPENDIX I: PAPER PUBLICATION

Application for Paper Publication by Postgraduate student.

STUDE

NT

CGS

DEPA

RTMEN

TCH

AIR

BUDG

ET REV

IEWER

CGS/RIO

1. Received Accepted notification from conference organiser/journal publisher

2. Fill‐up Application for

Paper Publication

4. Check & endorse the quality of the paper

submitted. *

5. Dean approval on the application

6. Submit request for travelling

Check & endorse the travelling requisition

EndREJECTED

APPROVED

REJECTED

APPROVED

REJECTED

APPROVED

Using CGS Financial Allocation Using Research Grant

3A. CGS validate student eligibility

3B. RIO validate funding availability

REJECTED REJECTED


APPENDIX II:APPOINTMENT OF SUPERVISOR

Appointment of Supervisor Process

CGS

STUD

ENT

SUPE

RVIS

OR

1. Students submit appointment of supervisors form

4. Dean approval 5. i) Update supervisors record.ii.) prepare official appointment of supervisors’

letter.

6. Dean signature on the official appointment of supervisors’ letter

7. Issue official appointment of supervisors’ letter

8a. Student receive a copy of the official supervisor’s appointment

letter

YESNO

8b. Supervisor acknowledgement of the appointment2.Supervisor

Verification

Change of Supervisor

Process

3. CGS Verification

YES

NO

YES

NO

Step Duration

1 -

2 1 wd

3 1 wd

4 1 wd

5 1 wd

6,7,8a,8b 1 wd

Appendix 129

APPENDIX III: APPLICATION FOR CHANGE OF SUPERVISOR

Changing of Supervisor Process

CGS

STUD

ENT

DEPT

SUPE

RVIS

OR

1. Students submit request to change of supervisor

4. Dean approval 5. i) Update supervisors record.ii.) prepare official change of supervisors’ letter.

6. Dean signature on the official appointment of supervisors’ letter

7. Issue official change of supervisors’ letter

8a. Student receive a copy of the official supervisor’s appointment

letter

YESNO

8b. Supervisor acknowledge the appointment

2.Dept Academic Committee Deliberation & Recommendation

(HOD/DHOD, Ex SV, Cluster Leader)

NO

Step Duration

1 -

2 5 wd

3 1 wd

4 1 wd

5,6,7 1 wd

3.CGS ValidateNO

YES

YES

MergedFile - Universiti Teknologi Petronas...2. Simulates the bloom of a floralbud while injecting a graphic outline of the PETRONAS Twin Towers. 3. Reflects the beginning of a journey

Documents